2E5OA

'solution structure of the trip_4c domain of target of activating signal cointegrator 1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
154
structure length
154
Chain Sequence
GSSGSSGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activating signal cointegrator 1
publication title Solution structure of the TRIP_4C domain of target of activating signal cointegrator 1
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 27
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04266 ASCH ASCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.30 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Hypothetical protein. 2e5oA00
1XNEA 1S04A 3IUWA 1WK2A 2Z0TA 2DP9A 2E5OA 2KKUA 1TE7A
chains in the Genus database with same CATH superfamily
3M65A 1XNEA 3M6WA 3M6VA 2AB4A 3ZV0C 1WXXA 4TZ4C 1ZS7A 1Q7HA 2AUSA 2B78A 3M6UA 3LWRA 3LWVA 3VSEA 1SQWA 1J2BA 3C0KA 4Q1TA 2CX1A 2J5TA 3M4XA 3HJWA 2CX0A 1WXWA 2FRXA 3U28A 3LJCA 3LDFA 1IT7A 2APOA 2Z0TA 4CI2B 3LWPA 2RFKA 2KKUA 3MQKA 1ZE1A 2J5VA 2Q07A 1K8WA 2ANEA 3HJYA 4CI3B 1R3EA 1IQ8A 1SGVA 1ZBOA 4CI1B 3LWOA 2E5OA 1ZL3A 2EY4A 4DMGA 1UOYA 3D79A 2HVYA 1TE7A 3UAIA 1S04A 3HAXA 1IT8A 2CWWA 3IUWA 3M6XA 2AS0A 1R3FA 3LWQA 1WK2A 2DP9A 1ZE2A 2P38A 1T5YA
chains in the Genus database with same CATH topology
1XNEA 1S04A 4P78C 3IUWA 1WK2A 4C26A 2Z0TA 2DP9A 2E5OA 2KKUA 1TE7A 1WHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNE A;  1S04 A;  3IUW A;  1WK2 A;  2Z0T A;  2DP9 A;  2E5O A;  2KKU A;  1TE7 A; 
#chains in the Genus database with same CATH topology
 3M65 A;  1XNE A;  3M6W A;  3M6V A;  2AB4 A;  3ZV0 C;  1WXX A;  4TZ4 C;  1ZS7 A;  1Q7H A;  2AUS A;  2B78 A;  3M6U A;  3LWR A;  3LWV A;  3VSE A;  1SQW A;  1J2B A;  3C0K A;  4Q1T A;  2CX1 A;  2J5T A;  3M4X A;  3HJW A;  2CX0 A;  1WXW A;  2FRX A;  3U28 A;  3LJC A;  3LDF A;  1IT7 A;  2APO A;  2Z0T A;  4CI2 B;  3LWP A;  2RFK A;  2KKU A;  3MQK A;  1ZE1 A;  2J5V A;  2Q07 A;  1K8W A;  2ANE A;  3HJY A;  4CI3 B;  1R3E A;  1IQ8 A;  1SGV A;  1ZBO A;  4CI1 B;  3LWO A;  2E5O A;  1ZL3 A;  2EY4 A;  4DMG A;  1UOY A;  3D79 A;  2HVY A;  1TE7 A;  3UAI A;  1S04 A;  3HAX A;  1IT8 A;  2CWW A;  3IUW A;  3M6X A;  2AS0 A;  1R3F A;  3LWQ A;  1WK2 A;  2DP9 A;  1ZE2 A;  2P38 A;  1T5Y A; 
#chains in the Genus database with same CATH homology
 1XNE A;  1S04 A;  4P78 C;  3IUW A;  1WK2 A;  4C26 A;  2Z0T A;  2DP9 A;  2E5O A;  2KKU A;  1TE7 A;  1WHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...