2AS0A

Crystal structure of ph1915 (apc 5817): a hypothetical rna methyltransferase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
396
structure length
396
Chain Sequence
MARVVVDAQAARAIGKGAMIVFKKGVVRVEGDIKPGDIVEVYTRGGKFLGKGFANPNSNIMVRIVTKDKDVEINKDLFKRRIKKANEYRKKVLKYTNVYRMVYGEADYLPGLIVDRFNDIASLQISSAGMERFKLDVAEAIMEVEPGIETVFEKNTGRSRRREGLPEIERVLLGKEKYRTIIQEGRAKFIVDMRGQKTGFFLDQRENRLALEKWVQPGDRVLDVFTYTGGFAIHAAIAGADEVIGIDKSPRAIETAKENAKLNGVEDRMKFIVGSAFEEMEKLQKKGEKFDIVVLDPPAFVQHEKDLKAGLRAYFNVNFAGLNLVKDGGILVTCSCSQHVDLQMFKDMIIAAGAKAGKFLKMLEPYRTQAPDHPILMASKDTEYLKCLFLYVEDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1915
publication title The crystal structure of a novel SAM-dependent methyltransferase PH1915 from Pyrococcus horikoshii.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 130
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase
A PF17785 PUA_3 PUA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2as0A01
3.30.750.80 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA RNA methyltransferase domain (HRMD) like 2as0A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2as0A03
3ERCA 4EKGA 5T6BA 3BXOA 3CJQA 1R8XA 1P39A 3DP7A 3L8DA 3PTAA 1AV6A 1UFKA 3ER9A 1G55A 2UYQA 1SKMA 3GDHA 4A6DA 2IDKA 3DH0A 4KIFA 3SR4A 3ER8A 2XYRA 3FUWA 4P58A 2FRXA 2Z6UA 4MHTA 2O06A 2VZ9A 2AZTA 3EVCA 3UZUA 4RTPA 2NXCA 3BGIA 4F86A 2BR3A 2J5TA 3BZBA 2FK8A 3P9IA 5LQCA 4H0NA 3LDGA 4PIPA 3SX0A 1RJEA 4PONA 5IH3A 4E2YA 1KPGA 1SQFA 1MJFA 1FP1D 2PXAA 5EMMA 1F38A 3UJ9A 3MERA 3KQVA 2K4MA 2HR1A 4RSRA 2EJTA 3LBYA 9MHTA 3EVFA 2B78A 3HTXA 5EPEA 5KS2A 5GINE 3C6MA 2IIPA 3THRA 3OFKA 3CBGA 5EVJA 1RI1A 5DLYA 1L1EA 5EIWA 1ZE1A 3KU1A 3HVIA 5EHIA 3PS9A 5CCXA 1NW5A 5DRYA 4AZTA 3LL7A 4FSDA 3TRKA 4DF3A 5FUBA 2I62A 2FK7A 2C7PA 3THSA 5DXAA 2I9KA 2ZWAA 3GNLA 5EZSA 3FPFA 4BP3A 2P40A 3G88A 5KQSA 1FP2A 3CGGA 3KQQA 1ZE2A 3PFGA 4YMGA 3FPEA 4HC4A 4K6MA 2ZZKA 3DTNA 2OYRA 3A26A 2IFTA 4P7JA 2BR5A 1ZGAA 5FA8A 2BH2A 3LKZA 5MHTA 2JHPA 2IPXA 2PGXA 3NDJA 3SSNA 4RTJA 1JG4A 5DM1A 4ER5A 2PX4A 1ZHFA 2AOXA 1IY9A 2QY6A 1XDZA 2WA1A 4LG1A 4KIGA 2ZIEA 4V0RA 5C0OE 1VL5A 3MGGA 3M6UA 3RW9A 4RTOA 4QQNA 4FR0A 4PCAA 1N7JA 4CKCA 3CJTA 3R24A 2I7CA 3PX2A 3NW9A 3QV2A 5DX1A 3RODA 3DXXA 5JUWA 4GOND 1O54A 3K6RA 4QTUB 2B25A 2ESRA 3JWJA 1KIAA 5LSAA 1VP3A 3EPPA 5DM4A 4U7PB 1I4WA 1VLMA 3SGLA 4RTMA 4KRGA 1EG2A 1WS6A 3HCEA 4LWOA 5CVEA 2JHAA 5EEGA 2HV9A 2ONZA 2YR0A 4E2WA 4E30A 3IV6A 4DA4A 5ICFA 2YXEA 1HNNA 4PYNA 5LQKA 3FTCA 1EIZA 1NV8A 3A4TA 3CVOA 3OU2A 4M37A 4OBXA 5FQOA 4Y30A 5DSTA 5K0NA 3FZGA 2ZWVA 1R8YA 2DPMA 3WSTA 3LGAA 4OX9Y 5EKXA 1RI5A 2HMYB 5GP1A 2PX8A 3LSTA 1J2BA 4GC5A 3BKWA 3BUSA 3I58A 3FPGA 2BZGA 3ELUA 2OB1A 4QPNA 3CKKA 2AN4A 5DTQA 5E9JA 5FWDA 2H11A 2PXCA 1KR5A 3UA4A 3GRVA 1ZKDA 1NV9A 4HRAA 1ORIA 4PYLA 3G5TA 3KQPA 4PNEA 1TPYA 3DLCA 3ELWA 4FT2A 2ZCJA 8MHTA 1JSXA 4IKPA 1WXWA 1B42A 1YZ3A 2CMHA 2ZFUA 4RTQA 5BXYA 4MWZA 3PFHA 1RJFA 2VS1A 3UJAA 1YF3A 2NYUA 1EJ0A 2PBFA 3I5UA 3CJRA 5T67A 3OPNA 5EMJA 4E31A 1AQIA 2BM9A 2G72A 2XVMA 2ZLBA 5EC8A 3RIEA 3P8ZA 2EFJA 2P41A 1PJZA 4HH4A 1L3IA 4P7GA 1G60A 3KQTA 3FUXA 3GRUA 5BP7A 1JQEA 3DR5A 5BW5A 2JH9A 5DTRA 5LQJA 4M7RA 5GIOE 2V74B 5DWQA 3LDUA 2ZZMA 4OQEA 1P1BA 2H1RA 4E2ZA 3M6XA 2GS9A 4PGGA 3QOXA 5LQNA 5LR6A 1K8WA 3O31A 2GH1A 3FUUA 4UOEA 1VIDA 1ZQ9A 2YX1A 3UJ8A 3KPVA 3MTIA 3GRYA 4RVGA 4ER0A 1KYZA 4WVLA 5FULA 3M70A 3NWEA 1XTPA 5DM0A 2PKWA 4C4AA 1VP9A 5E8JA 3TFWA 2GA9A 1PRYA 5CCBA 5DTMA 1Z3CA 1L3BA 2ERCA 5HEKA 2BR4A 2FYTA 2NXEA 3JWIA 2IH5A 1BHJA 1VPTA 3TKYA 2B2CA 4XUDA 2B3TA 2AVDA 1HMYA 2FCAA 3P97A 1R74A 3BGVA 2AN5A 3G8BA 1XXLA 5K0FA 2O57A 2AOTA 4RTKA 4YV0A 3NVMB 3P2KA 4DQ0A 4DMGA 5B1SA 1WZNA 2XVAA 2G71A 1Q0TA 3DULA 3FTFA 1YB2A 2IP2A 1O9HA 4QVKA 1NW6A 1FPQA 2EJUA 2IDJA 1Q7HA 2ZBPA 2ZTHA 2CX0A 3HVKA 4PYMA 5E8RA 3R9XB 3DXYA 2NXJA 1RI3A 4BP1A 2PWYA 1D2HA 2CWWA 1SQGA 1AF7A 2VDVE 3A25A 3GGDA 5EIFA 3SVZA 2Z6QA 4RVFA 5HIJA 2OPBA 3TMAA 2P3OA 3T7SA 3ME5A 1VQ1A 4Y2HA 5EZQA 1G6Q1 4DM3A 5K05A 5K09A 3B5IA 3G2MA 4YUVA 4YV1A 4OBWA 1XVAA 4Q1TA 5FWAA 2PSSA 2AOUA 3BWCA 3HP7A 3IYLW 4AZWA 4R8SA 1RJDA 3LHDA 3EEYA 2ORED 3K0BA 1QAMA 1NBIA 2YQZA 3P2EA 2G8NA 3PB3A 4KDRA 2OXTA 5H02A 2QRVA 3EVAA 3F4KA 3DOUA 5K0BA 2PT9A 3SXJA 5HZMA 3NVKI 3M33A 5FHRA 3FUVA 4ATNA 4RYLA 4FSXA 2ZULA 3BWYA 4FP9A 1WXXA 2JJQA 1XCLA 1BC5A 5CVDA 3EMDA 2O05A 1JQDA 4RVDA 2VDWA 2PXXA 2CKDA 2NP7A 4F84A 4QTTB 3V97A 1NKVA 5GWXA 5ICGA 2O07A 4YUZA 3OZSA 5DSXA 1X1DA 1WY7A 5FHQA 1NBHA 1ZG3A 3OU6A 4P7FA 4GOMD 10MHA 3HEMA 3GU3A 1KPIA 1QZZA 4ER7A 1SQWA 5HOQA 2GAFA 4HGYA 3UJCA 5FCDA 3T7RA 5E2BA 1D2GA 5D1HA 2R3SA 3UJ7A 5BW4A 1YFJA 3EVEA 3P9NA 3UJ6A 4EQZA 3TM4A 3KKZA 2OO3A 3DMHA 4GBED 5HIKA 1NT2A 2WK1A 1INLA 1T5YA 1KPHA 1D2CA 2EX4A 3PLAE 1JTFA 2O0LA 3Q7EA 5P8WA 5ERGB 5T64A 4RTLA 3MHTA 3M6VA 4QDKA 1R18A 5HFJA 3GRZA 5HIMA 3BKXA 3MB5A 4IV0A 2C7RA 5G02A 3C3YA 4LECA 4E2XA 3OCJA 4HTFA 3TLJA 3EVGA 1DCTA 3SSMA 4NECA 4RVHA 5CM2Z 2FPOA 5D1NA 3TKAA 4CWAA 2P1DA 3FRIA 1IXKA 1L3CA 3GJYA 1Y8CA 3O4FA 3S68A 4C04A 4XCXA 4BLVA 5HIIA 4M38A 5GIPE 3GCZA 4PINA 2UYCA 2QYOA 3PT9A 3R0QA 4X60A 1QAQA 1OR8A 4KDCA 1VE3A 4E33A 4RTRA 1QANA 3B89A 3LECA 4QVGA 3ANXA 5HILA 2GB4A 1AQJA 2YXLA 4QDJA 1XDSA 3KR9A 1WG8A 3VYWA 1F3LA 3TM5A 1JG1A 3LCCA 4BY9E 1L9KA 2Y1XA 5M5BA 2YUIA 1O9GA 2ZVJA 3G2OA 3HVJA 4RTSA 1U2ZA 4X1OA 2AOTB 4PYQA 1QYRA 3MCTA 2CX1A 2PY6A 4C03A 3NDIA 5C1IA 4AZSA 3JWHA 4JXJA 3C0KA 4MTLA 2A14A 2XBMA 2EG5A 4FT4A 5K0EA 2AS0A 2P35A 1SG9A 4OQDA 5GOZA 4YUXA 3H2BA 3LX6A 2IH4A 1KYWA 3OE5A 2NXNA 3M4XA 1T43A 4DCMA 4HSGA 4FS8A 5CVVA 4FZVA 3D2LA 3U81A 2GPYA 3HCCA 2P3QA 4XUCA 4R05A 3IHTA 5EG5A 3I9FA 3TR6A 2PX5A 3DMGA 1H1DA 1BOOA 2AOUB 1NE2A 2AVNA 3A27A 3BWMA 3KQYA 7MHTA 1P91A 3KPWA 5LQRA 4KVZA 2G1PA 3GIWA 4BLWA 4CKBA 4X41A 5FA5A 2QRVB 3EVDA 3P9KA 5EHGA 2CL5A 5CIYA 1QAOA 3GXOA 2CMGA 1G38A 3AXSA 4X61A 4P7KA 1M6EX 1UWVA 4G56A 1X19A 3LCUA 4AX8A 3FRHA 3HCAA 4C06A 2LD4A 3E05A 4GUAA 1ORHA 3HCDA 3GO4A 2OBFA 3G89A 1Q0SA 2FHPA 2HTEA 3HA7A 3UWPA 3HVHA 2XYVA 1SGVA 3I53A 2PV0A 1XDUA 3IEIA 4E70A 1IT8A 2PT6A 1X1AA 2G70A 3HA3A 4PIMA 4PYJA 5JR3A 3FTEA 5DM2A 3KR1A 4A6EA 5K0LA 1VBFA 3O7WA 5U4XA 4YUYA 4GF5A 5EEHA 1JSZA 5K01A 3FYDA 1JG3A 2ZZNA 3AWIA 4L7VA 4CTJA 1V39A 4RV9A 5K0GA 1EQAA 1JR4A 2JH8A 2YVLA 3HM2A 1KXZA 2ZBRA 3FPJA 2NNWB 3G5LA 4IV8A 3REOA 5KQRA 1N2XA 4F85A 3UA3A 3OFJA 3HCBA 2P3LA 5DPMA 1M6YA 5KYGA 3ELDA 3LBFA 3DMFA 3GWZA 5E1MA 2H00A 3UAIA 3OE4A 5GM2A 1SUSA 2PWPA 2J5VA 2ZBQA 1SVUA 4PYKA 2VDUE 3E23A 5DX0A 5DT2A 1R6AA 3LKDA 1NW8A 2OKCA 1TW3A 2I6GA 5CVJA 4HGZA 1I9GA 4B17A 4DCGA 2AN3A 3ID6C 4YUWA 5ICEA 2IBTA 2AR0A 3SM3A 3I64A 2ZSUA 3LDFA 2IBSA 4CKEA 2ZW9A 4HTFB 5GM1A 2HNKA 3JWGA 4O29A 2C7OA 3OU7A 1IM8A 2BM8A 4Z2YA 1RJGA 3AXTA 4CTKA 1KHHA 5E1DA 5K03A 5E1OA 2HWKA 3FYCA 4R6XA 4GQBA 3VC2A 1YFLA 4GC9A 2AB4A 2Q07A 2ZIFA 3MQ2A 3SSOA 3A7EA 3NWBA 3TQSA 1M0EA 1R00A 2XYQA 3KR2A 4EK9A 1G8AA 5K0JA 3GRRA 3EGEA 3DUWA 1N7IA 4GEKA 2PLWA 4FGZA 3SMQA 3KHKA 1YZHA 2PVCA 4QPPA 3Q87B 3AY0A 4M36A 3VC1A 2P8JA 2P38A 1FJXA 4RX1A 4DKJA 3C6KA 1JTEA 4R6WA 2IGTA 4CXMA 2Z6AA 4WXHA 3X0DA 1P1CA 5E9WA 3TPZA 1DL5A 3UJDA 2F8LA 1JQ3A 3DLIA 3EGVA 3KR0A 5E9QA 4C07A 1R3EA 3LCVB 2OZVA 4X63A 2PX2A 5FQNA 4QQKA 2C7QA 2UYOA 4MQ4A 2E5WA 3T7TA 5LQUA 3M6WA 3OZTA 3G7UA 4AUKA 4EKIA 1MHTA 3BWBA 3ELYA 1ZGJA 5EQJB 3HCFA 3MAGA 4OA8A 1XCJA 3FTDA 4RWZA 3G2PA 2PJDA 3HA5A 5EMLA 1RI2A 2JHCA 3B3JA 3T0IA 3ORHA 4E32A 4YV2A 1RI4A 2OB2A 5EMKA 1TW2A 2QM3A 1XJ5A 4PYOA 5EKUA 5F2KA 5FTWA 2IH2A 1FBNA 4PCLA 3NTVA 3OZRA 5K8VA 1BKYA 2ZIGA 2P7HA 2YTZA 3BGDA 4KWCA 2V7EA 1X1CA 1KP9A 5F2NA 2OY0A 3E8SA 3B3FA 1I1NA 1IQ8A 2KW5A 3R3HA 3TOSA 5E2AA 3P2IA 1SUIA 1YUBA 3B3GA 1G8SA 5CVUA 2UYHA 1R3FA 1UIRA 4U7TB 3EEOA 4V0QA 4KW7A 1DUSA 3HNRA 3C3PA 3KQMA 3R6TA 3QOWA 4PWYA 2WA2A 3KQOA 3KPYA 2JG3A 3NMUF 1EAMA 4AZVA 2DULA 2B9EA 5CUQA 4ISCA 5K0CA 4PYIA 3V8VA 5EOVA 4EMSA 4ER3A 5F2OA 3EVBA 3PX3A 2UZ4A 5IKMA 4C08A 4YMHA 4ER6A 4EVIA 3BT7A 1IT7A 3PVCA 2AOVA 3NJRA 5LQAA 4XUEA 3EGIA 5CD1A 3MTEA 2ADMA 1X1BA 4C05A 3P9CA 3UBTA 4ZTBA 2NP6A 3EVZA 3FUTA 5DRTA 3CC8A 5ICCA 3LPMA 4LWPA 3CCFA 4GOOD 5E1BA 3AJDA 3KQWA 2P7IA 1ZL3A 1ZS7A 2N47A 3D79A 1EJ6A 4POOA 2ONYA 4BLUA 5C9ZA 5DX8A 2QE6A 3FPHA 3VSEA 4PGHA 4MIKA 1NW3A 1JG2A 3DXZA 3A7DA 4HG2A 5EGSA 4IWNA 3KPJA 3KQSA 3UJBA 4RTNA 3P71T 3MCZA 2AOWA 3UFBA 3G2QA 2GLUA 4GOLD 3E7PA 2Y1WA 5FADA 2Q41A 2VP3A 3EMBA 1NW7A 3KPUA 2YXDA 4DZRA 5DXJA 5KVAA 2R6ZA 4OA5A 4R8RA 3B7PA 3G8AA
chains in the Genus database with same CATH superfamily
1V8FA 3E58A 2FB9A 5F9FA 2WV9A 1WSAA 5G1OA 1AK2A 4OXIA 3WRYA 3DMTC 2OFWA 1TZCA 2XB6A 1IE3A 1TJYA 1FVXA 1UBEA 1TM3E 2O20A 2WMOB 2R8EA 4FWBA 4AY2A 4PLCA 4LWZA 2ASVA 1BE6A 4KIFA 3WBJA 2BMJA 4DHWA 3FOEC 3FUWA 4PW0A 1WCV1 1ZESA 3NIWA 5B53A 3I2JA 5HP4A 1S2IA 4MGIR 3GROA 3T8YA 5IFLA 3NAMA 1EFRA 3D4IA 2J5KA 3STXA 4AS1A 1SRQA 3S2ZA 3VDXA 3BSYA 1VL8A 3WGNA 1EX1A 1PNOA 2I3DA 4MR7B 5FUYA 4EPXA 1FP1D 5KU1A 3PDJA 3OJEA 3UOGA 4BE4A 6ABPA 2CF6A 2H2HA 1OU4A 3VTAA 2JK1A 4I1RA 3GOQA 1UMKA 4RK6A 1E8MA 4POAA 1QDEA 3DVAA 3I1JA 2ZB4A 3S4YA 2VP5A 3DCYA 5DLYA 3TNLA 1L7MA 1ZGHA 3Q1LA 3NP9A 5CCXA 5BN1A 1JAYA 2V7QD 3T1OA 4G5QA 3ZV5A 2EGGA 2I62A 1ISHA 4KQHA 3X2EA 5EZSA 1H69A 2NTEA 4S1OA 2ZYDA 1DOAA 3MMXA 4UPVA 1A50B 1J8FA 4B87A 4YCLA 1P2FA 5DYNA 3KDSE 2N75A 3ZC3A 3EIEA 3LV8A 2FFBA 2O1XA 4R7GA 1HORA 2OVBA 2GPNA 3I76A 5L3SB 1IXSB 2PL1A 3G0OA 2P30A 4YY3B 3E9QA 4IINA 5JSFA 2OXRA 2QI9F 5AI5A 5JS2A 4V3BA 3AY6A 3KP1A 2NO4A 3VBCA 2Q4EA 4IRXA 3RGGA 3TIFA 2BMWA 5DMXA 1KRWA 1AUVA 1HA3A 2PUFA 1O9BA 4ARZA 4UZFA 4EI2A 4R40A 5JY1A 3ZVKA 2Z43A 3SVLA 1VM6A 3R24A 1LLFA 1Z0KA 1N57A 4KSYA 5BT9A 4KBGA 1XL0A 3B6ZA 3TTWA 1Z34A 1Z18A 1Z5UA 1E8NA 4G81A 3EIQA 1O58A 3QVXA 4IKOA 2CVQA 1BEUB 3ND8A 3KTAB 4LYYA 4V02A 4YRZA 4C0QC 3UWMA 5FOQA 5K3CA 3FNGA 4IEEA 3PUVA 5EEGA 3BGOS 1WHSB 2ONZA 3KV3O 2FZVA 3WYGA 2Y0CA 4E2WA 1VFNA 3TSCA 4M22A 1JVBA 1M8KA 4L57A 4TLBA 1K7CA 3ZWQA 1II8A 3RRZA 1LK0A 4JODA 4C22A 2NXWA 1TT7A 3W5CA 4J76A 1JIXA 3KDPA 4WLNA 4UARA 2CC2A 1B8PA 5EKXA 2QZSA 4L6CA 3BL5A 3EULA 1P1RA 2DPLA 2HA5A 2WWWA 3AB7A 3DO6A 5CXSA 5FWDA 4PN7A 5ITZA 4AMBA 2VTDA 1KQFA 3SS9X 5KYWB 3PUIA 1V5EA 4NPCA 4QRIA 4YX9A 1ZKDA 1NV9A 2GHQA 2Y2UA 4Q9LA 4XLTA 4MQMA 1CUIA 4ZOQI 3L8ZA 4E5NA 4DRXB 3I9V6 2HK7A 3COYA 4TKUA 4U8HA 4BE7B 4D81A 4QDXA 3ZY4A 2VYNA 3B82A 1MP0A 3I37X 2DKOA 3UJAA 1G6HA 2HU5A 1ENPA 3KXLA 3OPQA 1ZOPA 3CMCO 1L7NA 5C8XA 2A1UA 1F8FA 1ZP6A 1OYVA 2OHGA 4Z53A 3TIXB 3DOCA 3RSHA 2C2HA 1HDRA 2JGAA 1EVKA 3EASA 3NPMA 2PZLA 1KBQA 4LIPD 2G8LA 2YS6A 3KOZA 5M3BA 1F2TA 3F98A 4IO0A 1AURA 1MEJA 2VCHA 1YBFA 1REQA 2QTAA 2YWRA 3C4VA 4UCQA 4DJDC 3HC7A 1OBVA 3X1WA 2PZFA 1I8TA 1ST2A 2JCYA 2P90A 1Q16A 2W4QA 4JBXA 3ACBA 3H3XA 2FZCA 1C2YA 3W4JA 1OBHA 4ZQIA 5HR5A 2VK2A 3EHEA 3UEOA 3E5HA 1ZQ9A 3KPVA 1FNCA 1N6HA 4MDHA 3W8NA 4YJ2B 1KYZA 2HT1A 1KEUA 4UEKA 2D2EA 4XI9A 3CWCA 5DW0A 4RM2A 4FVTA 2EP7A 1DSSG 1XNQB 5DTMA 2ERCA 3CUUA 1WNFA 2FYTA 4G67A 4HMOA 2O2CA 1C81A 2GF9A 5F23A 4RC9A 2AUSA 1Z7EA 3IURA 4R1MA 2UYCA 3JQFC 5CB8A 1IONA 1K8XB 1R0YA 2OSBA 3Q7PA 5DFAA 3WLQA 1N0UA 5IRCD 1OAOA 1VKRA 1Z12A 4GRAA 2D62A 4LBYA 6REQB 5KYYB 4D7AA 1EP9A 4NABA 1MB9A 4M9RA 1IHYA 1XLTC 3MTGA 2V0NA 1NZFA 1O5TA 1P9WA 1G5TA 3GHHA 3OUZA 4JQOA 4BP1A 4GAEA 3QA9A 4LF5B 3KVYA 5JCJA 4KLCA 1LXCA 1DV1A 3C15C 2VJMB 1EFUA 3A9CA 1EXNA 2WKWA 2C0QA 2GILA 3F74A 1XK6A 1Y82A 3IB6A 4M9CA 3TLXA 3WLSA 4QLBA 3HMQA 4OBWA 5C7OO 5TSDA 3IYLW 4RORA 1K7EB 1T4BA 1U8UA 3QBEA 1FYDA 3K0BA 1C7RA 1NBIA 3AHIA 1KJZA 2QDXA 4JLSA 2IEIA 5HZHA 3FOZA 1JXOA 1ZIXA 3RUCA 4ZJUA 1CUZA 4N8EA 3RC7A 2QD3A 3W78A 5IARA 3NVKI 3FUVA 4O2AB 1IPHA 1ESDA 3LAWA 3GJ3A 4E11A 1NUSA 2FW9A 5BPFA 3P96A 1K4YA 4KGXA 5CVDA 3HWX1 3UV6A 3BQMB 3KKNA 4HD8A 1BO6A 4COOA 4NBLA 1KU0A 1GG2A 4JYBA 4LE2A 5JNUA 2XPCA 2FMTA 2EP5A 3T3IA 4JCCA 1R9GA 2RHCA 3IXQA 1UJMA 1NG1A 4WXRA 1F2DA 3CZQA 4MVJE 1DDIA 4CN8A 1J7JA 1JE0A 2EBHX 2V65A 1J0AA 1UPCA 2DR0A 4Q9NA 4DT1B 4JI8B 1TO6A 4B3XA 4DMMA 3IELA 4L8GA 1VJCA 2VAVA 1U81A 3LX8A 1SZDA 3H5NA 3H9GA 4HADA 2QLFA 3K9QO 5ILQA 1MX5A 4A2QA 2R3SA 1U2DC 2JAWA 3FB1A 4ZQGA 4ZVSA 2XZOA 1E0AA 1T5HX 4XJVA 3UJ6A 2FW6A 4KQFA 2UUCB 2YNMD 1LC3A 3D31A 2CD7A 3QLUC 2OO3A 4NULA 1B0AA 2WK1A 4LHZA 2GPWA 2O5VA 4N7JA 4UATA 1ZJYA 5J59A 4H6XA 4R41A 3QLVC 3OD5A 5JQWA 3OIDA 2WP0A 4BYGA 1FDIA 3TL3A 2Y1CA 3JR3A 2ZYTX 5HE8A 3D6NB 4L5CA 4BN0A 4DVJA 4EDFA 2JCGA 4HX2A 4LOHA 1F4LA 2C7RA 3Q98A 4EZEA 4H7DA 5G02A 4EYKA 4MIYA 1UBKS 4AWXA 4AJHA 3HNOA 2VDMB 1V8OA 4R4JA 3TLJA 1RLOA 1ESEA 2COUA 4J75A 1K9SA 1RCUA 2B9VA 5K51A 5EJIA 4MQFB 3O8NA 4CUKA 5FX2A 3EZXA 1NMQA 1FNDA 4IF6A 4QNRA 1NMZA 1VPEA 3IUYA 1HDYA 1CUFA 2AUTA 2XBLA 3AGPA 3P9RA 4LI3X 4UFPA 2JI9A 3OKFA 3ZZNA 1YR7A 1QS0A 4FYYA 1NGSA 1X0VA 2DRIA 4MV9A 3VNBA 6LDHA 3THYA 3SZUA 3K72B 3L8EA 2HNBA 3CKLA 4X1OA 2C2KA 2FXIA 2GGSA 2XUZA 5IAOA 3ZWKA 1NVVQ 3JR7A 3RVJA 2XGOA 3RRYA 2DPGA 2B8NA 1R4ZA 5T8KC 1JR6A 4I9GA 4RMGA 5AVWA 4UOQA 4EUHA 4F5YA 4DEXA 2XH8A 5IJ0B 3KVNA 1XK7A 3V8BA 1U2PA 1HE4A 1WPRA 1BEEA 1X7WB 4RV5A 3M3DA 3IDFA 4DCMA 4HSGA 3EGOA 3CSSA 1T13A 2GPYA 3HCCA 2P62A 3PYLA 4FDTA 4AWAA 4KRFA 5EG5A 4G5YA 5JYCA 1WE2A 1W2GA 4B79A 1KO5A 1I6WA 2E6KA 5HMLA 1E61A 2FW1A 3HKDB 1KJIA 4JBWA 4KG7A 1J6UA 4KE9A 1K3TA 4BX8A 3OQMA 3TR5A 3NX4A 1V8DA 4U7DA 3OJ0A 3OMXA 2Q1YA 2CL5A 4ZAYA 1TGVA 3IH8A 3NEYA 4QATA 2PUGA 2EJCA 4IQFA 3C1AA 4EW6A 4OK3A 2AJLI 4DJTA 5ILOA 2QLBA 2R1VA 1GZ4A 2P9GA 1DV2A 3R7SA 2AFHA 3EQ2A 3FNRA 4M1MA 3TECE 1KI2A 4B7XA 4CF7A 3HADA 4E70A 1U99A 5DYGA 2HTFA 2YRWA 3MRVA 821PA 1JU3A 5ED4A 1GFIA 1JA0A 4IBOA 4KK3A 2G25A 3KB8A 3UMMA 5EEHA 2IPLA 2COEA 1BOFA 2WIBA 1SKAA 2G5PA 3P45A 5CA1B 2GR9A 1DAEA 4L7VA 2WF9A 1Z6AA 4L5AA 2FUCA 1YQ9A 1PR6A 4N5MA 3C3WA 1BXKA 4RV9A 3RJ5A 5INTA 3OIUA 4FPXA 2NNWB 1IMJA 4QOHA 1SU8A 4QU0A 2NZWA 4PEVA 3S44A 2FDXA 2JB9A 4KIJA 4P4GA 3V7NA 3ES9A 4MWGA 2G1AA 1GZHB 3SE7A 1PFUA 1UJ4A 1KJ8A 4DJJA 3LBFA 1IUOA 2Z83A 3QMWA 3TW6A 4OV6B 2QMQA 3CINA 3ZJTA 2VPYA 4AP6A 3PNMA 2XMCA 2WNIA 2H4JA 2GVDC 5J2TF 5KHLB 1UZMA 1D7AA 1KEEA 3OCZA 1LJLA 3B48A 4I9UA 5CDSA 5AVUA 3V2UA 4C4OA 1FW6A 4DRZA 2YZMA 3JXEA 2P8SA 3N2LA 2XXBA 1DKMA 4PZEA 5CPBA 3PQ4A 3UOWA 4YAIA 1Z2AA 4XM0A 2C7OA 3DV0B 4C6HA 4EJ2A 4FMDB 1VC2A 4PF1A 5ALLA 4L74A 5E6SA 4F5WA 5BYKA 3VC2A 5J2UA 1QRSA 1J1UA 2R62A 3MQ2A 4TXJA 4DR6B 1M0EA 4FNAA 4EHFA 1KMCA 1VJGA 2Q45A 4K6GA 2OOSA 5HX7A 5IM4F 1SQSA 2GERA 3IOBA 3OQNA 1PZMA 3OECA 2B5OA 3GRRA 1AV7A 4HFNA 2GN0A 4D2IA 1CVRA 3KHKA 1N9KA 1C9JA 2OO5C 4C6TB 4BNFA 5AM2A 1R3DA 1Y8QB 2P2LA 2R7MA 1N5OX 3MFYA 4M3NA 1LQ2A 1MAVA 4K1LA 1NN1A 1UBRS 1G7CA 2G4VA 4Z0NA 1VCMA 4DJFC 1KVQA 2IPAB 4ZVLA 3VYVA 4DR7B 3WKDA 1YB1A 3VHQA 1QE0A 4CODB 4WXHA 4XGRA 3WIOA 5IZ4A 4FNOA 4ZZ2A 3DLIA 2AFRA 3EGVA 1E18A 2ZS7A 3MRSA 1O6GA 3OF3A 3VOAA 4K40A 3ZTTA 3DT9A 4ALNA 4DANA 2QMZA 1BRTA 2PIAA 3MILA 2HT6A 3AF2A 3NBUA 4AQ7A 3OZAA 4HFRA 4I4CA 1EXMA 1JKIA 3L1IA 3QZUA 4LRUA 5AP9A 3UK6A 4EQ6B 4N39A 5JQGF 2P9JA 5B2FA 2I34A 3N05A 3ETJA 1ZICA 5BVHA 5ADWA 1LF0A 4GO1A 1LTQA 2HC9A 1Y1QA 3CS3A 3HA5A 3NWOA 2JHCA 2XUPA 1XZ8A 4O2BF 5FA6A 4E32A 4HPJB 2VZ0A 3NDPA 1XJ5A 1T2AA 5KDOA 3E5RA 1X9IA 4FWIB 1M2JA 4UD2A 4A5SA 1Z7WA 2OORA 4E4YA 1QLWA 3CLRC 2BEVB 4ZMRA 1ILEA 1N2CE 3X44A 4FCWA 1QGAA 2X8AA 1G21E 2QKYA 2YXNA 1QC5B 1NVVR 4FQ8A 4MRVA 3S2UA 2XGMA 1JDTA 3KYCB 3ZTWA 1ZK4A 3UENA 1ZNXA 3AP3A 4EFLA 1MA3A 3DOOA 4FOLA 4OHXA 4YFYA 5U4QA 2FX3A 3IQHX 3ZE2B 5CLFA 4MPDA 1IWBB 3IAXA 4MVYA 3V4LA 3C8ZA 4O1HA 1ABFA 3U3MA 2O8FA 3KQMA 1CJVC 3FW1A 2OQIA 2C5HA 1LRJA 3NALA 5I7AA 3MF4A 3VHRA 2CNLA 4OI0A 4CEIB 3G5MA 2CSXA 1HG1A 3OQOA 3GLSA 6AT1A 1TQHA 2BWJA 3BOSA 3D0QA 4TLCA 1D3AA 2B4KA 3KOOA 4ZVPA 3NCHA 5B7QA 1CBUA 2W8ZA 3K09A 4ROSA 1H0SA 2NSJA 4DMCA 2IHVA 3R77A 2G9RA 3LJCA 1IQPA 3LQQA 3O47A 3MPOA 3LCJA 4LRSB 1R9JA 1YR9A 2ZSKA 3KJEA 1G5FA 1ZBQA 2O50A 3OHPA 5NULA 4O2BA 2BF7A 3FSRA 3QPVA 3RYFB 5L7YA 4ZALA 4G84A 1XDGA 4K6HA 5K3SA 2PH5A 3R3XA 1FFDA 4R54A 5FWXA 2ZM6B 1PT8A 5FTMA 4D45A 2F3UA 2BFDB 2B69A 3D8RA 1ULTA 3O1LA 3V4VB 1DC5A 1N1EA 3A7DA 4GH5A 4IWNA 4LDQA 2E4ZA 1CUYA 2HRDA 3A0UA 1OX4B 4NC9A 5EP3A 3IOEA 4RHTA 2GRAA 2BCGY 2GLUA 5ISMA 1A8UA 2BJHA 3I12A 3KG2A 4IIBA 1M67A 5IZCC 1ECFA 1Q5PA 2Y93A 3JZAA 4UUOA 4XDZA 4EG7A 4MS3A 4D26A 3NNSA 3NFYA 1MOSA 3ERCA 3FG9A 5ECYA 4QM7A 4HZIA 1I0LA 1AV6A 2CJWB 1NDHA 2ZWIA 3C98A 3TVDA 4A1OA 3UMGA 1UT5A 4FEEA 1ZJWA 1AS2A 1PK8A 2D5LA 4FFRA 4NDAA 4OP1A 5F3DA 3ILSA 1SC9A 5TF0A 4RU1A 4D3XA 4I6JA 2HRCA 3H42B 3L3BA 5A62A 2Z6UA 4KO1S 1D4FA 1U4OA 2FSVC 4LVOA 2C3PA 4R7TA 4C3VA 4DA0A 4WKNA 4F86A 4KR0A 5MN5A 4LJSA 4ZDWA 1TVKB 3TF5A 3SHQA 2YWBA 1IOZA 5IH3A 4TTPA 1U0JA 2YNMA 2WHEA 2PXAA 3U7RA 3N8IA 1DBIA 2EJTA 1BXGA 3EVFA 3QBVA 3FH0A 3IR7A 2JRLA 1WTCA 4J0HA 2GCEA 2C8VA 2ZG6A 5TDHA 3T5DA 4UHCA 1WD5A 2RB5A 3KU1A 3T3GA 5JCOC 1F8YA 3VI4B 1EA7A 4X6XA 1MZPA 2E82A 3M9XA 4AZTA 2XTJA 1AGPA 3NHWA 3QU9A 4IEIA 1WXDA 4P34A 5EFZA 3WL7A 5IYZA 2G09A 4N0MA 1GPLA 1SWWA 2QP3A 2R6AA 3EXAA 3GNLA 3S1AB 4DLKA 3SR0A 5GJBA 4EMTA 2P40A 1QP0A 1ISSA 1PNVA 3L1HA 3JAWB 3PFGA 3R2JA 4MARA 1URPA 2Q9CA 3DW3X 3FPEA 3QENA 4K6MA 1PWEA 2OYRA 4MJLA 5EXXA 3KD2A 4UVIA 3KZ1E 3VMMA 1PG2A 1GGEA 2JGKA 3DFKA 3FNQA 5IKXA 3BDVA 3KL4A 3KL2A 3GLFA 4EG4A 5DM1A 4ER5A 3BMQB 5DLEA 1ZOOA 3FLEA 3CF2A 3GVPA 3LUKA 3TDNA 3D0OA 3GPBA 2DJIA 5C8YF 2HCRA 4B2PA 5C5IA 1YB5A 3C1UA 2IEYA 3MCAA 4UEOA 4CKCA 1C0PA 1PJAA 4I46A 4CNBA 2OCYC 1BDJA 1X0XA 4Q6BA 1QGDA 3D9QX 4MCJA 2RGWA 2KJQA 4IFIA 1FC0A 2H07A 1QP4A 3A1TA 2ATVA 2H4WA 3H2ZA 2MSLA 4DEYA 4EJ6A 4LXGA 1IWPB 1KIAA 2IEZA 1EFTA 3JYHA 2H1SA 4OGKA 1C0EA 5GZ1A 2FHSA 3RUHA 5KX5F 3EXEA 2I2BA 2MT9A 3QX3A 2IKQA 1CEEA 3CO5A 4B84A 5HS4A 1VYUA 3U9TA 4QE3A 4NK5A 4GR5A 3DKKA 1JMVA 1YVUA 4F92B 4P92A 2Q3LA 3ANTA 3HLYA 3RS3A 1S7CA 2LV8A 2N0SA 2IYAA 3A4TA 3RR2A 3ZJ5A 2A0FA 1UXJA 3BBPA 4ESVA 5K3DA 1ECCA 4CF6A 3LGAA 1BKDR 3FNHA 3K2EA 3O73A 5GP1A 4OYRA 1J2BA 1Q17A 2WTNA 3TD6A 3ACDA 1UWCA 3I58A 3OQVA 5HTKA 4D97A 1I2BA 1XCMA 2OB1A 1Y98A 3NRCA 2FA9A 1UK6A 4QT0A 2WY2D 1SA0A 1GDTA 1KYVA 4O6VA 2QTMA 3ADDA 3ZQ4A 1SHTX 1QR6A 3DD1A 5C8YA 4PLHA 4NE9A 4Q66C 1GAEO 1NVDA 4HVTA 1JR3D 3VDNB 4D9MA 2ZXFA 2VHZA 3DZ8A 3G0BA 1O96A 1ZU4A 3B20A 1QWSA 3MWEB 4KKXB 5JSHA 1GQQA 1EJ0A 1ML3A 2Y99A 2PJUA 3LNCA 1AIPA 4B3DA 2Z56A 1UOOA 2MSDB 1ZIPA 1QPGA 2OM6A 2NV0A 1RQRA 2VJAA 3GNQA 3PEEA 4GNKA 4RJ2A 2NU8A 3RO7A 2FR0A 3JATB 2SKDA 4OQXA 2AHRA 3CRVA 2Z5GA 5IU6A 1KH2A 2O8NA 2GXUA 3VO9A 3HFRA 1YDHA 4B3GA 4YXWD 1EZ1A 1NLUA 4EIWA 1OGYA 2VK1A 3ZDRA 3IUJA 1IHUA 3M6XA 3MWJA 2GS9A 1B6TA 3Q2IA 4E2ZA 1EVQA 5JD6A 3C7CB 5LR6A 2ZYIA 4WBXC 4MYSA 1TJPB 2I80A 4A8JC 1J5XA 2W4MA 1VIDA 2E21A 2BTOA 1HYQA 2XUGA 4KIWA 4UTPA 3MUFA 4H1HA 5H4HA 1JFLA 4WVLA 2HJVA 4NPHA 5AJZA 2BZ0A 2QROA 2Y9MB 4C4AA 1IVSA 3I01A 3FPBA 7ABPA 2CB0A 5FOUA 2RGYA 5JZBA 4RF4A 5FOWA 2EFEB 5CCBA 4PZYA 2IU0A 4H17A 1FQWA 1IN1A 1YRWA 5DNWA 2PL5A 3M4ZA 4HXYA 2B2CA 2OPHA 5I47A 5BXQC 5ICMA 4AS2A 3GVJA 1SC1A 1RLIA 2XMGA 5ALPA 4OSEA 3ZWNA 3E4DA 1W93A 4ZT6A 4E12A 4D0SA 3K3PA 1LDNA 3DHVA 1BA2A 3PC6A 4G5RA 1H2RS 3L6EA 1LPPA 3SJ7A 4DMGA 5A9TA 1U2QA 4Y6RA 5CAEB 1QMPA 3AFHA 5H9WA 5CXXA 4RD3A 3SJAA 2I7VA 2IP2A 1UM9B 3FTFA 2NZYA 3AGQA 1AGXA 3EY9A 3GUHA 3RKUA 1OC4A 1DTEA 1LBSA 3AEXA 3HY4A 4FLFA 2JZCA 5I9IA 5ELXA 1JHOA 1KARA 2W6CX 1F48A 4J7CA 4N3CA 3AF0A 4HMPA 4IH9A 3QPUA 3EEIA 5EZYF 4O02B 4QDTA 3MJVA 3GUCA 3G9UA 5IK2D 5JFGA 3K4PA 4OBBA 2BONA 2QRMA 4J1TA 3GJ6A 3JQPA 3DVLA 4RCVA 5AVJA 1O0SA 2K87A 1JZTA 2PT9A 4UE3S 1JHMA 5A3SA 3U0VA 1CIVA 4PQGA 1T8YA 4Z7JA 4PHGA 3KQUA 4H2DA 4QQ8A 4EY4A 1B8NA 3U13A 3ULKA 2QDKA 3A3KA 4QG3A 2QMEA 4S24A 5ENZA 2DTDA 2W2TA 2P2YA 4QGFA 3K0SA 1BW9A 1DAHA 1T3ZA 1LRKA 2DHCA 1H6AA 4Q3KA 2IXDA 1THGA 3HBMA 3TIVA 1FP6A 3OVMA 3ZUGA 2GAAA 1KJNA 1CUCA 2WF7A 3IEVA 1TTHA 2XMSA 1KAHA 4BX0A 5LZ5A 1UKCA 4QUEA 1B26A 1L5GB 1NBHA 3NYQA 3RIMA 1T4GA 2RGBA 4P7FA 4WZAB 2J6BA 5JOQA 4ZDJA 2R2AA 1XZQA 4XEHA 4KQCA 1SQWA 4MV0A 4YYEA 3LUCA 2ZR8A 4NCXA 3EAFA 3WA6A 1RE0A 1YFJA 3DV9A 3LPNA 2A0XA 4ND2A 3L0SA 4ZGBA 1SZCA 2BGUA 2GYUA 4OYHA 1N5IA 3QY0A 4YS6A 5AOVA 4BQEA 2ZDGA 4Z0TA 2O0LA 2QD4A 2HHLA 1O87A 1AB5A 1PJSA 2AQHA 3CX8A 4EUSA 1L7XA 2GD1O 4G97A 4Y1FA 3A1UA 3E2IA 4ABYA 3HB1A 2AH5A 1QBGA 4IOJA 4MLDA 4RQBA 5JJIA 1NBAA 4DSTA 3H6GA 1A71A 2ZIVB 4EABA 2GTIA 2II6A 2J5XA 3FRIA 3GJYA 1R0BA 3HG7A 4TS3A 3T94A 4I50A 5LUAA 4R2KA 4C78A 5AK5A 1JL3A 1C14A 5EJFA 2AB0A 4HWOA 4RLHA 1DIOB 3WNCA 2W42A 1RHRA 1U8FO 5EY5B 4C01A 2CLDX 1RBMA 1VIYA 1Y3AA 3LRXA 1I6MA 2EKLA 2IU4A 1AQJA 2J0SA 3TQHA 1G8FA 4PPNA 4PWZA 4EFMA 2XMRA 4RWEA 2VHCA 1R5NA 3GA0A 1HYGA 5K8JB 3G6KA 3IVAA 4PYQA 2FLKA 2O7QA 1G42A 3HUEA 1SN7A 2O54A 1G8HA 4AZSA 2IYWA 2BP7A 3UBMA 3ZWAA 1YQXA 3DWIA 5CFOA 5K0EA 1Q1BA 4D02A 5F52A 2Z5FA 3JQFA 3ZD8A 4CFZA 4DILA 1R5OA 4YUXA 4LAFA 3MYYA 4WY2A 4BXOA 4M0EA 4ID3A 4QBHA 3M4YA 1P8JA 1R6BX 1Z4QA 2GO1A 3K6KA 4O4IF 1FDWA 3ZDQA 4DUYB 2I4OA 3VU3A 4BKOA 4PTLA 5TPZD 1LK5A 1QIHA 1HY3A 1HRDA 4JROA 2CFSA 2O52A 4R1TA 3KPWA 3KVVA 2R68A 3GLVA 4ZZ0A 5CEEA 3HXQA 1HBJA 3NTQA 1QNFA 1KYIA 1MABB 4F6RA 4RXMA 1P77A 1TU4A 3P9KA 4WHMA 4Z86A 3QWAA 3TDKA 1KAQA 1P2VA 3HBNA 2W98A 2DX7A 2ZJ7A 4OXQA 1RBZA 1Y1SA 2J9YB 3T7AA 3W7VA 4C06A 2EAUA 3ZWDA 1UBTS 1DE0A 3L7MA 5FF9A 1DG3A 4M7PA 5CK4A 3HA7A 2FHPA 1CY7A 3F6YA 3PJDA 1C30B 1BVRA 2XMBA 1SGVA 2ODEA 5JROA 2VP2A 5T6MA 3JD2A 4JI7B 5JS1A 2CVOA 2FPMA 1TC1A 1KQ3A 4BNMA 3NY7A 1EGVB 1NW4A 2HLNA 2P9QA 2PYDA 2ZAGA 4EG0A 4YUYA 1FY2A 3LC1O 1NONA 3DTTA 1YV9A 4ZI5A 9LDTA 5LP1A 2XZDA 2IUFA 2JFGA 1YH3A 2MR5A 4RMIA 2CXSA 4KAXA 4LDNA 2BFPA 3I6QA 2NIPA 2QP9X 2VKTA 3CX7A 4U7HA 1JR4A 1V1MB 2JH8A 2KPOA 2BBWA 4ARCA 3FVQA 3OX4A 2XCLA 1T0HB 4ZU1X 5CB4B 3ND5A 1E59A 3GVKA 2QP4A 4WTOA 2WI8A 4HNAB 2QPOA 5UKDA 4M9XA 2G07A 4EPRA 2E18A 2ZDHA 3AMVA 3NU1A 1PR4A 4X54A 3ELDA 3ZS8A 4CEJA 4Z4EA 3F67A 3GWZA 2WT8A 4GW3A 4UNPA 1XNRB 5I9LA 2A9VA 2J5VA 2Y66A 2UVPA 5DX0A 4O33A 1WW2A 1W4RA 3QP9A 1FZQA 5JAUA 1H6CA 1U2DA 3GLTA 3RVSA 4JIMA 1PV1A 1IC6A 5F5NA 3X2FA 3I64A 3LDFA 1KSFX 3IEPA 3W2IA 3A14A 1WUJS 5TX7A 4BFZA 1N75A 5K3OA 2PE5A 1LU9A 2HNKA 3IUWA 4HAWA 5I7EA 1QQAA 1OWPA 5KYXA 2BBTA 3RNLA 1L8QA 3ENQA 4KU4A 4XIFA 3QLVA 1GCOA 2JJMA 2AV6A 3OFND 1CE8A 4CV0A 1LZKA 5AUNB 3RHZA 3UCFA 3VKUA 4PLZA 4IYJA 1H23A 4M9ZA 4XPIB 5DM60 4Y9TA 4J07A 3ISVA 4ZO6A 2HEIA 4LZLA 2YVUA 1ZI9A 4QPCA 1GAQA 1RW4A 3DB2A 2QVBA 3SD7A 4QXRA 4YECA 4LOAA 5I4KA 3LFUA 1T91A 1WZCA 3GQVA 2JJ1D 3L77A 3FJOA 1THMA 1RKXA 5HQ3A 2WTBA 1MO2A 1II0A 3CF4A 4JLJA 3HM9A 5D6OA 5TMBA 4CXMA 3O4JA 2WF8A 2ZTMA 3ZG6A 1VSQA 3MOIA 3OCCA 4TPKA 1E63A 2J3IA 4JB0A 4JUCA 1J4AA 1R3EA 1LQUA 4X63A 3ZZ0A 1V8BA 3OIRA 4BAZA 5FUVA 3GGGA 2QJTA 3GRFA 3OMLA 3OZTA 2XD9A 4IWYA 2BOVA 2W2LA 4UCXA 5DTJA 3L0YA 1CNFA 4UPEA 4CCAA 1IBLB 2JZOA 3RYIA 3C3DA 3SYMA 1G41A 2XTAA 5T8KA 4G0WA 1I3OA 1WPGA 5KIAA 4YUAA 2I2AA 1E6WA 2R60A 3FTDA 2ZQZA 5I9BA 1VJTA 4MV3A 3SNHA 5JZ9A 3J81A 3AIOA 3GCGA 1VKNA 4MB6A 4PBSA 4Q18A 5CPFA 2VLBA 3EZ6A 5EMKA 3TVYA 3ZGLA 1E3WB 2E6UX 4CKBB 1DCKA 4IX9A 1H9AA 5FBWB 2LIPA 3Q3JB 1UODA 1ONSA 4Q9IA 1JIJA 2JJ8A 2XUJA 1GXSA 2BRUC 2YVQA 1Y6QA 4UREA 1GZDA 5CX1B 5EPOA 4DJEC 2VSFA 2FEOA 2P4EA 4I8XA 3TTVA 1X7XB 2E5LB 4MWSA 1U8AA 2EZTA 3BRCA 2O4UX 3B3GA 2KLNA 1BEZA 2EY4A 1GL9B 1SZJG 1VJ0A 2C3MA 4B4DA 3FNEA 4BQIA 1UDRA 2V7UA 1J2TA 2PTGA 2R00C 4ZAFA 3TL2A 4M1QA 1M6NA 2FPGA 4B5LA 3I2YX 1EUDB 4PLYA 1E5VA 2XWPA 1U6IA 4R1OA 2QYSA 4BUJA 2VTBB 4Q1AA 3RC8A 2FSGA 1ILWA 4QBTA 3Q41A 3T95A 1FC7A 2WJWA 3BD6A 2RHRA 5I9MA 1W7AA 1KK0A 3HBLA 2BC9A 4NMXB 2F6RA 4BLQA 4QJ5A 5JCPA 4WJZA 1Q1NA 1MX9A 4MUIA 1C1XA 1U3CA 3FOAA 4A0HA 1CLUA 1JG6A 3EGIA 3VPGA 4HPXB 1XTRA 3C16C 1C0IA 1T15A 3FLAA 1R9MA 1E20A 3LQ2A 3LPMA 2QRPA 5CNKA 1NVFA 1XZDA 5E1BA 3KYBA 2WUWE 2QZ9A 4RANA 1GPAA 3ZHQA 3RJMA 3I5MA 3EOAI 4E5MA 3B36A 1UEJA 4EHIA 3T9AA 3RBVA 3DFUA 4NTZA 3MUEA 3OC6A 2PQ6A 4U3JA 1F60A 3KPJA 1DJNA 2X2EA 2Y1KA 2H06A 3ZNOA 1T1IA 1BQ3A 2AI3A 2OV6A 4BNJA 4Z1OA 2J87A 2X5XA 2A9OA 2R11A 4U5XA 2ZBUA 2YMPA 2ZT5A 4QJIA 3CUYA 2ZYAA 3HCNA 4FDAA 2EHDA 2JFPA 2OA0A 3T1HB 2XB9A 2XKBA 2DFVA 4FGUA 4BV9A 3K8YA 1AHIA 4MUYA 3QX8A 2UYQA 5JRZA 5BSFA 3GNSA 1ODLA 2Y68A 3DQQA 4QC2A 2XYRA 3SQMA 4M8IA 4IF4A 3VPDA 3RIGA 2AZTA 3UZUA 3DDHA 3VUEA 3BGIA 3OICA 4GDMA 2BFBB 1YI1A 5CEJA 3LDGA 2A5YB 4KGZA 3Q3EA 13PKA 3L93A 1YRQA 1Y4AE 5JFTA 1T5LA 2D06A 2GZSA 4IJWA 3WK8A 4CU2A 1GUDA 2V1UA 2K4MA 2ZUDA 1HTBA 3VVCA 3N3BC 3IL2A 2OXIA 2FFQA 3ZVRA 5D3ZA 2B78A 3HTXA 2BGLA 3BREA 4UM5A 4A03A 2R8ZA 9ATCA 3OFKA 4GLBA 3QELA 2ATXA 5DI9A 4QQFA 1RRKA 3V9AA 5DIZA 2PLRA 1PQWA 1BG6A 2JK0A 3PCRB 4B40A 5KTPA 3BYZA 4RZHA 2ZR0A 2C7PA 1Z68A 2VPIA 2AKEA 3LIIA 3W7AA 1QGOA 4QWMA 1KJQA 4Z3OA 4QBIA 4EY3A 4FGJA 1VDZA 2J4CA 2X9VA 3DTNA 3CM0A 1E58A 3U1VA 4LEIA 3OT5A 4K05A 3ZY5A 1F9AA 1U31A 3O8OB 2PX0A 3F7NA 3FCYA 2A0KA 3W6NA 2X14A 1USIA 1CHNA 4JOBA 5C5CA 4DLXA 1SNYA 2GUGA 4WINA 3EPKA 4E5YA 1ML4A 1F0KA 1P5FA 3T7DA 5HK8A 1CCWA 3ZZ1A 1XZAA 1DKQA 1Z5VA 1RWXA 4LG1A 4V0RA 5J4HA 4RTOA 3M6UA 5E4FA 2WTUA 1TQ2A 3UMRA 1QPZA 2H08A 1QX3A 1VG0B 1VHWA 1R0ZA 5JSZA 1I3LA 4IO1A 4PS1A 1FMTA 5EQFA 3EZLA 1BH6A 2GBCA 2QJRA 2VUHB 3G8YA 4Y0AA 4D8XA 3JQ7B 5KJEA 3IUSA 1N3IA 3IAM1 3WKAA 1CRWG 4E51A 1Z6GA 2ZB8A 1JDPA 1T8RA 4KRGA 3WLJA 1NATA 5FWYB 4NCKA 4L4RA 3OLWA 3SVTA 2WQ6A 2CCJA 4HFJA 4OOFA 4ZREA 5IDVA 2EYUA 4G4SP 4JP8A 3E35A 2FW7A 4B83A 5IBCA 4DA6A 2BM1A 1OBFO 2QXYA 3X1MA 2EQBA 2I3ZA 4NZYA 1DS6A 1DP4A 3FPGA 3H3JA 5G53C 1TRKA 3EE6A 3L7KA 1H1LA 3PRKE 4YQYA 5IHPA 1PSZA 2JF0A 2YN0A 4AKGA 1IY8A 4U0JA 3H2SA 1J0EA 2ZCJA 3N2EA 4PBTA 2CYBA 2HU7A 5TGZA 3A9RA 1YIAA 1K7YA 3NT2A 3EQ8A 4G0PA 3IP1A 3R0ZA 2IOFA 2IW1A 4J49A 4EO7A 7GPBA 2JGIA 3LMKA 2CDBA 2HPZA 3AR2A 1PG0A 3BWDD 1TECE 4CMIB 3DKRA 2GASA 2C31A 5IZCA 1PX2A 1TNDA 3ITEA 3QW4B 1QCZA 3EUAA 3I6ZA 2I4RA 2OD9A 3FYSA 4J4BA 5BUQA 4DQLA 1NXWA 4JOCA 3S27A 2YKGA 1D4ZA 3F3SA 4IXWA 5JZOA 2PKXA 2R25B 2WJ4A 2IOHA 5JAZA 5AW8A 1OB2A 5T4HA 2JNWA 3DAGA 3T9DA 4DLTA 4MR8A 1W73A 2D0PB 4L0DA 5TXGA 2HSEA 3ZDZB 3QYPA 5F33A 1N6DA 3IQDB 2FSVA 3RSOA 1MB3A 2ZUUA 2E9SA 5MF6A 3CNHA 2V1XA 1S8OA 4JLAA 2HK8A 4JC4A 3KT3A 1C1DB 1FRQA 1K5GA 4N0EA 1XTBA 3DT8A 4UUQA 4WCVA 4YRQA 2RBGA 4FC7A 4BFXA 4TTAA 3HYTA 4MS4B 5JH7B 1TMOA 4X7BA 3TFWA 2W6NA 1L7BA 4HN4B 4CV1A 4KNYA 2UYYA 4FJ0A 3WGLA 3DNFA 1YZQA 1PNQA 4BO3A 4M7WA 3RSSA 3GLIA 1Q77A 4N3BA 2Q5LA 3SHTA 4KXLA 5JCOA 2WIAA 1X9HA 3R23A 1JLKA 3SZMA 2AVDA 3TKYA 3QFTA 1HMYA 2OECA 2XNDD 1B6RA 1R74A 1VJRA 2ZPTX 3U60B 5EJ5A 4KXUA 5B64A 1DAFA 2IPMA 3A9VA 4KRXA 4ENWA 3G0DA 2I8AA 1SG6A 4O4JB 3DULA 4DLYA 1D8TA 3GLGE 3TLEA 1UQUA 1V96A 2G3YA 4OKNA 4RVOA 2Q2NA 2RHJA 3UAYA 1ZOSA 2VT3A 3JRWA 3WTCA 4AROA 1NVWQ 1QIGA 1R8QA 3KUCA 4IHJA 3PP8A 4KOEC 1XFAA 4RK0A 3H1GA 4DR3B 4L95C 3UHOA 5K05A 5LB2A 1J8YF 1Z0SA 2NVUA 4Y6OA 3B5IA 5CIWA 4P82A 4YUVA 4OGFA 5AKJA 5FWAA 1J2UA 3SEZA 4YV1A 3BH0A 1K8ZB 1SKYB 3OCWA 1B0UA 1UK9A 4XA8A 3TLYA 5I7RA 3K8OE 1QP7A 4DC9A 4G0MA 5BVGA 1IM2A 1K4MA 2CMKA 4FHFA 4HX9A 2JW5A 4PGAA 4U2BA 4WK6A 2HRRA 3HYSA 5JDCC 5C34B 3OY7A 4HDNB 3AC0A 3M33A 4QU8A 4A23A 4ATNA 4JLUA 3CW2A 3OOYA 4I9NA 3EF1A 1C8VB 4GMDA 3EDRA 4RA9B 3REFA 1G9XA 1MC5A 1LB1B 5H3HA 1HEUA 4AZ3B 4UVHA 1AF4A 2E4YA 1J42A 2RK3A 1QGUB 2QG6A 3WS7A 3KQLA 4Z2AA 3E1SA 2GZ1A 2AR9A 1A9OA 4YN3A 1PT9A 1BQ4A 3CIFA 3W5VA 4M4SA 3AQ4A 3ZGNA 1SVMA 2FGKA 1Q0LA 1A7JA 5B4VA 3CISA 1YGPA 3F49S 2ECKA 4HOYA 4NOKA 3TR0A 3HEMA 1MC8A 2PBZA 5G4KB 5I4BA 2ZATA 3AI7A 1DLIA 3AU8A 4US1R 2X9GA 3CLHA 1N34B 2DY1A 3EVEA 3SQWA 1E1DA 5KYNA 1WM1A 3F4LA 4NYMR 2JJ2A 4FOSA 3EX7C 1XVUA 2N1BA 2WAXA 1NVTA 3AP1A 1A9ZA 3AERB 2X0IA 4GBED 4R9UC 2FSFA 1Z8NA 3ZEIA 4HH0A 5JISA 2CLKB 4NEQA 4EGCB 2YJNA 4WN9A 4YAEA 5EWLA 4V1CI 1U0LA 1ZKMA 2WKRA 3CVJA 1YE8A 4JB2A 5KDLA 3AJ8A 4M0LA 4UM9D 4KXNA 4E2XA 2UU9B 4YP7A 3OZIA 2FWJA 5D84A 3AV0B 3CXRA 1FTSA 1J7XA 1I2MA 3B5EA 2QX9A 3QPCA 3WWCA 4D0GA 3IMKA 2EOAA 1WVMA 5CYPA 1TX4B 5HIIA 5SYAA 2C4UA 1WBBA 4HWGA 2Q3DA 3R5SA 4GYKA 4B3RB 1H65A 1ZJ6A 4RTRA 1M5UA 2YN4A 3F9IA 3NUZA 1ONBA 1X80B 1XEWY 2I6QA 2ZRLA 3OFVA 4OQLA 4A8JA 3OPYA 3KR9A 4ZARA 1BXRA 3AUAA 2M6LA 1U0EA 4ILKA 4LV6A 5CMLA 2KHZA 4BX3A 1QFYA 1SIUA 2ZVJA 3IIMA 1QP8A 4Z9AA 3F2VA 5J9FA 5H8WA 4M76B 4FCVA 2LCFA 1NDQA 2BHNA 2GT1A 3Q3GE 3VBEA 4LJRA 3AUUA 4ZIRA 4JUBA 2VQ3A 3PENA 4R2XA 3K1AA 1L5ZA 1LGYA 3SK0A 4FT4A 3AYXB 4RAQA 2P35A 3HY6A 2VDQB 3S1LA 3PUKA 2XUIA 3JQ9C 1KEKA 3KJHA 1P7YA 1X8XA 5E3IA 2IH4A 1QZXA 2AMYA 1T43A 1D4AA 1RCFA 2A5GA 2JKYA 2H54A 3PQCA 4FS8A 2QVZX 1DQZA 1GZUA 2YQ4A 4WEOA 3EA0A 5CVVA 1UQTA 4BEJA 3PDIB 4A82A 4M54A 1A9XA 1I2CA 2FPWA 2PUJA 3UPTA 2P68A 3ORFA 4NYJQ 1NUTA 4UBMA 5LXTA 2IZZA 3GI1A 4F1KA 5AR1A 4DQUA 4P5DA 1FU8A 2XNSA 3O8RA 2I2CA 3AI3A 3CH6A 3P0IA 4CU5A 4E46A 3K1ZA 3ZKAA 1LVHA 2QRVB 3P4XA 4B0OA 5BW8A 3CUSA 5LIPA 2PD3A 3STTA 2FRDC 2P3SA 1KJJA 2OGTA 3L49A 1Z0IA 3P2YA 3RS5A 2ZBFA 2QUZA 2VRCA 2F3RA 1CETA 1KQGA 1WZIA 4NYIQ 4YNBA 4DIDA 1DKUA 3HGQA 4AAYA 3FDZB 4FZJA 1T1EA 2X22A 4D92A 4DABA 3C3XA 2FG6C 5CVTA 2BBOA 5D00A 2QTLA 3PI6A 4OB7A 2DAPA 4H3SA 3AZOA 3ADCA 2FDRA 3MA0A 3RFVA 2YOFA 3MD0A 1KI6B 1OXSC 3GLHA 3AL0C 3B1XA 4CIAA 2IHZA 4X6LA 2OG1A 5CBPA 4EVQA 4KXFB 3DTYA 1RZ3A 1E4EB 1SXJB 2EZ4A 4UDYX 2AKAB 2GARA 1GP2A 4B2YA 5HF5A 1V7ZA 4WESB 3WL6A 4NNPA 3L79A 5FEUA 1OLSB 3G5LA 1M9NA 2JGNA 5BWLA 4LV8B 4FD2A 1NRXA 5I8PA 2V58A 5C4MA 1M6YA 2DFKB 3LS2A 3A1EA 4ENTA 1FXWF 3CURA 4BGVA 5A0VA 3QE2A 4KITB 2BKUA 4H7HA 4MRNA 2Q1XA 2PWPA 1SC3A 2EDAA 3MWDA 4FHGA 4JJ8A 4LQDA 4M46A 2CL0X 5FBLB 2CHFA 5BRNA 1G2PA 1RYHA 5LFAA 2QV7A 1RR6A 3TH5A 1X94A 2XXJA 2HO4A 4ZEVA 5KOJB 1V7QA 3GELA 3HP1A 5BUSA 1CDEA 2YH2A 3X1KA 2IBSA 2F8MA 5TB5A 4HTFB 2GRJA 1GSAA 1JYEA 1RXCA 3N7TA 4UD6A 4RETA 5F1KA 4WAUA 1RYBA 2OO7A 3P2MA 3KXKA 2CF5A 3U62A 1G20E 2G80A 3ASUA 1RKQA 2C78A 2E5FA 4MGEA 2ZJ8A 3OLXA 3IPAA 2GPAA 3L7NA 2XYQA 4EK9A 4D96A 4X84A 4EL0A 1OJ7A 3BZUA 1E3IA 3ZCQA 4BECA 2MYUA 4WJLA 3ZDBA 2QQ0A 3N2YA 4QPPA 4OK5A 4FDLA 1Q15A 3Q87B 3AY0A 4ID9A 4ZVMA 3RV3A 4D3FA 5J58A 3L7DA 3VR3A 1JR3E 1MV5A 4RF2A 4FTWA 3X1DA 3WK7A 1DXYA 2ASEA 1EB9A 4FGKA 1FX1A 4DMHA 5E9WA 1V43A 4GXQA 3JPWA 2FKNA 1JQ3A 5HA5A 4Z54A 5CA0F 3GT0A 4CM1A 1C7EA 5A4IS 4MR7A 5I8WA 3V6MA 2GYYA 4KI0A 2HHJA 3KZOA 3U09A 3IC5A 2E5WA 3L7YA 1JPVA 5ALSA 5ENDA 3PHHA 2VRWA 3CO0S 1ESNA 4KFTA 1EI9A 2YCLA 4G8DA 3CUVA 1GV1A 4YRPA 2QTFA 2JIDA 1NVGA 5AI6A 2PJRA 1TCCA 3LK6A 1G1AA 1XCJA 2Y67A 4HGOA 3TIGA 1XKXA 3KE8A 1LUAA 4KO4S 3M34A 2OB2A 5F2KA 4UKDA 3CZMA 4ZVUA 3SF0A 4H1UA 4BQFA 3VU9B 3CT4A 3ROEA 2PZEA 4L0CA 4GKJB 4IL5A 1KO1A 3IA2A 4J90A 1RFGE 3CNLA 1S3IA 3IPCA 4JHXA 4KVAA 4KWCA 1ONNA 3EWSA 4NG4A 3TNYA 1W4BA 1HV8A 1BCRB 1THTA 3SI7A 1G64A 2PH3A 4IZIA 5L3SA 3WQHA 1YHNA 3TOSA 3A1DA 2JDID 3BA6A 3OWHA 3IILA 1YUBA 3ISTA 4WSOA 2CNBA 2UYHA 4DV3B 3IF5A 5L3RA 2ACVA 2VDLB 4U7TB 2IV2X 5LYJB 3ZXSA 3TSYA 2Q3MA 3HABA 4YJGB 1ECLA 3AVQA 1ESMA 1XBTA 3PF9A 1NYLA 3GMFA 3Q8WA 3CXUA 4TXLA 5J40A 5LYYA 5EUUA 4F3CA 1P6UA 2RHOA 4ISCA 4PE5B 2A3RA 1GQRA 4NYJR 1UMCB 4L1KA 3WMXA 4EJ0A 1YVPA 2D7JA 3CTMA 4IJ6A 3RREA 5ESWA 3KTAA 5LQAA 4ZPXA 4PHFA 5I48A 2VLIA 1O95C 4HAUA 5J4KA 3QVLA 4NBSA 3RGWS 1X1BA 5AI0A 4R8MA 3URMA 2OYSA 3DFMA 4C05A 4RVNA 3EVZA 4F21A 3FUTA 2XRZA 4FFBB 2ZTUA 1EG7A 1WHSA 3CN7A 4NS4A 3PD7A 3V1YA 2QTZA 4RKRA 5CM8B 3VTZA 4H7FA 3ZIUA 1WXEA 2APOA 4GGPA 3TZQA 1UKVY 1OTYA 3CGWA 4RD6A 4DLNA 4F2DA 3DO5A 2XDWA 1YZTA 1ZL2A 3ZS9A 3RUFA 2DCUA 2SBTA 3KB2A 1YZGA 1SAYA 3BXFA 3V1LA 3HO1A 1PKXA 4GOLD 4IMIB 5KYWA 3K5PA 1NW7A 4C6SA 4DZRA 1EGHA 3ZTBA 1R16A 4R8RA 2IGBA 2P75A 4JK3A 4DRXA 2HJRA 4MKXA 2JLQA 3WV4A 2IOQA 3OLQA 3CJQA 1J2JA 1TXGA 1UXIA 2HI0A 1NJGA 4M0DA 4I6GA 3PTAA 5C1BA 3HHPA 2NTJA 3OH8A 5T5QA 4X91A 2D7CA 2IYQA 2WIKA 3LF2A 3QXSA 4FYMA 4JOSA 4DMLA 3D5EA 2UYGA 4LOKA 3OPMA 4UMEA 5IWCA 1J8DA 1TJ3A 2I9PA 1CP3A 1HG0A 3RS9A 1MQSA 2WHPB 4OFBA 2V9ZA 4TKVB 3OP1A 2O5EA 1PGJA 1BFDA 1CQJB 2WSSA 1ZNYA 1N2EA 2G6BA 1QU2A 4BMYA 4XSGA 3WLNA 2I33A 1Q74A 3PE4A 3TZHA 4EITA 2QEQA 2WE7A 3QX7A 4KQGA 1GPJA 4JN6B 1BJKA 1RYMA 3DOHA 4CLRB 1T6YA 2H9AA 1FRFS 4YHBA 5D7NA 3DHWC 1ADCA 3HPRA 4JU9A 4DCVA 1KVRA 4YJ2A 5A0TA 4ZT5A 3L9XA 4OB8A 3WOHA 1RLUA 4M60A 5LDHA 1YS9A 3T35A 1YZKA 4RPHA 2ZJ5A 5AKLA 3ZLUA 2FK7A 4RKQA 2E5OA 5JS6A 2ISSD 3EGXB 1V41E 3BXXA 2H1FA 5TQ0B 4ZYZA 1IBCA 4BVFA 4EB6B 5DU2A 1FP2A 1YJAA 2VAXA 2NAPA 3C3MA 2F48A 1Z17A 3SFTA 4EG1A 1IEQA 1PR1A 1HSOA 2WAOA 4Q9AA 4PN3A 2IFTA 1WAMA 2G5TA 2Z2JA 2ZRIA 4PSDA 1VGVA 4KV7A 5MHTA 2ZUCA 6REQA 2R5NA 4FI3C 5JC1A 5KYYA 1QFSA 1JG4A 3V5NA 3HY3A 2GETA 5DHFA 2BRUA 2R4QA 4OXRA 5I5EA 3JVUA 1ZI6A 1SCIA 1ZA1A 2H48A 2GFQA 2Y1GA 3AVOA 5CT5A 2PT7A 1J0BA 2YIDA 5DHSA 1EBBA 4BB6A 5LZ2A 3IP3A 3TGLA 4K6OA 1EWKA 2O0KA 3NS7A 3MTBA 3QNUA 2GHIA 4PG6A 3RNOA 1V6SA 1BU5A 3HNPA 4DUGD 3IP7A 2VJMA 2C94A 3NW9A 3RT9A 5H83A 3EPRA 1DX9A 1TEHA 1NX6A 2R00A 1GARA 2FOXA 3LYLA 4GOND 5FTKA 2C1XA 3GEDA 5TS2A 4AW9A 5JANA 1N6OA 5IXJA 1P4RA 4ZEXA 2FLVA 3M2TA 1TIKA 4LXQA 4Y7DA 2BF4A 4MW2A 1FC6A 2ZKLA 1Q11A 1Q3KA 1N6PA 4DQXA 4LVNA 1UP4A 2HHCA 3QF7A 1EG2A 2DU8A 1EM6A 5CVEA 4ZO8A 2CXUA 2J07A 2YR0A 3E8XA 3TQTA 5IX8A 2I4IA 4B7CA 4O2AA 1VSTA 1JQLB 1CG6A 2YIMA 1BVHA 4MQEB 5E6RB 2A30A 5EFOA 3A6HA 4IFEA 4BEVA 4OBXA 4BIMA 1KU6A 3HEAA 2XY4A 2PX8A 4CT4B 4GC5A 4CIVA 4LKRA 2R8BA 3W2TA 1BMQA 5EP1A 1J25A 1MX1A 3DBLB 4DB4A 1GTSA 2CXTA 5IXYA 3C70A 1D5CA 4FB4A 4DT1A 1P5HA 4I9FA 5CDFE 2HUPA 3OPVA 4NV1A 5BW6B 1ARZA 2GZRA 2J3JA 2NNLD 4ZDIA 2CMHA 2VYVD 3K96A 3N2ZB 4NCIA 5GJCA 4QEZA 4OREX 2HD4A 5T41A 3X1YA 4JC0A 3RVBA 1P19A 4G01B 4B74A 3WAJA 1WUIS 4EW2A 2WM3A 3HCRA 5EC8A 4JENA 1OB5A 1U28A 4N7BA 1FMLA 2ATEA 4TXHA 1TMYA 3QEKA 2FE1A 3WYFA 4CMHA 2W2KB 3KQTA 3GRUA 2J7PA 1JQEA 3H5TA 3N59A 4XQEA 3MWKA 2EJWA 3BZWA 3GT3A 1ISJA 1GPUA 1XP8A 4I1IA 2CT8A 1Z4OA 3QBTA 1FFAA 3UQYS 4E1BA 2JI4A 2RH4A 4KR2A 3QOXA 3WHKA 4I66A 2DUJA 2QZJA 1KMQA 1JNXX 1OAKA 5DN6D 4MS1B 1Y7TA 4RYDA 3DUFB 4QLAA 4MQFA 1FP7A 3PGXA 3GRYA 5BSUA 1V4NA 5KQRA 4J3FA 4OLJA 5FULA 4EARA 2BE7A 3H8VA 2PKWA 1R6XA 1UPBA 2HADA 1NVXQ 1MJ5A 3CH4B 3DF9A 2LKCA 3CQ9A 5TC4A 4E15A 4CGZA 3U7QA 4BDSA 2WSYB 1AY0A 2FCRA 3M1LA 3GLIE 1PJ2A 2AC2A 2P2ZA 1EHYA 2FQ1A 3W05A 5EUMA 2BKAA 4QECA 1UAAA 4DDMA 1W4CA 2RJOA 3P97A 2IE8A 3FB4A 2HF2A 2YZGA 3H0EA 2NT4A 2NT3A 2Q3BA 3D6VA 5FUMA 2DWUA 3DBVO 2P4SA 3I42A 1GNPA 5H0IA 4DA7A 4K2HA 1ZJZA 3U37A 1N25A 2IA5A 2J5QA 4D3YA 4PPGA 2VK4A 1W94A 4XIGS 2EBFX 2B82A 4P08A 1RQ2A 1KGDA 1LVGA 2L42A 2WUEA 4MUJA 3UH0A 3NOVA 5LZ9A 5IJ0A 2EJUA 2ZBPA 2QBYB 1DX4A 1JKXA 4LOJA 1ZMRA 4GL2A 1M34B 1KMIY 1KOGA 4WUTA 1B43A 1GT6A 1X7WA 2BV3A 1E62A 4NJOA 4ZVRA 4CIXA 5T7BA 1N32B 1U1EA 2QUJA 4OHOA 2OPBA 1Q0UA 1VHJA 3G3EA 2Z8YA 5HF9A 1TYDE 4E14A 4C0KA 2FSSA 4XDHA 1ZS9A 3HBFA 3ZXIA 1LTHR 3NTUA 4PQEA 4U8GA 3AR4A 4GI5A 2B6HA 3ED5A 3HKDA 4OJYA 5CDHA 3CZAA 2PJZA 3LHDA 1C8KA 2ZK7A 5H02A 4W5QA 1ZW6A 2B94A 1KKMA 2Z8ZA 4OM7A 5IJXA 3WIBA 3GJ0A 2JIZD 1GA1A 3V3TA 5DLQC 5KSYA 4O4LF 4ALKA 2RHDA 4V1CB 5CP8A 2IF0A 3BAFA 3T0GA 3BWYA 5JD4A 2CDCA 2JHFA 2JJQA 2FU5C 3N2IA 3EMDA 4PLVA 2JAPA 2XUAA 1U9ZA 3TLKA 4OI2A 2V7GA 3U49A 3DONA 1WO8A 3OSUA 3BJZA 1N7HA 1HE3A 3EZ9A 3C2QA 1QOZA 2OV3A 3GZTB 4QTTB 5JD3A 4F84A 3RIYA 1TIBA 4P31A 4BX2A 5ALYA 3T3MB 2OUKA 5CA1A 5JSUA 2VXCA 1I6KA 3EDYA 2YC4C 3TUIC 3N6RA 3LTEA 5C53B 4WGFA 2Z08A 4ZANA 1NQTA 2NZJA 1LBQA 1N5MA 4G41A 4TMFA 2LXNA 3P9NA 4WECA 3UY4A 1CTQA 1LNZA 3FM9A 5AUPB 1T6NA 4Q4JB 3DMHA 2OK8A 3A4LA 4W6ZA 5DMHA 2VNAA 5FI1B 1HQKA 4BO5A 4BBJA 4C6RA 1FQOA 3CRQA 4LJAA 1IB6A 4C1BA 1OAAA 3AKYA 4X66B 2RAVA 1LPAB 1NQOA 1ZN8A 4KMMA 3EUWA 1T0JB 4PNPA 1DCTA 4NECA 4S3MA 4XWTA 2RGAA 5ILGA 3NHRA 2B0CA 1TCAA 4MKZA 4ARVA 3DV0A 2CDAA 3O4FA 5DYWA 4AO8A 1BWRA 3KHTA 1CB7A 3CZRA 5DBOA 1U2SA 3GCZA 4OIFA 1T2DA 4V0OA 1ZWKA 1XWWA 4GS5A 1UCFA 2MSCB 4IXNA 2K6GA 1UBGA 3B89A 3GJQA 4HYLA 1EVLA 2ZREA 4G1VA 4C6TA 4JBLA 1A4XA 1MOPA 1WG8A 2PKCA 3UFXB 1O89A 4TVSA 4Q1FA 1Y8QA 2EJVA 1JG1A 2Z04A 3UAVA 3DQPA 4BOYA 4CDNA 1H9BA 2RHTA 5LU8A 5MN6A 3D4BA 4HO1X 1NT4A 2C9OA 2JI6A 3W5UA 2OEPA 5KREA 4B44A 5THKA 4Y9UA 2NO1A 2Q5HA 1T2UA 2EWVA 1Z63A 4XEUA 3JZFA 1FDRA 1V7PC 2PMFA 3AB3A 3KZXA 1TRHA 4MTLA 1U0HC 2FWBA 4WACA 3CWQA 4KN5A 4QELA 5F76A 5F5XA 3RPEA 1PT5A 1OXXK 1VYVA 3AKEA 3OE7D 2DWQA 4G5OA 2WB4A 2NV2B 5GOZA 3UT6A 4Z9BA 5AW7A 1O2DA 2C5FA 1GD1O 2PMDA 2PZ8A 4JLDA 2NXNA 3KM0A 1CUVA 3WWEA 4QJ3A 3DLBA 1KJ9A 1SKQA 4NMHA 2JA2A 4EQ6A 3GVXA 4GM0A 5KC9A 2AF3C 2P3QA 1ATIA 4G5GA 2ZSEA 1X1SA 4R05A 4OXYA 3NTXA 4Q01A 1IWOA 1PL7A 5LKAA 4KB5A 1IOWA 4QBFA 3M5DA 3WB0A 4CTMA 2HW8A 3U3OA 3ZD6A 1CY1A 1XN4A 3LHSA 3PWKA 5U1PA 4BV8A 1AT1A 1JKJB 3C87A 3WGKA 1POWA 1DC4A 5FA5A 4RSMA 3STVA 3UMCA 4EA9A 2RGNC 2D59A 2LTAA 5EHGA 2BEVA 3IP5A 1PZGA 4TXNA 4Y9SA 4EUKA 1P0IA 5A04A 3T12A 3K70C 4LRWA 4X61A 4RZUA 3UB3A 2D3TA 2VDKB 1QC5A 5KNDA 3KAKA 2VQSA 3KYCA 5SZJA 3E05A 3PA6A 4GUAA 3RJ9A 1J9ZA 1Y34E 4WNAB 3WZMA 3TJMA 3MCVA 2GLTA 5FEMA 2GJ8A 2MSNA 1MX3A 1Z5ZA 1FTGA 3AY7A 5J1SB 2ZETA 3K4QA 1T3GA 3LF1A 4JT2A 2YW2A 4PIMA 3ZX5A 4J7XA 9GPBA 3GFRA 1VBFA 3Q6MA 1Z82A 3O7WA 5BN4B 4CEIA 4NR0A 1JHXA 2W2NA 4CM5A 4ESOA 3IUPA 4YYZA 1T8TA 2ZRNA 2QL6A 3G9XA 3WL5A 4BB9A 4D74A 4TYWA 3WGYA 1QTNA 4LBVA 1PQ4A 4EY7A 1Y80A 3Q0TA 5JFOA 3D8NA 1CUJA 3K9LA 2WHQA 2X19A 3GK3A 3GUVA 1CLEA 1CUHA 1GQFA 4FYXA 4IV8A 4MQ6A 1JHYA 1N2XA 3EZ7A 1MBZA 1NJ8A 2P4HX 3C6QA 4QREA 1Z45A 3C6BA 4JUDX 2VJCA 4I55B 3KSDO 4KQ6A 5A05A 4ZCIA 3QE3A 4GKKB 1WPXA 3O83A 3QBDA 4R7ZA 4TS1A 2FSHA 1LLCA 2B36A 2X1MA 1GVNB 1K06A 2P6NA 2W6ZA 3EF3A 3LVBA 2W0MA 1LRLA 2ZSDA 3QJYA 3RYFA 4DKXA 1D9ZA 3TRDA 4QM6A 2VJQA 5DYTA 3CLUC 2C2GA 3ANLA 1IEXA 4YCSA 2DUMA 2BFDA 4R68A 3QKRB 1K0FA 2NO0A 4Y2VA 1B4DA 2WV7A 4BNTA 3E22B 1QIIA 1OWOA 1XAIA 3EODA 1S3SA 1W36D 1M1YB 3AESB 3DHEA 1OX4A 3H5VA 2QQFA 5EA2A 5F1PA 2WJAA 4C4XA 1GCAA 2NUTB 1AMOA 3UUEA 3CE6A 4CETA 2E4UA 3E3OA 1QHNA 5CCDA 1W34A 4DC0A 3IMGA 4R3UC 1I0IA 1G5RA 1H8ED 5DNYB 3U2QA 4BB0A 3PGKA 4FGZA 4Z5XA 1T1SA 2CJWA 3KZMA 3SKVA 3V4OA 3VC7A 2QENA 4Y9DA 2JFZA 3M65A 1DTSA 1QHYA 3SYTA 5AK0A 1FLDA 1UC4B 2HQ1A 1LSJA 2ATCA 3KTOA 1WXGA 1Q0RA 1M66A 2VYVA 3EYAA 4UHEA 3R9KA 5A4JA 4DV5B 2DWPA 5GADl 4X0EA 2ZJ1A 3JQAD 4R81A 1Y8AA 1ZDMA 2ZT7A 4MYCA 4F4DA 3DPSA 3LG2A 3PRHA 2OZVA 2X3UA 5HZGA 4QSMA 5FQNA 2IX9A 4WMLA 4X3OA 5K99A 3GA7A 3OM8A 4G1CA 1P9NA 2VQFB 4LMBA 2X76A 3D6HA 5DOZA 2BEJA 3BERA 3BXGA 3FF1A 3SP1A 4BC1A 4Q37A 1UANA 3PHLA 1EUZA 2WYOA 3RS8A 5I3CA 3ELYA 2OHOA 1EDDA 3EDCA 2QSJA 4MW0A 4V2UA 3EH2A 3ZHZA 2DH5A 5ALIA 5AVQA 2PJDA 4Z7QB 3JQ9A 1XPRA 2C3OA 3P19A 3SQNA 4C5AA 3BDIA 1CQPA 4KQ9A 3S1AA 1Y9DA 1N5KA 2J9ZB 1PL6A 4L27A 5E4TA 4HAOA 5FTWA 5FUWA 1GKIA 2A9FA 4N47A 3B6EA 1EKXA 4GKBA 2Y9PB 4BMDA 1J2RA 1E1NA 2ZROA 3JAWA 3BJMA 4IGFA 5JTTA 1E8DA 2WIJA 3Q5GA 2YJ3A 1JI0A 1Z29A 4GEGA 4KWTA 1XZFA 1PBNA 3U7IA 1LY1A 2JLUA 1WHTB 1IK6A 1PE0A 1EUQA 3NBQA 1WNTA 2OQRA 5FUXA 3BMQA 1Y1TA 5DK4A 3PG5A 3RHTA 4E5DA 1ST3A 4U9HS 1X7ZB 1SOUA 2W6MA 4V0QA 5KEIA 1Y5RA 3BRSA 1KSJA 1X8JA 4M2LA 4X24A 5EQTA 4ENVA 3KPYA 2JG3A 4DLZA 4PQYA 3N7UA 2GVNA 4DSNA 1FRNA 2FSIA 4MDFA 3I9V1 1MIOB 1SUBA 1U7DA 2E4VA 3DL4A 4FOTA 4KRYA 1UFQA 3RI3A 4F46A 1RQGA 1H22A 1XJQA 4J0GA 3CUEF 3IRVA 5ECGC 3VZRA 2UZ4A 3UWSA 1QX4A 3WBBA 1CJCA 1YL5A 1DUVG 1SUFA 2H4ZA 1TCVA 2W11A 4ZPJA 3T3EA 3FRJA 2ADMA 1TT5B 3IV7A 721PA 1V5IA 5ESDA 3CR3C 2IHTA 2PMCA 1QFJA 2I7XA 2WQZA 4EY6A 1W581 2XYHA 1WRBA 1KA9H 2A92A 4L5JA 4NDNE 4XWWA 1WL8A 4Z4CA 4Z4IA 3ODPA 3N8KA 3SDSA 2CL7X 2ZSFA 2VNKA 4RGYA 4YQZA 1T8UA 4B7AA 5IEBA 1U11A 2JBAB 2OAQ1 3S2GA 2JIZA 2WUVA 3D4OA 4CI0B 3SLRA 1BE8A 3FJ1A 5IC4A 2GJ9A 4V0NA 2GAIA 4B3BA 2CVZA 2GZDA 5I7UA 5JAOA 3TVTA 2FOIA 4F6LA 2Q3HA 1QUEA 4LC1A 2JRCA 2C4TA 3ESXA 3JQQA 4OCZA 4MV1A 3SQXA 2VJKA 2H2DA 2XNKA 1H93A 4AVYA 2PGLA 5LIRA 2VRBA 3JRNA 4JKOA 4N6GA 4C21A 1NBOA 3MWEA 2QN6A 3VGPA 4A6DA 3AVPA 4OXXA 3K20A 3ER8A 1RWOA 2HO5A 1SOWA 1NSFA 5EJ8A 2F9LA 1Y6FA 3JATA 4FFDA 1MPTA 1KYXA 2YRXA 3BXZA 4PQRA 2J5TA 3OE1A 3DORA 1KOJA 4AN0A 4Q4AB 5BSGA 2A9RA 1IXZA 3SX0A 1SVNA 4DPKA 5G0VA 2Y0DA 5LCXA 4FOPA 4UE6A 4V38A 4IJUA 3H13A 5A5FA 4C7JA 4X85A 2HSGA 2VUIB 3LBYA 2ZYWX 2RI6A 3P9QA 3NIDB 2CKMA 2BMVA 3C6MA 1XZHA 1N3BA 2BW0A 2MU1A 2PZBA 3CBGA 1ZE1A 3E0XA 5IW8A 4F1JA 2A94A 3NHBA 1K3UB 1TTQB 4DM3A 4GNRA 3LLVA 4OAOA 1Y4SA 2IV7A 1L2TA 1SUEA 3RVLA 1AKQA 2F62A 1O3YA 5BV1A 4L51A 3CNEA 4QEKA 4DV2B 1EDBA 4Y0VA 5AKEA 2PS0A 1LLQA 1T10A 2GKGA 3FPFA 4M8SA 4G9BA 5EUBA 2YWJA 5DNVA 4G63A 1UIMA 1JXQA 1LFDB 1M2NA 1SBYA 3K6JA 3PC2A 5E0KB 1WY5A 3P9YA 2RONA 3QLEA 2HBRA 5BSMA 5LLDA 1GG5A 4F5ZA 2BR5A 2VHEA 4CG0A 1WVIA 3LQFA 2HA6A 5CG1A 5CFZA 4S04A 1OH6A 1JXAA 1WQ1R 2KYRA 4I1VA 3M7IA 4QLOA 3TE7A 3W8FA 5CAEA 4R1SA 1L5MA 2GX6A 1MO3A 4IMRA 3TX6A 1H4SA 5D01A 1LTKA 1UM9A 3BMOB 4YCMA 4QULA 4FR0A 1S5PA 4A8PA 2BLNA 2OSVA 2VR1A 4CDMA 3IXLA 5DISB 2ZRCA 2D1TA 2CXNA 2HBZA 2ONCA 4BLRA 2XMZA 4CMGA 3PX2A 3QPDA 4U7GA 4B3FX 4FFWA 1XU9A 4MCAA 1DNPA 3OE7A 2PUDA 2WSLA 2AZXA 3A2KA 5A1JA 1P0PA 3ZIAA 3ABSB 4B45A 2EGUA 3A58B 3HBJA 3WNBA 4XXHA 4YO8A 3IMCA 2BGNA 4BVEA 3NKLA 1VP3A 4WY5A 4U7PB 2FWIA 1JH9A 5BV0A 2P0AA 1P9RA 2VWHA 2X5NA 3HCEA 4ANFA 1GRQA 4MCHA 1XKTA 3F6CA 4OQQA 1BA3A 1Z47A 2FF5A 4E30A 3PDUA 5TMEA 1XN1A 1KQNA 3UMJA 1FXSA 3D2BA 1O95A 3FWPA 4MDEA 2AEEA 2VT6A 2ADFA 4PPQA 2E7ZA 1SXJC 3CUWA 1CQZA 4I1PA 3D6FA 3CG4A 3BKWA 2LVBA 1XWIA 2FOLA 2Y1FA 1PS8A 1AZSC 2VC2B 4MI6A 4YCJA 2YICA 4XD2A 5I7SA 1EWTA 2NTNA 3A1VA 4KE6A 1ATZA 2HOQA 4FT2A 4WZAA 4H7IA 1JXMA 4IKPA 4LC9A 4MXDA 4S0ZA 2BBSA 1T3SA 3AH8A 4A92A 5C5EA 2W48A 1Y37A 3I28A 2XEXA 3K32A 1SBNE 3LYAA 3PPXA 4IY1A 1JHPA 2NX2A 3I5UA 3NONA 4W1PA 3TTUA 1VB5A 3TAHA 1ZRMA 1PTJC 3LQ1A 3NTLA 3R8XA 3CMMA 4IJMA 3TD2A 4BRZA 2BM9A 1Z4NA 1Q7RA 4RFSB 2M1ZA 4FQ7A 1TAHA 3PGJ