The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
130
|
sequence length |
396
|
structure length |
396
|
Chain Sequence |
MARVVVDAQAARAIGKGAMIVFKKGVVRVEGDIKPGDIVEVYTRGGKFLGKGFANPNSNIMVRIVTKDKDVEINKDLFKRRIKKANEYRKKVLKYTNVYRMVYGEADYLPGLIVDRFNDIASLQISSAGMERFKLDVAEAIMEVEPGIETVFEKNTGRSRRREGLPEIERVLLGKEKYRTIIQEGRAKFIVDMRGQKTGFFLDQRENRLALEKWVQPGDRVLDVFTYTGGFAIHAAIAGADEVIGIDKSPRAIETAKENAKLNGVEDRMKFIVGSAFEEMEKLQKKGEKFDIVVLDPPAFVQHEKDLKAGLRAYFNVNFAGLNLVKDGGILVTCSCSQHVDLQMFKDMIIAAGAKAGKFLKMLEPYRTQAPDHPILMASKDTEYLKCLFLYVEDMR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
hypothetical protein PH1915
|
publication title |
The crystal structure of a novel SAM-dependent methyltransferase PH1915 from Pyrococcus horikoshii.
pubmed doi rcsb |
source organism |
Pyrococcus horikoshii
|
molecule tags |
Transferase
|
total genus |
130
|
structure length |
396
|
sequence length |
396
|
chains with identical sequence |
B
|
ec nomenclature |
ec
2.1.1.-: |
pdb deposition date | 2005-08-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF10672 | Methyltrans_SAM | S-adenosylmethionine-dependent methyltransferase |
A | PF17785 | PUA_3 | PUA-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 | PUA domain | ||
Alpha Beta | 2-Layer Sandwich | Transcription Regulator spoIIAA | RNA methyltransferase domain (HRMD) like | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Vaccinia Virus protein VP39 |