2AS0A

Crystal structure of ph1915 (apc 5817): a hypothetical rna methyltransferase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
396
structure length
396
Chain Sequence
MARVVVDAQAARAIGKGAMIVFKKGVVRVEGDIKPGDIVEVYTRGGKFLGKGFANPNSNIMVRIVTKDKDVEINKDLFKRRIKKANEYRKKVLKYTNVYRMVYGEADYLPGLIVDRFNDIASLQISSAGMERFKLDVAEAIMEVEPGIETVFEKNTGRSRRREGLPEIERVLLGKEKYRTIIQEGRAKFIVDMRGQKTGFFLDQRENRLALEKWVQPGDRVLDVFTYTGGFAIHAAIAGADEVIGIDKSPRAIETAKENAKLNGVEDRMKFIVGSAFEEMEKLQKKGEKFDIVVLDPPAFVQHEKDLKAGLRAYFNVNFAGLNLVKDGGILVTCSCSQHVDLQMFKDMIIAAGAKAGKFLKMLEPYRTQAPDHPILMASKDTEYLKCLFLYVEDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords hypothetical protein PH1915
publication title The crystal structure of a novel SAM-dependent methyltransferase PH1915 from Pyrococcus horikoshii.
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 130
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase
A PF17785 PUA_3 PUA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2as0A01
3.30.750.80 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA RNA methyltransferase domain (HRMD) like 2as0A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2as0A03
3OU2A 1NKVA 4PYLA 1XCJA 3HCAA 1JQ3A 2P7HA 5EMMA 4YV0A 5C1IA 1DUSA 1WXWA 1F3LA 2YR0A 3G2QA 4HRAA 4X60A 1WY7A 1BOOA 3P2IA 3DOUA 5FQNA 5GIPE 2PY6A 3HCDA 3KR0A 3UJ6A 2PKWA 4MIKA 5CD1A 4M38A 5GM1A 5CUQA 2YXDA 3ME5A 4HGYA 3JWJA 5E8JA 3CKKA 4PYMA 5DM4A 2ZW9A 5FHQA 1ZGJA 1I9GA 2HMYB 3BWCA 3E7PA 3X0DA 3NVKI 3DP7A 4FSDA 2EJUA 2HTEA 5M5BA 2ONZA 2O57A 4KVZA 5HIMA 5KQRA 2OY0A 4DMGA 3G8BA 1JQEA 1YUBA 3EGEA 5EQJB 2GB4A 2ZVJA 3FZGA 3DXZA 3TQSA 4AZTA 3H2BA 2EFJA 4YUZA 2CWWA 3BGIA 4V0RA 5DRTA 3KPJA 3SVZA 1KR5A 1IM8A 1ZQ9A 3RW9A 3K6RA 5T64A 5DTRA 3EEYA 1V39A 5DXJA 4YMGA 7MHTA 2IGTA 5GIOE 3GIWA 2EG5A 3LCUA 3M6XA 4KWCA 1KPIA 4K6MA 4QPPA 5K0JA 4GOOD 3UBTA 4UOEA 3GRUA 3SSOA 3FUWA 2IH5A 2PSSA 2E5WA 3P97A 4AZSA 1NV9A 1O54A 1U2ZA 3FRIA 1XVAA 3G5TA 4NECA 5K05A 4MHTA 5EIFA 3P9NA 3BKWA 5EEGA 2A14A 2JHCA 1N2XA 1BKYA 2GAFA 1PJZA 3KR9A 3HA5A 5P8WA 3T0IA 3SX0A 2DPMA 3FPJA 4GOMD 1AQIA 1G38A 1YZ3A 2B3TA 2KW5A 3CJQA 4ISCA 5CVDA 4YUVA 2OO3A 3VYWA 2B2CA 4QPNA 3NTVA 4EMSA 4QDKA 3CJRA 3KQWA 2P35A 3LDUA 5F2OA 3SXJA 4BLUA 1SUSA 2AN5A 3GGDA 4P7KA 3OFJA 2H1RA 1K8WA 3E23A 3THRA 2Z6AA 1UWVA 4DQ0A 5FA5A 1VPTA 4CTJA 4AX8A 3LBFA 2AOTB 3C0KA 3C3PA 5GWXA 4F86A 2G71A 3UJDA 1XTPA 3C3YA 3EVGA 2C7RA 4KIFA 4OQDA 1P91A 5E9JA 5DM2A 1WZNA 1YB2A 1IT8A 5F2KA 3ORHA 3O4FA 4O29A 1T5YA 3IYLW 4PIPA 4X41A 5KQSA 2XBMA 3D79A 4G56A 4P7GA 4F84A 1TW3A 2ZWAA 5C9ZA 3LGAA 3A4TA 3T7SA 4DA4A 2PV0A 4PCAA 2QYOA 3ELUA 1M6EX 1SUIA 3P71T 5EEHA 1JQDA 3R3HA 1KPHA 2B9EA 2O07A 4M7RA 2P3QA 4H0NA 5EKUA 3TKYA 5K09A 1I4WA 5BW4A 3D2LA 3KQSA 4IV0A 1BHJA 3P9CA 5FTWA 2PVCA 5JUWA 3BZBA 3DUWA 2IIPA 4P58A 5DM1A 4PGHA 1NW5A 2V7EA 3G2MA 5EHGA 5EKXA 5K0NA 2ZIFA 3FUVA 1YFJA 4MWZA 3P8ZA 5FA8A 3FTFA 1JG4A 3HNRA 4E70A 2PBFA 1ZGAA 1SQFA 3UJCA 4X61A 1P39A 1NBHA 2FYTA 3DLCA 2AOTA 4AZWA 3KQTA 4KRGA 1F38A 4R6XA 5DX1A 5GP1A 3VC1A 3KR2A 4F85A 4RTQA 1P1CA 4EKGA 3HVJA 2FPOA 4GQBA 3GNLA 4DKJA 3CC8A 2WK1A 3GRZA 3R24A 2QE6A 3HA7A 2EJTA 1P1BA 2GA9A 3M6UA 4OA5A 4EKIA 2XYRA 3I53A 4FZVA 3ELDA 4PONA 1QAOA 4BLWA 3Q7EA 4YUWA 3FRHA 3FPGA 1O9GA 3HVIA 3V97A 1D2CA 2BM8A 2R3SA 4PYOA 4M37A 1KYWA 2ZIGA 1O9HA 4HC4A 4QQKA 3T7RA 3NWBA 2UZ4A 3NDJA 2PLWA 1X1CA 2AOWA 3G5LA 3MB5A 3PX3A 4PWYA 5E1BA 5EPEA 4RTOA 3M6VA 4RYLA 5E1OA 3T7TA 4IWNA 4DCMA 1JSXA 1D2GA 5CVEA 3PX2A 3OPNA 1ZE2A 3ANXA 3B3JA 3MTIA 3OFKA 5CVUA 1SQGA 3U81A 5HIKA 5IKMA 4X63A 3I5UA 3EVEA 4OQEA 4QDJA 4U7PB 4ER6A 1YFLA 3FPEA 3BGDA 3VSEA 5ERGB 2ZFUA 3EVZA 5K0BA 3FUTA 1ZHFA 4MQ4A 4OBWA 4RWZA 2ZTHA 1G6Q1 2GS9A 2XVMA 1RJGA 1JSZA 3B3GA 3LCVB 4GC9A 1VE3A 2UYHA 5E2BA 5E2AA 2NXJA 5B1SA 2HR1A 4C04A 2AVNA 1SG9A 2AVDA 1JTFA 5DTQA 3MTEA 1KYZA 1YZHA 4CWAA 3I9FA 2ZBPA 4Q1TA 1NE2A 2JJQA 3HM2A 5K0CA 1NW7A 1M6YA 3G7UA 1R74A 2IBSA 3LCCA 3HTXA 3DXYA 1KP9A 1L3IA 2R6ZA 3LDFA 2FK7A 2PXAA 2P3LA 3M6WA 3FUUA 4EQZA 2ZZMA 4PYJA 1XJ5A 2P3OA 2FCAA 1L9KA 3DLIA 3KQPA 1FJXA 3PS9A 3KU1A 4IV8A 4R05A 2OXTA 5LSAA 3G88A 2XYQA 5DX8A 2PX5A 5LQKA 4HH4A 5ICEA 3PFGA 3IHTA 1R6AA 3FPHA 2YVLA 4LG1A 3VC2A 2ZIEA 1QYRA 3QV2A 5E1DA 5IH3A 4E31A 4POOA 5GINE 3LECA 1HMYA 3P2EA 3FUXA 4HSGA 4R8SA 4GOND 2YUIA 2JH9A 1T43A 3IEIA 5EMKA 2H11A 4RVGA 5CIYA 2OPBA 3UJBA 1RI1A 3ER9A 2WA2A 3B3FA 3FTEA 2AOUA 5K03A 5BP7A 1IY9A 5DXAA 4FT4A 2BR4A 4PYIA 3TLJA 2VDWA 1EJ6A 2Y1XA 3OZRA 4FP9A 1X19A 4RTSA 5MHTA 4CXMA 2I7CA 2PWYA 5E8RA 3PTAA 2N47A 2ZBRA 3ERCA 2I62A 1RI3A 1DCTA 4BLVA 3B7PA 3WSTA 2FRXA 3R9XB 2HWKA 3HEMA 3CGGA 1ZG3A 3TRKA 3NVMB 5H02A 5K0FA 3CJTA 4HGZA 4KW7A 5KYGA 2AOXA 3EPPA 2YTZA 4FS8A 2IDKA 2AS0A 4XUCA 3LX6A 1ZL3A 4L7VA 5DSXA 2QM3A 3GRYA 3KQMA 4QTTB 2ZWVA 2I6GA 1VBFA 4AZVA 3QOXA 5LQUA 3DR5A 4YUXA 2JHPA 3F4KA 1IQ8A 3BWMA 4PCLA 3TMAA 3MGGA 1ZE1A 1RI5A 2ONYA 4Y30A 1RI4A 2OB2A 4QTUB 5LQAA 3TPZA 5GM2A 2YQZA 3DXXA 3JWHA 1N7IA 1UIRA 3HCBA 3BT7A 4ZTBA 1X1AA 3TKAA 2YX1A 3HA3A 3MCTA 3AXSA 3R0QA 4DZRA 5JR3A 1D2HA 3OZSA 1WG8A 4YUYA 3A27A 3NDIA 3M4XA 3UFBA 2BR5A 3I64A 1WS6A 2K4MA 3LBYA 2UYCA 2CX1A 4RTMA 4C05A 3TFWA 5EC8A 4C4AA 3UJ9A 4CKCA 3DMFA 3LSTA 4FR0A 3UJAA 2YXEA 1Q0SA 2V74B 2BR3A 2G70A 3IV6A 2VS1A 4R6WA 1NW8A 5DTMA 9MHTA 3ER8A 5D1HA 1SQWA 3EVDA 2GLUA 5T67A 1R00A 2H00A 2J5TA 2O0LA 3KQYA 3FTCA 4JXJA 3A26A 3SR4A 3GXOA 2ERCA 5HFJA 3THSA 2JH8A 1R8XA 4GOLD 1RJDA 3DH0A 1X1BA 4KDCA 2AB4A 2P1DA 2C7OA 1IT7A 5EVJA 5EIWA 4PINA 4WVLA 5HILA 4LECA 3GO4A 1YF3A 2VDVE 1AV6A 1MJFA 1ZS7A 2FHPA 4Z2YA 1QZZA 3FYCA 5FADA 4RTJA 2P40A 3DMGA 3EGIA 2NYUA 4BP1A 4RTNA 1VP3A 3TR6A 3K0BA 4ER3A 4CKEA 2J5VA 2C7QA 4OX9Y 8MHTA 1G55A 3FYDA 5EMLA 1R8YA 2VDUE 3MCZA 1L1EA 4FT2A 4A6DA 2PWPA 3EVAA 3PT9A 3QOWA 5DSTA 1JG3A 1RJEA 4X1OA 1ORIA 3CCFA 4GEKA 4DF3A 2BH2A 2UYOA 4R8RA 2P8JA 5HIIA 3BXOA 4FSXA 4Y2HA 2NNWB 3SSNA 2ZLBA 3G8AA 1I1NA 2XVAA 3BWYA 1XDSA 4U7TB 1HNNA 3UAIA 1AQJA 4EVIA 4BY9E 3CVOA 4P7JA 1G8SA 3KHKA 1L3CA 3I58A 4P7FA 4E33A 3C6MA 3G2PA 1XXLA 2AOUB 3UWPA 4RVFA 2ESRA 5EZSA 3KKZA 4PGGA 2P7IA 1EIZA 3HVKA 4FGZA 2CMHA 3MHTA 3AXTA 5FWDA 3NW9A 2IDJA 3EMDA 3UA3A 1SGVA 2XYVA 2NP6A 3HCCA 2NXEA 2QRVA 2PT9A 3ELWA 1EG2A 3G2OA 4PYNA 5GOZA 4E2ZA 3GRRA 5DT2A 1J2BA 3OU7A 5HIJA 2HNKA 2Q41A 3DTNA 2GPYA 1JG1A 3GWZA 2GH1A 3SM3A 2C7PA 10MHA 4KIGA 4C06A 2B25A 1VLMA 4E32A 3B5IA 2BZGA 1MHTA 4PIMA 2ZZKA 3FTDA 4DCGA 3AWIA 1KPGA 4E2XA 1EAMA 3KPVA 5LR6A 5E9WA 3KPUA 4QVGA 1FP1D 1NV8A 5DWQA 1TW2A 4RVDA 3MERA 3PB3A 5CCBA 3EMBA 1INLA 3OU6A 4V0QA 2P38A 1TPYA 1JG2A 2P41A 4KDRA 4HTFA 4E30A 4LWPA 1IXKA 4ER0A 5HEKA 1M0EA 1RJFA 5K01A 2ZCJA 5FWAA 1Q7HA 3AJDA 1QANA 3BWBA 2CX0A 1N7JA 3UA4A 1JR4A 3BGVA 3UJ8A 3TM5A 4RTPA 3PLAE 1ZKDA 1NW3A 2Z6QA 1SVUA 3B89A 2ADMA 2CL5A 3OCJA 2I9KA 1XCLA 2Q07A 3KQOA 3ID6C 4B17A 3TOSA 2AOVA 1QAMA 3R6TA 4C07A 3BKXA 2UYQA 5K0GA 1VP9A 1UFKA 3EVCA 2NP7A 1L3BA 3REOA 4RTLA 2G72A 4M36A 2IPXA 3PFHA 4HG2A 1G8AA 4QQNA 5LQJA 4RX1A 1FP2A 1QAQA 4RV9A 5FHRA 2AN4A 3S68A 2OZVA 4WXHA 1XDUA 3SSMA 3P9IA 4IKPA 5CVVA 3M70A 4GF5A 2ZZNA 4RVHA 2OBFA 3JWIA 3KQQA 2CKDA 5DM0A 5T6BA 1PRYA 3NJRA 1B42A 2JHAA 3GJYA 5EMJA 5HZMA 1NW6A 1SKMA 2IBTA 1EQAA 3Q87B 2WA1A 4PYQA 3KPWA 3LDGA 3SGLA 3GU3A 3V8VA 4XUDA 2NXNA 3RODA 2IP2A 4YV2A 3EVFA 1Q0TA 2PT6A 2OYRA 5ICGA 2PX2A 1R18A 3P2KA 5KVAA 3G89A 1BC5A 1XDZA 1DL5A 3A7EA 2YXLA 3HP7A 5EHIA 5BW5A 2G1PA 5G02A 3PVCA 1KHHA 1NBIA 2ZULA 1NT2A 2OKCA 4ATNA 4E2WA 2CMGA 2PX8A 3EEOA 3KPYA 3A25A 3LPMA 5D1NA 3DMHA 1RI2A 5ICCA 1X1DA 3NMUF 4YV1A 3GRVA 1Z3CA 3E05A 3CBGA 2G8NA 3C6KA 1FBNA 4XUEA 5CM2Z 5EG5A 1AF7A 3OZTA 5K8VA 5KS2A 2AN3A 2FK8A 2ORED 4QVKA 2VZ9A 1EJ0A 5FCDA 5FUBA 4LWOA 4AUKA 1VQ1A 3P9KA 5DRYA 2PX4A 2EX4A 4CKBA 5ICFA 4ER5A 5LQRA 2QRVB 3LHDA 4RSRA 2O05A 3MAGA 5FULA 1KIAA 5CCXA 1Y8CA 1R3EA 3GCZA 1KXZA 3KR1A 5E1MA 5C0OE 1FPQA 3UJ7A 3BUSA 3LKDA 4C08A 3EGVA 3L8DA 4YMHA 5U4XA 2Y1WA 5DLYA 3TM4A 5EZQA 3AY0A 3EVBA 3OE4A 2IH4A 5E9QA 3HCFA 3ELYA 5EOVA 3O31A 2AR0A 2ZSUA 4A6EA 2JG3A 2PJDA 3MQ2A 5EGSA 2VP3A 4MTLA 1VIDA 5K0LA 2PXCA 3GDHA 1WXXA 4PYKA 1ORHA 2BM9A 2PXXA 2HV9A 5CVJA 4ER7A 3LKZA 4HTFB 5HOQA 4GC5A 4CTKA 2DULA 4EK9A 5LQCA 4RTRA 1VL5A 2Z6UA 2LD4A 5LQNA 2AZTA 3SMQA 3UZUA 1OR8A 4RTKA 2QY6A 3RIEA 1JTEA 3HVHA 5DPMA 4PNEA 4XCXA 5BXYA 1H1DA 4OBXA 1R3FA 2OB1A 5F2NA 2F8LA 4GUAA 4C03A 3E8SA 3KQVA 3A7DA 3NWEA 3O7WA 4GBED 5DX0A 5K0EA 3FPFA 5FQOA 3LL7A 2IFTA 3HCEA 2NXCA 2PGXA 2ZBQA 2IH2A 3M33A 4BP3A 4OA8A 2B78A 3OE5A 1G60A 4DM3A 3JWGA 3DULA 2O06A 4E2YA
chains in the Genus database with same CATH superfamily
4PYLA 1SVSA 5EP1A 4MKXA 3JARB 3K30A 1UZLA 3CPJB 3C43A 4HFRA 4UBLA 2HM7A 3ENKA 1F3LA 4P0QB 4DR4B 2NU6A 4M53A 1RJWA 3K0CC 3V7WA 1TMYA 4O2BF 3X1KA 1NUQA 4EHNA 5GM1A 4U3JB 3ME5A 4XJVA 1KC3A 5CHEA 1OFUA 3OP4A 1DIHA 4FFOA 1I9GA 1YZFA 4QUDA 1XZEA 4RH3A 5C7YA 3ZW8A 3ASVA 1AG9A 4OXIA 1RLOA 2ONZA 3BOSA 4KVZA 1NDHA 4EF4A 5KQRA 1KEEB 1NQWA 1AHIA 1Q0RA 1JQEA 2F7SA 3DS8A 1V35A 2BAGA 3K5IA 4YRRA 2BFCB 3KOWA 4OMUA 2JGEA 2HCJB 1GPKA 3BGIA 3IJ5A 4DM4A 3UPTA 2P9QA 1JNYA 1JVNA 1W36D 5CD9A 4BMVA 1Z2NX 1N1GA 3LQ4A 3JD1A 2MSLA 2NU9B 3TSZA 2ZBGA 2F4VB 3DAHA 1UFOA 4BQPA 5KTRA 3SU8A 3RT9A 3ZHZA 4K6MA 5DNEA 1LW7A 2IEAA 2WSMA 3LWNA 1PVVA 4GOOD 3BIXA 3JVUA 3KEOA 5AHOA 2YCBA 3LX4A 4Z9YA 4ZI7F 3RM3A 3U4MA 5JZVA 3CN7A 3BVPA 1TQDA 4AZSA 3G5TA 2PA3A 1XLWA 3PFFA 5HNKA 3GGSA 4L22A 4W99A 3RGWS 3ECAA 4CM6A 4RELA 3EX7C 1AXRA 5A5DA 2JHCA 1E2IA 1GSOA 1CEEA 3AT1A 5IFLA 1TU3A 3JZAA 4PY2A 2GXQA 1YCHA 2DPMA 3GPDG 4ZI5A 5THKA 2PFSA 1ZGZA 4YUVA 4HUQA 1EFHA 2CJWA 3NX4A 2B2CA 5B58C 4I55A 3CJRA 4PBRA 2UUPA 4DHEA 1OASA 4FMCB 2W8ZA 3RBZA 4CM9A 2AN5A 3WFIA 1M6VB 4R1LA 2FQXA 4QUIA 5G1OA 3IUWA 1P5HA 1VIYA 4CMIA 4TLDA 3S2IA 4RKYA 2NUPA 1AK9A 1K88A 4LYAA 1SRRA 2ANCA 4OTZA 5CK5A 5J59A 2R8OA 2C5GA 1R3UA 3S2UA 1ARZA 3V6LA 4CTJA 1U90A 4AMYA 4Q4HA 2HI0A 1FFDA 2CLLB 1FUYB 3EVGA 3HB5X 4IVRA 5D84A 4M7WA 2BFEA 1REQA 1ZWLA 1YQQA 2I03A 1YB2A 3KG2A 4K05A 3KOXA 2QMQA 2RGUA 2ZUDA 1PT7A 4H1HA 3L07A 4N6NA 4W5WA 2PNJA 3W9BA 1OKKA 4XJTA 2ZIVB 2RAFA 2IUTA 1L8AA 2Y92A 4MHSA 1JHVA 2KBFA 2Q49A 2QAGA 1DAIA 2R60A 4IIUA 4YJ3F 3A4TA 4RA9A 4CLOB 4MQMA 4WDRA 2HLHA 4CUJA 4HNSA 1BQ3A 3GRFA 4MUEA 1SXJC 2R65A 4ZXFA 1GLGA 1F2UB 2X0IA 3L82B 2X0JA 2ZJ6A 3Q15C 4C4RA 5I7HA 2OILA 3RYFB 3TKYA 2PT7A 4QO7A 2CLHB 1JMYA 2C9OA 5IEBA 3BIFA 1DO0A 3KDSE 1UPFA 2AK3A 5E6RA 5JXJA 3AFNA 3NT5A 2BFFB 2GMWA 2RCNA 1C7ZA 2WTUA 2JLSA 3UV7A 6GPBA 2IHUA 2E1RA 3DDHA 3K96A 3JAKA 1ODSA 3CLVA 4W7HA 3D64A 5LQSA 3V7YA 1A77A 2RB5A 2G82A 3FMPB 1U8CB 4NBTA 3DT9A 1ZC3A 3MIIA 2OGUA 3KR2A 1NI4A 4MUBA 3L8EA 1WM1A 2DH5A 4ND7A 4QEKA 4LJ6A 3Q0IA 3E1SA 2RHGB 4XOUA 4ZYTA 1P74A 3DJAA 3LUFA 5GY7A 2O50A 2QE6A 3AK4A 3GXBA 5B6IA 2CLFB 4UCXA 3M6UA 3LNCA 5KTPA 2AYZA 4FZ3A 3I9LA 1L4BA 3ZK8A 1D9XA 2I67A 1WUTA 3E2IA 4LHSA 1O9GA 1V3VA 4QDXA 4R2JA 3V97A 1Y3FE 5K3AA 4QQKA 3WQHA 4M37A 5KOHB 1SMKA 1VKOA 3LM8A 3N0TA 1BMDA 4LTMA 4MWTA 4ZVKA 2CW5A 4J3NA 1UEIA 4RTOA 2OV6A 3M6VA 3RUIA 3O73A 5KOYA 1DAEA 1XZIA 1PR9A 4XD7D 4H7DA 3MTIA 2JIMA 2XWSA 3L7DA 1M34B 3K6JA 1ODFA 3ABRB 3ADDA 3MYRA 1TPZA 1Z5WA 2IYSA 4FD3A 3I61A 1AN9A 1OMOA 3BA6A 2FI1A 5JEEA 1Z83A 1PWXA 5AJHA 2R6FA 3W6PA 4I1YA 3W4KA 1UWLA 3T3NA 1JHQA 4MVWA 1A5BB 4JSRA 3WFJA 2J9GA 2HR1A 1U0JA 3KAQA 4EX6A 1OLSA 1UT6A 2AI2A 4XM0A 5KSOA 1EHIA 3BN3A 3WGYA 3FAZA 3LCCA 5LKRA 3DTVB 1QR2A 1A9XB 2RHDA 1JDTA 3UFXA 3OO1A 1BQEA 3M6WA 1ECGA 3IOYA 1Y80A 1KAHA 1XJ5A 4QM6A 1VCNA 2Q1XA 1W8IA 2Q1TA 4FYWA 4M46A 5AI4A 5H16A 2OKGA 3FNGA 3E8MA 3GQBA 1BU5A 1XP8A 3L0OA 5MDHA 1XJCA 1WU7A 4OB8A 1U3FA 3WIEA 3QQ5A 1VDZA 2NU7A 2Z8ZA 4BU1A 4BCDA 4K9DA 4QUBA 2DVMA 1A8HA 1CRPA 1ZDMA 4UHEA 1G9XA 1ESCA 2AKAB 3BCUA 3CLRD 5BNIA 4D82A 4EOGA 1UJBA 4RVGA 1A5ZA 3P5SA 1BE0A 2YVUA 1XAJA 1XCGB 3BFXA 3QLVA 1I36A 3K72B 3PT5A 4OSEA 1EX1A 4RPJA 2V7UA 1PHPA 5REQA 1AGPA 2W2MA 4YXWA 2OZLA 3ACCA 4TLBA 3KTAB 2VNHA 5KVSA 1E8DA 4F9FA 1L7MA 1G64A 1HFJA 3IGFA 4BO3A 2Q4EA 4G5QA 3OZRA 1HYEA 4RTSA 2R97A 2VT2A 4ERNA 5LXTB 1HT1E 3M5WA 3I1JA 1L4NA 1XD2B 3BX1A 1U8TA 2GYVA 1VLHA 4MRSA 2OAQ1 1C3OB 2WSYB 3T5GA 3TLAA 4I81A 1UAGA 5H02A 4RMNA 5E3JA 3T3HA 1WUJS 4I6EA 2VYVD 4KW7A 1PKEA 1V6SA 4KE9A 2JGAA 3DE5X 3M6IA 3PQ2A 1K8XB 2C9MA 2VRCD 4ID9A 3V8EA 3DUFA 1J07A 1IDOA 2EJVA 3GC6A 2FTKE 3SQDA 3G2LA 4D3YA 1VBFA 4QLAA 2BY4A 1EZ1A 3T12A 5JS2A 1IQ8A 3ZCTA 2JLAA 4ZYYA 4PG4A 3IL2A 1PW5A 3GUVA 4DQLA 1Y3AA 3K31A 1ABBA 1JIXA 1LVGA 3IDFA 4JGIA 1MVOA 4P35A 3BT7A 5AICA 5BWBA 1VTKA 4X24A 2VVTA 4ZTBA 3I76A 3DM5A 3VX4A 5AESA 2QI9C 5EINA 4OI1A 2D1TA 4UFOA 4MUNA 4U2DA 1XNEA 3H2KA 1J9EA 1JE0A 3O8LA 4LDQA 4MPPA 2H07A 4JLBA 3URMA 2B1JA 3P4YA 5F7ZA 3GRKA 3X1XA 5H5JA 1JTVA 4QGBA 4NBSA 1YVRA 3AV0B 3SC2B 2IVZA 2VTEA 3ETHA 1QO9A 1PT5A 3JZIA 4QYTA 1TB4A 2QTHA 3DOHA 3FMGA 3G0GA 3K2EA 1UKZA 1C14A 3L6RA 2BR3A 2PHZA 3OFSA 1CT9A 3OHSX 3PGLA 4HJXA 2V7PA 3IQGX 5IVDA 2VP9A 4E03A 1ND6A 4KH1A 3CN9A 4AWBA 1FNMA 4KTVE 4AMVA 3KQYA 2HZ7A 3AB8A 3A11A 2C57A 4BZQA 4QOFA 5HFJA 1D5CA 1H6BA 2I87A 4LGCA 5EWLA 1MUUA 1U9YA 2BGIA 2YNMC 5HFAA 1EK1A 2I8AA 3STVA 1G17A 2WAMA 3ROQA 1LQ2A 2CDBA 1O0SA 2CFSA 3F6SA 3OIVA 4G6ZA 2HFKA 3HBNA 1XXHE 4AQYB 4HBGA 3PXCX 3K3PA 4E5DA 2AEJA 2GR9A 1TEVA 1THTA 3AB7A 1LDBA 1JXQA 1T26A 2HDWA 5DP2A 3AR8A 4FNOA 4D4KA 4ND5A 3DMGA 1VHJA 2H2GA 3LAWA 4LQ4A 1VP3A 3UT6A 1UBMS 1TJPB 4JLNA 2JI7A 1QKJA 1EKXA 1SC3A 3WP1B 3F6EX 3FYDA 3UQZA 1QTIA 1WUIS 2JFOA 2QXYA 4Q9HA 2I22A 1ZCAA 2L82A 4PAQA 4BP8A 5JD3A 2VQFB 4OU5A 5J9FA 3SC3A 4ALKA 4UCWA 1UMBB 2ZTSA 1K06A 4MLPA 3HACA 3T5BA 4OH7A 4A16A 4YT4A 3TW8B 5CX1A 1OZFA 1XKQA 4AJ2A 1T8WA 4HN4B 1GA1A 1KZ6A 4GWKA 3O2JA 4MAFA 5CX4A 2C1EA 1M2OB 3L06A 5JFGA 1FDSA 1ZITA 2G63A 3WYNA 1NXWA 1VKJA 3GT7A 1G8SA 3LA6A 3A31A 1VGRA 5AO9A 4BCBA 2O8NA 4P32A 4A0QA 4ESVA 1FPMA 3EPLA 3NT2A 1L5HA 4QODA 5KJFA 3AUFA 4KSYA 3ADBA 1EIZA 4KI0A 3SG0A 1ULTA 1UJMA 2ZUBA 1NYQA 1Y34E 1ZKMA 3CX4A 4OHFA 2F9FA 3KAKA 3AXTA 3M5CA 2ZSKA 4Q1FA 1AS2A 2ATVA 1TE2A 2IDJA 1MJHA 3K2QA 1QHHB 3O83A 4L74A 4BAZA 4F2WA 1XMQB 2FPPB 2OD2A 3W8FA 2AC2A 2GBCA 3VTZA 3UKJA 1L4EA 1LI5A 1OV6A 2W2VA 3W5JA 1YOVB 2HA0A 2B83A 1H22A 3DKVA 1H8EA 2F8TA 1PEAA 3AM4A 3GG2A 1XNHA 3HGMA 4CLXA 5IDXA 2QTRA 4RKQA 3TXYA 1LTHR 2ETVA 5TS3A 3QX9A 2J6IA 4Q7QA 1I7SB 3C3KA 5CCBA 4GQAA 4DPMA 2C5LA 2J48A 5IC5A 3PGMA 4HYYA 4P5DA 5E95A 3GLQA 4HTFA 3HB7A 1RPTA 2XXAB 1BOFA 3BXEA 4EA8A 5LP6B 1LC0A 3OA2A 4DNXA 4FIDA 1MQSA 1UBJS 2DHCA 3BJIC 3IAS1 4M8NE 3GGJA 1YJ8A 2GEKA 5EESA 4IIBA 1UOYA 3HRKA 1AVTA 3PYXA 3PHGA 2XZPA 1Q1BA 4D25A 1JEDA 5HMMA 1OPRA 1QIFA 2AOVA 3JVDA 3PC7A 3PQ6A 2QYTA 1EP1B 4IBOA 4TMTA 5EKSA 4DZRA 2V3CC 3ZD7A 3KV1A 2IYRA 3B1ZA 1YC2A 2YIVX 4C76A 5JC1A 2DHQA 3HEBA 2JARA 2P6UA 2JS7A 2I7XA 3HADA 1G8AA 4MWEA 5KYXA 2YWDA 5EHNA 5FHRA 5PGMA 2YRWA 1PJCA 2Y1CA 2A0WA 1XDUA 2ZTMA 1YR3A 3OICA 4JASB 1E0SA 1P2TA 3OVMA 5BV0A 3CZRA 4B09A 4RIEA 2ZZNA 4MRVA 4HTAA 5H81A 2RGWA 3LHIA 4OJMX 3MW8A 4FJ0A 5EMJA 1B42A 4LZJA 5K4GA 2VRCA 4BNWA 3Q8WA 2GN6A 1H05A 3OBBA 3Q87B 3UK0A 3KPWA 1OGYA 1KBZA 1RQXA 3HWWA 1IEXA 1MEEA 3PPYA 4QAQA 3NHFA 4Z99A 2OQ2A 2NXNA 1NJ5A 2IP2A 3NKVA 1QYXA 2MJLA 1FYVA 2PT6A 3A6HA 3M5PA 1SHKA 4JJ8A 2QVXX 1ONNA 5L3SA 2X9NA 1YBAA 1ISGA 2QSJA 3BGOS 3FF1A 3MWFA 4AIRA 4AO7A 5DBHX 4GICA 1XTJA 4X95A 5BN1A 2QP4A 3RIHA 4NYIR 1ZL0A 2WJ3A 2Y1FA 2FPUA 1O94C 1W5TA 5KTOA 3H9JA 3TBFA 1QORA 4RM3A 4NARA 2K2WA 2GN2A 1DDOA 1E3QA 5CYFA 1E2HA 1LV7A 3L46A 2O2YA 1L5GB 5JQGF 4XCQA 3W5VA 1UQRA 3OUUA 3CBGA 3ZGOA 1UMCA 4JBXA 4G1UC 2FDCA 3GJRA 5JCPA 2HBRA 3EWAA 1KL7A 1Z25A 3H9BA 1Y8AA 3M49A 4XSGA 3U4HA 4LWOA 3WWYA 2GZ3A 4B3BA 1E6UA 2H65A 1JH9A 1UADA 3O3OB 5EUMA 1SB8A 3DL7A 3Q0EA 4FVTA 5LYYA 2D5IA 3AGEA 3A9CA 4OMCA 3WDSA 1KORA 1IIRA 2GESA 4F45A 3K1ZA 2OXCA 4I5FA 1LUAA 1ZK3A 3BRQA 3ZBUA 5JSZA 1VOTA 1WV0A 4MR9B 1DGQA 4ECEA 1NVVQ 4FXPA 8ABPA 3ODGA 3T15A 2OCBA 3WYFA 3CKLA 1KI7A 5E9QA 4B3MB 2H5LA 1GFIA 4MVJP 1N6DA 5CTJA 5EYPA 3UH0A 1HRDA 2O7NA 4COOA 4HAVA 3OQPA 4G5FA 4BEWA 4MTLA 4DUGA 1N3IA 4K7JA 4UDXX 4X1YA 4ALMA 1QP8A 3LP5A 5IBCA 3Q41A 4IICA 3AFMA 3P9RA 4CTKA 5TPZA 1J8YF 1ATIA 3C7AA 4PQGA 4K3UA 1JB9A 2WM8A 2FMHA 1FQOA 4R0NA 5FPQA 5ER6A 1NL3A 2J3JA 4EFNA 5DYGA 3O8RA 1YCDA 2Y9PB 3CB2A 1J7JA 1ODKA 2H9IA 2E87A 2Q6KA 3HR4A 3HKDB 3B20A 1N2IA 2UYYA 3OA0A 1PEDA 1VG0B 2CXQA 2O2JA 4I5DA 4QBTA 4C03A 4B3IA 5IU6A 5JDIC 1JEYB 3VC3A 2J1LA 4KQMA 5D51S 3GFOA 4BVLA 2OXFA 3H19A 3IUPA 2BFBB 2ZDGA 3ZTBA 3OE5A 1F17A 3P4UA 4UU8A 3WSWA 2RH5A 4ZAYA 4NMHA 1TO2E 3GEIA 1G3MA 1NE7A 3EW7A 4HPWA 4M9CA 4QC2A 4J76A 4YB8A 4B3JA 1UM8A 3CV3A 4V2UA 3NYIA 3EDOA 4NBKA 2CBXA 2ACEA 2VRNA 3AHFA 4UNQA 3ZY2A 1NUAA 2MDTA 3FMOB 2Z9BA 2F17A 2R47A 2CVOA 3L01A 4JUAA 4X60A 4R7TA 4MIKA 1X8XA 3QGMA 4PSAA 2NOAA 5DM4A 1FX0B 4OQMA 2HMYB 4DA8A 3SS9X 4PZEA 2QRGA 3X0DA 1QXSA 4TWBA 4C87A 2WWWA 5M5BA 2EFCB 3JVEA 3RS4A 3C15C 5EE0A 3EGEA 3A58B 4DIMA 1KWKA 2L17A 3HBJA 3NDPA 3ZDDA 5J5CA 1QCDA 2ZO9B 3QWBA 4EKDA 1P2GA 2C8KA 4JI5B 3U4GA 3QBJA 3EDCA 5DRTA 2QLTA 3H1PA 2REBA 1CR4A 3JD4A 4R4JA 3VJLA 4A10A 4FZJA 4RJKA 2Q5IA 5DTRA 4YDQA 4IXDA 3OCYA 1VL2A 3V1NA 4XGQA 4U63A 4ZYUA 3S5UA 2O8DB 1Z2CA 3NTOA 4MUHA 2WWVD 7MHTA 4D5GA 2EG5A 1J9GA 2ECOA 5K0JA 3H5LA 1ISIA 3D8RA 1JEQA 1N2HA 2H51A 3FCYA 4LOJA 4CCWA 3AIOA 3HV2A 3N2GA 3IR7A 1UC4B 3FA2A 1QUEA 2JGDB 4WW0A 4QARA 2E2WA 3V1KA 3WNBA 4H3HB 3KUUA 5FBHA 2QPAA 2WU8A 1IBLB 5DULA 2WHXA 3SC4A 3I6QA 4U8GA 2BGLA 2HBZA 1SIOA 3DV0B 3GGPA 3IPXA 2EWWA 3HDJA 4HNHA 1NF2A 4CKBB 4C2UA 1CY7A 1NATA 1L7VC 2CUTA 4BKUA 4UUNA 1WNTA 3EXEB 3T1QA 4QPNA 4N7JA 3GB9A 1KYIA 3W5BA 2H1OA 3COVA 1SUSA 5BOSA 3FWHA 2Q9AA 4JJZA 4EG7A 1CUFA 3OE1A 1OLOA 4L73A 2HDHA 2ZTUA 4BE4A 4N76A 1LBEA 1VPTA 2VPPA 2EV9A 2VBIA 4N3BA 2C9ZA 4WL0A 2ZRJA 3L0DA 5CB4A 1L7EA 4JUIA 5LMCA 5FV7A 3GLFB 1IIBA 1VHTA 3OMLA 2VYQA 1LBHA 2GEDA 2OCPA 2WR8A 2ZE8A 3H5AA 5JBIA 3EBOA 1ACMA 2IOYA 3GLHE 4UVEA 2P4UA 3FSGD 4PHCA 4CMJA 4D9JA 1N2BA 1QHXA 1DC8A 3A6ZA 1NTOA 4V3CA 4EGSA 1KI8A 3MWGA 1MR3F 4F84A 2YHAA 2YZNA 1N8TA 3U44A 1QUFA 3L93A 5FR1A 3W8NA 3OOSA 4Y6PA 5FPSA 4UM7A 3N3BC 3RVOA 1SUIA 1JAHA 1BHO1 1LSUA 3CHYA 3IR6A 4L51A 4L76A 1U3WA 2X23A 4MR7B 4O4IB 4UVHA 2QL5A 2EKBA 4MVJH 4B4VA 5CA1A 4BLRA 4AM8A 1GUFA 4YPOA 2B5VA 1SD2A 1SKUA 1TQ4A 4L5JA 3CO5A 1BA2A 3KQSA 1XL1A 4PR3A 2E9SA 1E4YA 1SHTX 1HDGO 3BZBA 4JQOA 4W6QA 5AUPB 3G2MA 1S3SA 2AYXA 1JU4A 3O9ZA 3TIGA 3EIQA 4MWZA 4MO9A 4NU5A 3GJ8A 2VDOB 2X7HA 3GPCA 3S8MA 2EBWA 1SVMA 3UJCA 1NBHA 1YRBA 2FMUA 4G37A 4P36A 4QPJC 5BYBA 3WLIA 5CHYA 4RPKA 3ZIUA 1AZSC 4EYSA 4BX2A 4GBGA 1KEPA 1WETA 3W8EA 2ZUSA 4DLVA 2NPFA 1OB2A 1GZ7A 5JALA 1XF1A 3EXG2 5TQ0B 4C0SA 4GL2A 4LZPA 3FCCA 2OV8A 3TNJA 4BLTA 3C7CB 4HJRA 4F2DA 3KLPX 4PONA 1JBEA 5AJZA 3RYCB 1GN9A 4CNBA 3FPGA 3MGCA 4LTNA 1W4LA 3J7TA 3QWIA 4MR8B 1J1IA 1ZOLA 1G19A 5B7GA 4G1CA 3WJ1A 4ITUA 4BV3A 1QH0A 3EQ2A 2P79A 3AERB 5CYGA 2ZJBA 1JFFB 4D3DA 4CV3A 4IJ5A 3A9VA 5COBA 5AW8A 5G3ZA 1YB5A 3RSOA 2C1XA 4OLJA 1LZKA 1I2CA 1XHFA 3HP1A 1LK7A 1FTWA 1UDAA 3S4YA 3SMVA 1KEWA 4OSPA 4UOZA 3GDGA 4TS3A 1HDIA 4I7EA 1SUBA 4IY1A 2QAGC 4NPAA 5JYEA 3I2IA 4NNJA 3QY0A 1Y9EA 1A5TA 1H2FA 4CI0B 1TKBA 4UTOA 4F92B 2AVNA 3IB3A 5EQFA 2Z2XA 5BYAA 2I6TA 3WYCA 3WB9A 1IRIA 1TU4A 4PFQA 1NW7A 2YHBA 5BPHA 3KXLA 3VH2A 2AI1A 3EHDA 4IL5A 2RBGA 2FN4A 3K0EA 2GBGA 2R8YA 4XSHA 3PP8A 2A9FA 2C20A 2PQ2A 2QNRA 1S2GA 4BQQA 1Q3TA 3U4QA 1ADGA 2AI3A 2YFKA 3DQZA 5KJ1A 2DETA 3G88A 3OM1A 2R7MA 3U39A 1ACJA 2HO5A 1SXIA 3H2ZA 1PHRA 3PFGA 5HKAA 2AUTA 2ZIEA 4PO9A 4DARA 1LSSA 3TFQA 1XP5A 3KT6A 1HLPA 2P1RA 3Q7RA 4HP8A 3FWKA 4F6RB 5HGXA 2CWDA 4V0SA 3ONWA 4QOHA 4N3CA 5EMKA 1U6JA 4DSOA 3MD9A 4HQFA 1JHOA 3C1OA 2Z83A 3TSCA 4A15A 3IOMA 3IQIX 1FNNA 1I10A 3CE9A 1QZXA 2XCQA 2FSIA 4DNFA 5IXSA 1I4DD 3IQXA 5DXAA 4A03A 5JNRA 2B7LA 1B4DA 1D9ZA 4MJXA 3D2BA 4S1WA 4Q1BA 3JATA 4F3RA 1Z13A 1W76A 1G5IA 2GN8A 3QE9Y 2V6IA 4N7MA 1OT3A 3VQTA 2P9ZA 1RI3A 4JI3B 3OHPA 1YR2A 5JPCA 2IDZA 3ORQA 4KE8A 4NDAA 1ZG3A 4M9RA 1C1XA 1TM2A 4Q4AB 1N6EA 3OEHA 1PV2A 1VPLA 4JL6A 4Q15A 5K7SA 5KWJA 3ONFA 2QR2A 4Y9RA 3AKYA 4AJKA 4HWPA 2NU8B 4P8RA 1ZH6A 5C5EA 1Y48E 1YI0A 3IDSA 2BEJA 2RFLA 4TLLB 3SF0A 3GLFE 2YVQA 3I23A 3OX1A 4FGUA 1TI7A 3L8CA 3M83A 2X9LA 2AD1A 1JEJA 1SA0A 3AJAA 5EPOA 1XEXB 1ZR4A 4Y30A 1A76A 4C0JA 2ZT7A 4CLDA 2RGCA 3R7SA 3CUYA 2J9YB 1GTRA 3P2YA 1TUBB 2PUDA 1Z63A 3D0KA 1GQYA 5GONB 2W6QA 5C2JB 1QIJA 1CY0A 5GV7A 1DFIA 1TEZA 1FS4A 1A9PA 3SSAA 4B4WA 2AUSA 1R5NA 4G81A 1JAXA 3CUTA 1LPAB 2WWIA 4YY3B 4AEJA 1SC9A 2DR2A 4IIDA 3C5WP 3UFBA 2CLEB 2R5WA 3TSYA 3D6NB 1OAOA 4QKQA 3RC1A 4D4IA 3CH5A 5E4JA 3FFXA 2EZUA 2REQA 3JQAB 4E5UA 4WK2B 2QUZA 4CDRA 1A98A 5COAA 4IIHA 3QVOA 4KBYA 4UEKA 3ZHOA 5CT5A 4DMCA 2C88A 1OX4A 1G18A 4PX2A 2H00A 2O0LA 4ENVA 4W8OA 4O2AF 1E2GA 1FTNA 1C2YA 3A26A 4UATA 4D5EA 2NUAB 1IL0A 4NHOA 2PSDA 1A95A 4E3ZA 3R4VA 3B6ZA 3AB3A 4HAUA 3QLVC 5T7BA 1E3JA 1WP4A 2OBYA 1QFXA 1G16A 3ETLA 3V4LA 1JYSA 3MJSA 4WVLA 3WDKA 4LECA 3K6SA 2YC2C 1LW6E 3L7MA 4Y6GB 2DFDA 4O8CA 4B76A 3NBAA 1VE7A 4YXFA 5JS6A 2D4HA 4RTNA 3EGIA 4AX4A 4ANFA 2A5FA 2ORVA 3GGOA 1KY3A 4ER3A 4ZYWA 2JLVA 1KAQA 1Z5NA 3ETCA 1FUKA 3WA6A 4A6DA 1E20A 3URKA 1EFTA 2IW3A 2WUFA 2TMYA 4RGQA 5AXAA 2QG6A 4ZCIA 4P4SB 1E3SA 3OMWA 4JT2A 2WQ6A 3L18A 3ENZA 4TV9A 1PFUA 5CB6A 4MUXA 2XHEA 4EO4A 4MWGA 4MUFA 1V1RB 2C5FA 5IM5A 1S9DA 4MQFB 2F3QA 4GR5A 1MA3A 1P2FA 4X1KB 2W42A 2ZP1A 2W2LD 2B5WA 2HEIA 1K2VN 4HGPA 5G0UA 2XIJA 3OQVA 3OAAD 4E33A 1AZLA 1AUQA 5LYJA 2F1JA 5I7FA 1I7DA 1A5AB 4J4TA 3BXXA 1P7VA 2YJNA 2WHPA 3TSWA 1V8PA 9GPBA 1E64A 3BQMB 3N2YA 2JCVA 1Y6GA 4BXOA 3N59A 3GN1A 3CURA 2XEXA 1MH9A 3H2HA 5TT1A 3RK4A 5GPBA 3HCCA 4OXQA 1XU4A 2PT5A 5DHRA 3GRRA 5FPHA 2C8LA 5LD2B 3W2HA 4WOPA 2GNPA 3F7MA 3LT0A 4RYDA 3DCYA 5LM3A 1VBNA 2M6KA 1Z5UA 4ND6A 5ILOA 5E0OA 2P9CA 3FTDA 1X0XA 3AHDA 4B5LA 3UK6A 3H8JA 5CLIA 5TDHA 3F1LA 5E9WA 2W4MA 1GNVA 1IAQA 1KFJB 1ZVMA 3CONA 3EY4A 3K15A 1NURA 3NAGA 4NZNA 4RVDA 2XTNA 5LLSA 1NYLA 5BY2A 1N34B 4KNYA 1VJ1A 4V0QA 3EQ8A 1OUMA 4EJ2A 4B47A 2CBZA 2IBMA 3IULA 3OZEA 5AI9A 1QLJA 1KK0A 1TFUA 2WP8J 4OHPA 4AO8A 5HOEA 3AQIA 1R6DA 1Q7HA 1VJRA 1Z2AA 2AQ8A 3EJ6A 1M6WA 2IYEA 1B8OA 1BXRA 3G85A 2PMDA 3K0AA 4UBJA 4WK0B 4M98A 3ZUGA 3MUFA 2AHRA 4PLFA 3H1GA 4PHHA 1PLLA 1RKXA 4X8OA 3SYNA 2I9KA 3C5CA 1XCLA 5JJCA 1G5PA 4OBEA 4QDZA 3GFVA 3V4VB 2WVGA 3NBFA 4UHJA 4CLRA 4HNTA 1SGWA 4ZVNA 4M8KA 4IJUA 5JD4A 2VAMA 1PR4A 4NY1A 1RKQA 1OZAA 1WXGA 1IN1A 4HZIA 1CERA 2HXYA 1XTRA 1U28A 1O97D 2IU6A 3QQPA 4L0DA 1KGSA 3REOA 3UICA 4BVKA 4KITB 5IANA 3CVUA 1DTSA 2GPNA 5KSZA 1QAQA 3F47A 4EELA 3G0HA 5KDLA 5KTNA 4NZPA 2H7YA 3M9LA 1ZGCA 2AG8A 1ZM2A 3T6OA 2C99A 2P90A 4G8BA 4HF7A 4LHEA 3ESAA 3SSMA 5AUNB 1SBIA 1XVTA 3TD9A 3QLUA 1XG5A 7MDHA 2W58A 4FJ2A 4HAWA 4RVHA 4RE6A 4KNWA 5J43A 2R87A 4CM7A 4ZT7A 2HPVA 4EPYA 1YNSA 5BSHA 1E2MA 3WMFA 4PYQA 2GZ1A 3D7KA 3QTLA 4Y2XA 4ECAA 4XWOA 3TBKA 2C4WA 2C82A 5C1BA 3GU3A 3E5HA 1KQPA 3ENVA 3TPCA 2BMDA 2PDAA 3ND7A 3O4GA 4OFBA 3HU5A 2JIZD 3N6VA 5JS8A 3OE7D 4WINA 5ICGA 3DF9A 1R18A 5KVAA 5AKZA 4B2PA 1U4NA 4M88A 2Q3EA 4B75A 1GPLA 4LRSB 1Y8RB 1S1MA 1XJQA 2B61A 2VWHA 5JJ5A 3KSZO 4C0BA 1EK2A 1L5YA 4LV6A 1A9YA 2BUCA 1SCUB 1KY4A 2ID8A 3JW8A 4GQIA 4HQ6A 1MX1A 4F97A 4YAGA 5BW8A 4GD3Q 4EATA 5IASA 1RI2A 2BDEA 1XA4A 2I1VB 1CQIA 3GRVA 2QL6A 3IPYA 4RZ3A 3U28A 5FNZA 3TUJC 1TXGA 3MHPA 5CJPA 4DJJA 3BTVA 1U1CA 1JA1A 4P83A 1BRTA 1LPMA 1LRJA 5J40A 1GSHA 1QOQB 2CLIB 4GVXA 3KVVA 5CT9A 2PUWA 4RHEA 2EX4A 3BTOA 1AQLA 1CQJB 5JBNA 1NMEA 4RSRA 4EJ6A 3R5XA 1DC4A 5YASA 3FPLA 16PKA 1OX6A 4K6HA 3GCZA 2I4OA 4DCPA 1EVYA 3NHPA 1U7PA 1UK6A 3E3AA 2X15A 3CY6A 1THZA 2B92A 1ZOPA 3KKEA 1FE8A 3H9EO 3L8DA 2QDKA 2Z04A 3DEZA 1NXQA 2UVPA 1HA3A 1L5MA 5JHGB 4FMCF 2IH4A 3EG9B 1RADA 3ITEA 3JTEA 1S6YA 4XARA 4LF8B 4BU0A 4IQGA 1AKNA 2Q45A 4YRJA 2R1VB 1YVDA 3EFOB 1P0CA 3DCIA 3ZX4A 4OQXA 2QTFA 5K0LA 2PXCA 2GI4A 3C48A 4TL9A 3LXMA 2CLDX 3AESB 1Y9ZA 2HV9A 3O9VA 2DGDA 2PNFA 1D8TA 1TF7A 2OCYC 1UAAA 4WXPA 3CEAA 2IX3A 1W88A 1EEHA 3PDJA 4C6RA 2AZTA 4KU4A 2ZSIA 1OU4A 1ULSA 5BXYA 2IGBA 2H18A 3P2MA 2HCBA 5E6UB 1QVVA 2C3YA 2VL7A 2PRSA 1GILA 2HUNA 2VWQA 4NOLA 1BIFA 1HSZA 1XYYA 3CX8A 3QG5A 3TGWA 8ATCA 4JJFA 4YDHB 5JAZA 2QPOA 3LYUA 3L0PA 3HCEA 4JR0A 2JFUA 3CB4A 1WHTA 1LPNA 4YRCA 1XRQA 1T2DA 4EP1A 2I80A 3Q7TA 2FSPA 3B1JA 4Q16A 4WLEA 3D3KA 1A04A 4YECA 5EMMA 1FFGA 3F97A 4YV0A 2J3KA 4FBLA 4XJSA 5G41A 4LRWA 2HMWA 2Q0SA 2ZJ5A 5FQNA 4C0KA 4YRZA 5FTJA 3QF4B 4JR1A 5I9TA 4CQMD 4J4HA 5E8JA 5I45A 2RMKA 2GJKA 4D3FA 3N87A 1YZVA 2VEDA 1SM4A 3FM9A 4K6FA 1RZVA 2FP4B 4QRIA 1W9HA 1U0SY 2XUDA 5GZ1A 3QKSA 5AJXA 2W5UA 2HRCA 5L40A 1FC6A 4M0LA 5MFPA 3VBCA 4G86A 4OL0A 4BFYA 1P62B 2ON6A 3A14A 4UD2A 1JVSA 3UUEA 1QQTA 2IS6A 2ARKA 4V0RA 3KD2A 2VAVA 4MEBA 4MJ3A 4RK6A 4GXNA 3K0FB 3THXA 3QMMA 5EJFA 1ZQ9A 1T4CB 5LZ2A 1CUBA 2G4CA 5D3MA 4HZGA 5DTJA 3V5NA 4KN5A 4NBRA 5AKYA 1OXSC 3LCUA 4TZ0A 4TYYA 4UTZA 2YIDA 1E61A 4Q3OA 1MB4A 3MC1A 3QVTA 1YBHA 3OECA 1J42A 3HE3A 1ZC4A 1DG9A 5FLYA 1A8IA 3QVJA 1A2KC 2KM1A 1XVAA 2J3QA 2YMPA 1N9KA 5H3HA 1JLLA 2A2ZA 5KNBA 1I0LA 3IPCA 4XPIB 2PCLA 5DT9A 5EEGA 3F49S 3RJ9A 1N2XA 1BA3A 2BSAA 4PLWA 1EX7A 2BGJA 3DEKA 5FFMA 1CNMA 4RDHA 3N28A 5LOVB 1XRSB 5ELMA 1LLCA 2C92A 3DDWA 1R8JA 4NCIA 3C3JA 5HXAA 4MB2A 3CYFA 3FHJA 5CLFA 3LBHA 1EI9A 2Z3WA 1MX9A 1HDEA 4FNAA 3GGDA 4BEBA 2OFOA 1KXJA 3OFJA 5HUQA 5LL6P 4B40A 4RK4A 1KMHB 4RY0A 1ZONA 5F12A 2PH1A 3CGWA 3VZDA 2GF2A 4G5OA 3R7BA 2ZAGA 4DMUB 5B64A 3AM5A 3VAAA 5ADVA 1H9CA 2FFJA 2AOTB 2QSUA 1Z37A 2GVZC 4L16A 3YASA 1CEYA 4E1BA 2A0XA 4P33A 2B35A 3UJDA 3MTDA 4GXQA 3BQNB 1E2PA 3IBYA 3PRHA 4J75A 3TMKA 2XXBA 2PYZA 2ZIXB 4D9EA 3SX2A 3KUCA 4I08A 2JZCA 2ZUVA 3QUSA 4D9NA 2H1FA 4BMYA 3JD2A 3O4FA 3QITA 1KMCA 4HX9A 4Q3NA 3O92A 5EVCA 5EZBA 1H2BA 3EASA 4IIJB 3D79A 2V3VA 2FPMA 3HUTA 3MD0A 3MK31 5FKJA 1T9DA 1UBFA 1SB9A 3U7EB 3JY6A 1IQ0A 5JOQA 5KNLA 1HOXA 2O3RA 2Y71A 1Z4LA 4G8CA 1H2RS 2BHTA 4ZGGA 1DLJA 2C9CA 1DMRA 3ABIA 4OGWA 1GUAA 3MLBA 4G0OA 4MCHA 2IOHA 4EABA 2J45A 3JTMA 3BSFA 5K09A 2EGGA 4X3OA 5CR9A 2BSXA 2PIDA 2WFLB 1GZUA 3GPLA 1KI6B 2ZAMA 2X4IA 4JHLA 4URHA 4BJ1A 2PVCA 3UOWA 1BG6A 3IPAA 1ORRA 3LHFA 5DGIA 4E5SA 3IVAA 3HB9A 3CVJA 3ETEA 5DNWA 3ESRA 2XIQA 5BSGA 1G59A 1OZ0A 3PEUA 2SCUB 1BCRA 2BGTA 3W6NA 3MJTA 1OSNA 5J1SB 1AKYA 1IFXA 2LVBA 2H0AA 1ONOA 1JP7A 3C6YA 4ZO8A 1P81A 2FYTA 821PA 4R6XA 1NJSA 4D81A 4B7ZA 3MA0A 4YONB 3O3CA 5BUCA 3GFGA 4DBLE 1NP3A 1YQ9A 2FPOA 2J0VA 2WWXA 1F2VA 2ACVA 4FWBA 4WFQA 3GRZA 4ZQCB 1C7EA 4B0OA 3SQXA 1YR9A 3OJEA 5KWEA 1OAAA 1HI9A 4J2OA 5FWYB 2GTIA 5LVAA 2QOEA 4YJ2A 5AVJA 4DJFC 5FIUA 2GF0A 2IYWA 4INPA 1JDZA 3H5OA 4K8RB 8AT1A 1UK8A 4RCYA 3X1ZA 1GQSA 3QKRB 1T5LA 2I1QA 3T6KA 3BE4A 4CM4B 4FGSA 2MYNA 1XK6A 1LVHA 2GYYA 3G5LA 4JLPA 1TA9A 4Q9KA 3PR1A 3O03A 2KB0A 4RL6A 4GDFA 4Y98A 1E5QA 1KZHA 4HDNB 4EUNA 4M8LA 5ARDA 4DC9A 1HTWA 4E7OA 4YS6A 5JWRA 4PQYA 3CLKA 3N74A 2MSWA 3EVEA 2GAIA 4IMIB 3SLGA 4MDHA 5JD6A 3AGPA 3ZDFA 3Q6MA 5LP1A 2CVPA 4MVJE 1E2KA 5AM4A 1ZHFA 4J8PA 3N2ZB 4MQ4A 1CRQA 4PO8A 3MXTA 4EB0A 4NJEA 4ZKDA 1E1YA 4IIXA 5EIXA 4XIGS 1ISJA 4AICA 5CM8B 2A35A 1U1IA 1YJ5A 2PANA 1HBJA 1VJCA 3AZOA 3DBVO 3DWIA 3OJWA 4G8DA 4XW2A 3FCEA 1GNPA 3K2IA 1U1FA 5FT9A 1Q7TA 3F6BX 1T9BA 2W90A 1FDTA 4BV2A 1H2HA 4HEA6 1UZNA 2PUEA 1C7QA 3GJXC 4FD2A 3VH1A 1JR3A 3RBVA 3MOSA 2QGZA 1RP7A 2C54A 2VF2A 5THXA 4JB2A 4RIFA 4HI0E 2Y05A 4K5QA 3UCEA 2HSZA 2FZKA 4Z7QB 1ZJ5A 3AW8A 3G9XA 5CA1B 5I7SA 4ZI7A 3R3ZA 4ND3A 1N5OX 3NUGA 3TYXA 2MR6A 5TT0A 4BN0A 1XN1A 2HJSA 3LPNA 3HUUA 3QVSA 5GINE 2ZR9A 2GAOA 3FUXA 4YEDA 3AGDA 3HYLA 2FMXA 2ISSD 2IYAA 2OV3A 3DE4X 1QYDA 1FMCA 4X8LA 3RE1A 4H7KA 2JAQA 2OCAA 4OQYA 3RRZA 1N2OA 3NC4A 4QECA 2J67A 4EFMA 1I80A 5T4HA 2WA2A 3PWSA 1YC5A 3V8BA 4BRUA 2PS1A 1T4MA 2VCHA 3KZ1E 1HQDA 4ZOLB 2JFNA 1IY9A 4UXHA 3I8SA 5JAOA 1FFYA 1ESEA 1UOPA 4IFEA 2AMVA 3HB4X 2NVWA 3OOWA 4RF5A 3D4BA 1UC9A 3R20A 4HWKA 3LKBA 2F3PA 5ITWA 2FW7A 1BS9A 1J49A 2ZBRA 4XWTA 4B71A 3D5QA 3B9PA 2C2XA 2PJZA 2DBVO 3IP3A 3W3AA 4LZLA 1YZTA 3HEMA 5T5QA 3FWZA 1UQUA 2BW0A 3KJQA 3T38A 2HY7A 2Z58A 2QNBA 4RM2A 2JGFA 4NMMA 3TTUA 4LW8A 1FJHA 1W2HA 3LY5A 1XZCA 3R5KA 4BB6A 1KIMA 2FSUA 2OENG 3ANYB 4KXQA 5DSXA 2QM3A 3L7YA 2I6GA 2XCUA 3P2JA 3IPLA 1M76A 2F9MA 3FFBA 4ENWA 1U11A 4L0MA 1MC4A 1AUXA 1I13A 3DMDA 3PTZA 4YJ3A 1LFAA 3HC7A 2B3DA 3FTNA 2CLMB 3IIEA 1A4IA 1L5OA 1NY5A 4QTUB 1IOWA 1U7OA 1YRAA 1N7IA 3JYOA 2AXNA 4UXJA 4YLEA 3SR3A 5HJ2A 3I9MA 1Q14A 2J9FB 3HA3A 3N1UA 1WD5A 2PQ0A 1F4LA 4PCUA 3WNZA 3U4CA 1G20A 1EQ2A 1USVA 5EQTA 3BD6A 2E21A 2OFFA 4DCJA 3OIZA 3MXOA 1QRUA 4FILA 1WMDA 3W34A 5LP6F 2UYCA 1ZLXA 1FA9A 4H18A 1FTQA 1YL5A 2ZYSA 4HX2A 3IHBA 3LO5A 3OOJA 1SD1A 4OQNA 4CKCA 2PH7A 4YBRA 4FCTA 1Q0SA 3AR7A 1CY4A 4TGLA 3CKYA 4TKZA 4D42A 4DS3A 1IM5A 3TTTA 1BE8A 1CUVA 1OJLA 2HBYA 2YBEA 5H80A 5JYBA 2OOKA 4KXXA 3THSA 5HDQA 4A92A 3HFGA 1QVRA 2G5PA 1XDBA 2M98A 1GZDA 1WMFA 1W5BA 4AF6A 4EAAA 3K70D 1O6GA 3E9CA 4UULA 3QENA 2JBHA 1YF3A 1KAOA 1MW9X 2FVXA 5FADA 4FDTA 4D7AA 2X0RA 2OORA 4MMYB 5JT1A 3P4XA 3V42A 5DNUA 2NUBA 2OHOA 5AQ1A 1DRJA 4FYVA 3TLEA 1SCQA 2WVHA 4D96A 5CG2A 3N8KA 4X64B 1NRWA 1GTL1 4LYDA 2JFGA 1ZS9A 3FMVA 3PICA 2BGMA 3OZIA 1P3JA 2ROQA 2QM8A 3K9BA 2I4RA 4PF1A 1V8OA 2W2OA 2FWRA 3PT9A 2BTOA 4QICA 5FL7A 3GLGB 1PDVA 2QR3A 4L5BA 1SUEA 2DJIA 2FN9A 1HLFA 1Y81A 1XMJA 5AOVA 2PWZA 4OQQA 2J33A 5SICE 4RK7A 2NNWB 1R12A 5E4FA 4BVBA 2Q9UA 4AKGA 4BRWA 1V5FA 2QN6A 1T4GA 1OFHA 4N9WA 1BJTA 4U9UA 4C1NA 5JZ9A 1NQAO 4HH0A 3CVOA 4EW6A 2HUPA 3AHGA 4JBHA 3JQRA 1QTNA 3H1BA 3LH5A 1QYWA 2ESRA 4WNYA 2E48A 2O0KA 3I9OA 1CJKC 4QUGA 2B2NA 3KJZA 5A06A 2V0CA 4C7KA 3GDOA 3UXMA 4J7AA 4I1IA 3M5DA 4BZWA 3WB0A 4AP6A 1OAKA 4DOMA 1YB7A 3EMDA 4DREA 4XDZA 5H8WA 3HDVA 1EG2A 3HJGA 4MI6A 4ZYZA 3NYWA 1FNBA 2V5UA 5GZ3A 1EUYA 1GPYA 1J33A 4B3FX 1XX6A 2YDXA 1JWBB 1TYBE 1KGDA 1RMQA 1VZ3A 1T2FA 5H3LA 5G4KA 4EPVA 4MPRA 1FJ2A 1EUCB 1L1RA 3VYRB 4PHGA 1K08A 4I5IA 3BWEA 1DKMA 4WNIA 2PO7A 4LA4A 4UD6A 1ZN2A 1Y6ZA 2FXVA 5AHKA 4AUNA 3EMBA 2PQ6A 4BLQA 5F7XA 3ZQUA 2FDRA 3F2VA 4EB6A 2GPAA 5JI2E 3MNFA 3OPYB 4JQZA 4MW2A 5SZJA 4K8OA 4EJSC 1L1FA 5J3JA 2G80A 2JRLA 2PRYA 4J03A 4RPLA 2Y1DA 4Z1MD 4G0ZA 3O0DA 1M1NB 2QSZA 3TM5A 1QX3A 4YJGA 4BVGA 4EITA 2QP3A 2ZIAA 3TX2A 1W34A 4K6CA 4D8UA 2BJHA 3LXXA 2ADMA 2CL5A 2OGSA 4YO7A 5I47A 3R6LA 5DN6A 5ALPA 4XA8A 4FFMA 4ZAXA 4C0WA 3AMVA 2X14A 2G8LA 3ID6C 4B0PA 3JAMA 2EOAA 5LBUA 3N7UA 2D1FA 3G13A 3IODA 5FEMA 1EUDA 5K3FB 2Q3FA 4KAXA 3PXAA 2HVYA 4A5SA 3AM1A 2X8BA 3LU1A 3I2KA 4A0FA 1PL6A 5F1KA 3W04A 4RD3A 5DTIA 3DD1A 1GOTA 2QW0X 2YHIB 3EPKA 3E4CA 4QRHA 1FU4A 1AS3A 5ALVA 3UHFA 1IJKA 1UJ5A 3LTEA 5A9TA 3G8YA 1KP3A 4L5AA 1S3GA 1JL3A 2LGJA 2W6PA 2WJJA 3WBJA 3AHIA 4JWTA 3TLYA 4UU1A 2VPXA 4MITA 3IH8A 3QI7A 3NJRA 4KQFA 1R4ZA 5GV8A 2WYHA 3I3SR 5IDVA 3GAMA 1VCIA 2VTVA 4Z4FA 1RKVA 4JJIA 4GM1A 5SZIA 4W7IA 3LDHA 4H3KB 1RBZA 2V4UA 3LWDA 4ZJZA 4PZYA 3ZE9A 4R41A 5ICMA 3KM0A 3EVFA 1WZ2A 3BB1A 4P4GA 2QRKA 1KH2A 2BP7A 1ZRHA 3D6FA 3HYSA 4WDQA 1FCFA 5LMUB 1E7MA 3QP9A 3TVDA 4OOEA 1K97A 4M0DA 2GETA 3FGZA 3LWBA 5G02A 3D0OA 2CCKA 4BNTA 3HXTA 3KS9A 4DA7A 1DJLA 3NHYA 4LOIA 5EMNA 2JI6A 1HETA 2PUJA 3RKRA 3H11A 2VNAA 2WIFA 3IXMA 4Z9AA 1VRVA 3W8DA 2AQKA 5EG5A 4FUTA 4QTXA 4EEXA 3QJYA 3NKLA 3B6EA 5BVHB 5K8VA 5FB3A 5BVGA 3IBCA 3I5YA 2FY8A 1Z62A 3JQBA 3PIDA 4JC4A 4JXZA 1UXHA 5KYUB 4HFMA 5C8VA 4UMEA 1DKPA 2ZJ2A 1T36B 1L4GA 2X6QA 4E5MA 4IQ0A 2XQJA 4KDFA 3GOQA 3L1KA 4LDNA 3WL3A 3DE3X 5IARA 1KXZA 2OZPA 1U28C 3ZKWA 3KT8A 1GXSB 2ATEA 2X0KA 4H15A 4ASUD 5ADWA 5H4GA 4TMZA 5EOVA 2ODTX 1N36B 1U2QA 4RSGA 4D26A 1TO6A 1QC5A 5TY0A 5DF1A 3QNUA 4IEFB 2B8EA 1VIDA 5G53C 1KMMA 4JJ6A 2IZ0A 4C4ZA 2FH5B 1Z6QA 3QLUC 3B48A 4KAJA 2QJFA 1F06A 521PA 1T8PA 2BH9A 2QR5A 4BUZA 2QROA 4DCTA 2Z6UA 3DQPA 3D8SA 1LPPA 4EWLA 4HEA1 1D0SA 3WHKA 1OWOA 3RIEA 2H92A 4PNEA 1SBTA 3DLBA 2I2FA 2HJHA 5IC6A 3AEKB 2QU7A 3B9RA 3IRVA 3R3UA 5H7XA 5KYTA 1J5EB 2C4VA 1P7ZA 1UXKA 1WW2A 5LIRA 3HUFA 3NOVA 3RG8A 1EFPB 2NXCA 4QJBA 4RHUA 1O1YA 2ZBQA 2EEPA 3R40A 3BG5A 4OQ4A 2EF0A 1ORDA 1WZIA 1EG7A 2P4SA 4BQOA 1BXZA 3DEYX 3E7XA 3RUPA 4DE5A 5C46F 3JU3A 4URYR 4E46A 4GNKA 2HSWA 1UZMA 3UXYA 5TR9A 3B2EA 1XNQB 4XVCA 2VJDA 2WJYA 1MF7A 3WGLA 1RHJA 2A6PA 2R2GA 2G9VA 3DG9A 4Z53A 1BXGB 2XQIA 3AH8A 3EISA 1QG6A 2YR0A 1BDMA 2GCOB 4NZMA 3VPFA 2WHRA 1BOOA 1G6OA 1W0KA 2WYOA 2XB6A 4U2CA 3DVAB 1P4GA 5EE5B 1TZKA 4JOSA 4YWHA 3U4AA 1JI3A 2JZNA 2ZWMA 1LBTA 3N0VA 4FUQA 5AW3A 1GA6A 1OBFO 3RJ5A 4A8HA 3LT5A 5M3BA 2BT4A 2W2NA 3LRXA 3R23A 4KLRA 4RD0A 3U0VA 5EIAA 3NVKI 5LCXA 2VBGA 3WBKA 1WCIB 5D7BA 2BGUA 4ETWA 1NDUA 4TLMB 1O96B 1R0SA 1YK1A 3FZGA 2ID9A 1OLUB 1D4ZA 2X4LA 2DJ5A 3RFXA 3RH0A 2C9YA 4V0NA 3V8MA 4B44A 2Y66A 3R8XA 3V1MA 4CKWB 4FFBA 4RQBA 1I4LD 3K8OE 5CFMA 3PUKA 5T64A 2ZUCA 2B2XA 1WMAA 2HK9A 1HE8B 3TECE 3M6XA 2HJRA 3RTBA 5JZMA 2ERYA 3GH1A 3MQFA 4GRDA 1QFMA 4X20B 5MF6A 3UYKA 5DNYB 2ES4A 3GAFA 1MIHA 2PRIA 2BEWA 1G5FA 1MRNA 1P9RA 4HEHA 4XH9B 5TEWA 1E1QA 4QDTA 4Y18A 1XKXA 3KKNA 3OUTA 3SXJA 5A4IS 3ENQA 2WU3A 1O3YA 3EQ9A 3JYQA 4II2A 3HA5A 5P8WA 3UGQA 1I94B 3L49A 1YVUA 3TOZA 3UK2A 4ISCA 5CVDA 1FLAA 3NTVA 2QBYA 2QUIA 3LQ1A 4K9LA 4UZFA 1H6CA 1OBHA 1WABA 4MQBA 2CXSA 3OEED 1RQLA 2B98A 4P7KA 4MHOA 4X97A 3TAXA 3GZNB 3KT3A 1DV1A 1JU9A 2Y0EA 3F9IA 4KAAA 4DQ0A 2AFHB 4LHYA 4ZJPA 3V1YA 4LDJA 2JK1A 3THWA 1I32A 1T2NA 2OV4A 2QRPA 1YZGA 2DUNA 3AUKA 3DHVA 2OQRA 4JHXA 1GEEA 1Z5OA 3A1FA 4KJXA 3N2EA 2EIXA 5JQGA 4FGKA 2IUYA 3L4BA 3GZJA 3ED5A 3WLMA 4CEHA 1J7KA 2HSGA 2OWDA 1F0PA 3CRW1 1XQXA 1XELA 2LIPA 4W1QA 4EHKA 4WBSA 3TOVA 5EXXA 1WP9A 2H5EA 3NBZC 4G56A 3O8QB 1E6CA 3P96A 4Y1RB 4UM5A 2ZRGA 4FFLA 1TZMA 3T7SA 5KX5B 1UF9A 2MIIA 1ICEA 3K09A 5ARCA 5KO2A 4F91B 1M6EX 1LA2A 5A7HA 4BFUA 3R3HA 5L3RA 3LPAA 4AUEA 1BDJA 1I9CA 1GY8A 2R1UA 1MNAA 3L5OA 4U2GA 3RVRA 2LBPA 3V7FA 5IT5A 1DT5A 3QU5A 2XLBA 2YOGA 1FW6A 3K9FC 4QJ3A 1CR1A 2GN9A 1PNRA 4OREX 2Y3IA 4RMHA 2PFGA 5ALOA 5JFTA 2ZRLA 4TT3A 2XYGA 4UE3S 4D0SA 1X8LA 2RARA 4C89A 4YRBA 4TVOA 2JAXA 2WD7A 1FP4B 3FTFA 2M6SA 3DM9B 4IZHA 1V7ZA 1LU9A 1DOHA 2OESA 3C39A 4UVIA 5E0KB 1PZXA 1QJ4A 2JJ8A 2MU1A 2ZANA 4KRGA 2KWIA 4NYJQ 3TN7A 4DDHA 5CPBA 2G09A 4NPCA 2A30A 1PZEA 3DZIA 1NN5A 4H0FA 1X38A 1YONA 2PBZA 2WUGA 2ZJFA 3BHIA 4GQBA 3VZCA 3P1JA 4BX3A 2QQGA 2QT1A 4NIMA 2C2OA 5HF6A 3ZK7A 2H85A 1C0LA 4ASUA 1MABB 1XZAA 5BOVA 4H7JA 2Z2KA 2WJIA 1KJQA 3LY7A 4QUKA 5DGTA 1KDPA 3WGVA 4YRPA 5ARBA 1GKLA 4OB7A 1MTOA 3AUAA 3KOZA 4TXLA 2EFHB 4Y2RA 4D45A 1HE2A 3UAYA 2TMGA 2W0MA 3PDHA 5GONF 4DT1B 4E94A 4UTPA 4OHMA 3CX6A 2RGXA 3Q1LA 5ITZA 1N5RA 1YH3A 5LD2C 1JIIA 1KHTA 4L3WA 4DCMA 1N6IA 3CIFA 621PA 5EP3A 1YDWA 2E3JA 3O2NA 4XOIA 4KMOA 3VR5D 4P4NA 5IKMA 1CHNA 2C3PA 3L92A 1C9KA 2P2GA 1ZIDA 3EC7A 2DY1A 4QZVA 2BM0A 3N2IA 5H4HA 3RT1A 3L7JA 3AUXA 2XRMA 3L6DA 3QFRA 4F96A 5AW1A 4RXMA 3SFZA 4EG3A 4IOKA 5EJIA 2DEUA 2RRLA 3AX6A 3GD5A 4AROA 2CV1A 1HORA 1TJNA 1A2QA 3EEIA 3IDOA 4W9RA 4KLNA 2KHZA 3WLRA 1MVNA 2IY9A 3WAGA 3UMFA 1VSBA 2UZ1A 4YCDA 5JG7A 4OM7A 3ESDA 2IUFA 4RO0A 5LNK6 1M8FA 1CIVA 1BN7A 4Q1TA 1VFPA 2BGNA 2CF6A 3CSUA 5F4ZA 1XE3A 3FBWA 3G7UA 4KUGA 2V7WA 4LVUA 4JSTA 3CNNA 3RYTC 1D04A 2ZIUB 5DCYA 4PXAA 3I72A 1UBNA 3IO5A 2I1WA 3HKCB 2YZMA 4EG8A 1S2NA 2GWHA 1HM5A 1RYNA 4K9SA 5IW8A 3HSSA 5K6AA 3HNPA 4MB6A 1MB2A 9LDBA 3BDVA 5KIAA 2D3TA 2ENWA 1QX4A 3HAXA 2Q46A 3DDUA 4O4HA 3TZHA 3W7AA 3SE0A 4LZZA 1N1EA 4POOA 1QKIA 1QYRA 1ESDA 5G0WA 4PVDA 1A7UA 3B51X 4LYHA 5IVHA 3VOTA 2ZWPA 3D03A 1U0EA 2Y9MB 3BSYA 4QWMA 3A10A 2BMFA 4GI3A 3IEIA 4LJLA 5DXFA 3T0GA 2B30A 1MIOB 4OV6B 1RXVA 4UEQA 5KAMA 2VY9A 1B8NA 2FZWA 1IQRA 3H65A 4TXJA 4C3ZA 3DMTA 5KHAA 1EHYA 3QKTA 4KQEA 3MZ0A 5K99A 1ECJA 2PBRA 5EN4A 3J81A 3G5MA 1EFVB 1MX3A 2IJGX 1T6BY 4OP2A 4G0PA 2P9EA 3A1EA 3HR7A 4S24A 1TE7A 1SOVA 1ID1A 1Y82A 2QZ4A 1XKTA 4GSLA 4HLCA 1DWQA 5BORA 2O8VA 1KYVA 5DGXA 2PWYA 3VUFA 5HKBA 1QRSA 3WLNA 3EVTA 2FRXA 2QUJA 3C6ZA 2IV3A 4WADA 1CZLA 2IYXA 2E5OA 4HDCA 4V0KA 2UAGA 3PKZA 3L1JA 1P6QA 3JD0A 1JLMA 3KJHA 4FHFA 1OXBB 1LJLA 2J3MA 3HYCA 3ECCA 3R7DA 5E3HA 1YBFA 3VPHA 4IKEA 1DADA 4MDEA 2W6OA 2YUTA 3GRYA 3D8UA 4F11A 1P0QA 1UDWA 1ESNA 1HQCA 2EKLA 5ALIA 4LCJA 4OHVA 3H16A 4WH0A 5KYWB 1DI0A 4Z3KA 2R6HA 2QKYA 3DHEA 4P84A 4A0GA 3M6LA 1GZSA 3VV3A 1Y7IA 4BZPA 5IC4A 2V4MA 1CLUA 2YQZA 3O93A 3JWHA 4H6XA 4QU9A 4X54A 3ND9A 5E7MA 3SKXA 1SKQA 3R3VA 3OPMA 1DAHA 4KLCA 1XCMA 3C14C 5JLAA 4RFSA 1V0EA 4GMDA 3U7QA 2FN3A 1ELOA 1WS6A 1X9IA 1EM8B 2VJPA 3UWKA 3HBMA 4C05A 4XPZA 3NT4A 5F51A 1W4BA 5IABA 2AWNA 4PN7A 1ESMA 3NB0A 3TTVA 2NPIA 2IIQA 2B0CA 4V02A 3CMCO 3ROGA 3T1OA 3X43A 3I62A 3OKCA 1Q0LA 4CF6A 5A9SA 5ALJA 3NORA 1Q91A 4IMJB 3FTCA 3A2LA 1FMJA 4JT9A 3GHYA 5FOTA 5FBZA 3NTQA 1FZQA 4WZAE 3WGZA 4BHTA 4FNMA 1W0CA 1T5OA 1ZGBA 1MO3A 2IODA 4JH0A 4FS3A 2O2EA 4IZOA 4ZGWA 1F6WA 4UNNA 3SLKA 1VBKA 2X2OA 2ZXEA 2P40A 1Z6PA 2FZVA 2H1SA 2KS6A 1I1HA 4H2DA 4QGGA 4U2FA 3F3KA 4YVFA 4BKPA 2H5JA 5A3RA 1NP6A 1QQ6A 2I2BA 4FCWA 3DV2A 4QO8A 7GPBA 4JKOA 2W37A 3F98A 4ND4A 4Y2YA 5IBPA 3JQCA 4CKEA 2J30A 1SOWA 2B4TO 2GDZA 3CUSA 3H2GA 3Q88A 3MLEA 3MCZA 4MAAA 1WUKS 1TQ8A 4YDRA 3FKSD 4F4HA 3TJRA 4RD4A 1AGNA 3QOWA 4IYJA 5EWJA 2I55A 2BLNA 2ISQA 4GEKA 5CCEA 3WRWA 1DKRA 1XMIA 3GI1A 4MDFA 4ZARA 2VDPB 5A4AA 2DPGA 1CE8B 1R5BA 2KQUA 2FZEA 3AEQB 4NENA 1Y3BE 5B3JC 3NPMA 3WGKA 1T25A 2WW8A 4ZJYA 1HNNA 1HURA 3LYAA 1B93A 2W48A 4WXRA 5C1OA 1RXWA 1YDFA 2HHAA 1FSGA 4C14A 3ZLJA 1SBQA 1E2EA 2GJ8A 1Y1LA 3HXLA 3A06A 1R0BA 1XXLA 3M9WA 4RVFA 5BNFA 4GWLA 4WK4B 2H63A 4PSDA 3FH0A 2VP6A 2EATA 4P22A 2BMEA 4LDAA 1TC1A 1NLFA 1PD0A 1WQ1R 2CDAA 1NHGA 4KUEA 1MT0A 2LTAA 1U7WA 2C61A 2QRJA 3S2YA 2FN8A 4DGQA 1JHRA 5DHPA 1PF7E 1TUEA 5AK5A 4X92A 3ITNA 4E2ZA 5C5IA 1EZZA 1P29A 3E15A 3OU7A 1S3FA 1TUIA 4GH5A 3HCWA 2DBZA 3PPXA 4K81B 4BP3A 4ZYLA 1U2EA 5JAIA 5KTMA 4LOAA 3KCQA 5HCIA 2WJZB 3WICA 3F43A 1JHUA 1PJ8A 3LX8A 4YMVA 2ZB4A 3AWIA 1P9NA 3TSAA 3D9QX 2DP9A 4QE3A 2X0NA 3E0XA 1FS6A 4J0GA 2MSEB 1L7XA 4KRXA 1INLA 4MW7A 3WQBA 1G7CA 4RNDB 1AKWA 1P3DA 2NSLA 4N3AA 2JD0A 3D3UA 4KWEA 1QHNA 2NYRA 3PNKA 4OKNA 2OORC 5D6OA 2FN7A 4EY3A 2GXAA 2DFNA 3TTYA 1F4VA 3W9UA 2Y2UA 4J9UE 1AHHA 1USWA 2CX0A 2ABWA 4DILA 3BGVA 4FHGA 4Z3OA 3I9KA 4TKLA 1EDOA 2WFAA 4YRLA 4YYEA 5A03A 1MLDA 1GL6A 2QM7A 3G02A 3NCHA 4CIBA 3GJ5A 3KYJB 4E51A 1DNPA 1QAMA 1WXDA 2JC3A 2WAXA 3AI1A 5HE8A 5TB5A 4B45A 3FF4A 3DBHA 2J5KA 3T7JA 5JPDA 3B1FA 3W1VA 2EY4A 4HG2A 5IH7A 3EC2A 5SY4A 4RX1A 1X3SA 1BMFA 4R68A 2NO5A 4EHDA 1RMTA 3H7AA 4GUDA 1I2ZA 5EA2A 1JFTA 4RMGA 2EDCA 3G1WA 1G0NA 2PAFA 4XYBA 3H5VA 4XQEA 5ELLA 1LNSA 5ED0A 3TLZA 5HW0A 4WKBA 5HF9A 3NR2A 3F1KA 3OZGA 4KQJA 5TJ9A 4EA6A 4HL6A 1D1SA 2I0FA 1V71A 1YZUA 4MAMA 3TOXA 2N46A 3WK9A 5K01A 1E79D 2G7ZA 4HDMB 3NAZA 4MGYR 5EUBA 1NFQA 3V8VA 2MT9A 3AOEA 1CR6A 1J2TA 3RODA 1KWGA 3TR0A 4ZAVA 3VX3A 1XNJA 3K94A 3PKJA 2ODEA 3IA7A 2OA0A 1H8HA 4A3SA 1QR6A 3D31A 4KZPA 6NULA 1U8XX 2HV8A 4WCVA 1OHHA 4O2AA 1RTTA 3GR6A 3I9NA 3RUEA 4XLLA 3VNSA 3N7TA 1I30A 1Z8FA 4B87A 1Y33E 4B7CA 3NIWA 4Q6BA 3MS4A 3EEOA 3J7AC 1KO7A 1E3WB 3DMHA 4L8WB 2IYNA 4UUQA 1H4TA 2E5FA 1C4WA 2HIHA 3HV0A 2FUEA 3FBTA 3HKEA 4RU1A 2B1IA 4MB0A 4ENSA 4KRFA 5KNBH 1KFKB 2FKAA 5ESRA 4BNJA 3SQWA 1LTKA 1T8SA 3I2HA 1LVUA 5HDBB 4S2UA 4PPQA 1TQ6A 3INGA 3MTJA 3PNMA 4P38A 3KZMA 5DYWA 3DO5A 2WP0A 2O05A 4HNAA 4G65A 3C97A 3A28A 5FULA 1AHNA 2V7BA 1S3IA 3A9WA 4R1NA 2JGLA 3AUYA 5AXBA 5LOVF 2VO1A 1L0BA 4LJ9A 2BHSA 4R9NA 1Y3DE 2ANEA 1FPQA 3BUSA 3L0ZA 3BXHA 1Y37A 2B6NA 1A71A 2WAOA 4L72A 4YMHA 5BSFA 3MVEA 3O38A 3PWTA 1V3QE 3MCVA 3L05A 5KOJA 3KZVA 1AU9A 1D03A 1Q74A 1PYOA 3MTBA 4G5HA 3CO0S 3GAAA 4KXFB 4AY5A 4PYKA 1U5BB 1LDGA 1T3HA 2A0UA 2BM9A 3JD3A 1ZJYA 3D54D 3VAYA 1TILB 3OESA 3ASUA 5HOQA 1UMKA 1JHMA 2DULA 2J41A 1NIPA 2OXIA 5DLDA 4CF4A 5LNK1 2QMZA 3VDNB 3L43A 2QY6A 2CNWD 5TEVA 3SXUB 3FYUA 1IY2A 1PFKA 2KPOA 4OBXA 5AJUA 4GZLA 3PC4A 1I5OA 2CXHA 3T61A 3AL0C 2C59A 4D6XA 2F8LA 2GZMA 1IHUA 2QG9A 4IIJF 3VR6D 5DX0A 2FR1A 2A9OA 4KGDA 3I5AA 3M65A 3FVRA 2FUG6 3ZNNA 2IH2A 3EXIB 2WZCA 3TDMA 4NX2A 1RRPA 5AD1A 4U7DA 3Q9UA 1CBUA 3DONA 3MMXA 3T3GA 3JZFA 2QRNA 3GAZA 2J4DA 3MT8A 1MHTA 1IJEA 1WY7A 4DGHA 4C20A 1W48A 2B69A 4CCSA 2XXJA 4NQRA 3IIKA 2O7RA 4WESA 1L4MA 2ZDQA 1EVKA 4PYMA 2ZW9A 3E22B 1OD6A 4F8JA 3NWPA 3JQBC 1EP2B 2VLIA 4M9QA 5KVCA 5JXIA 4H59A 2XWQA 1T6NA 3KVYA 5ALZA 3WMEA 1W52X 3WDLA 1CDZA 2FQQA 4UUOA 4DWJA 4HMPA 4QXRA 5CK4A 1AQ6A 2JBAA 1V11A 1PNQA 1BDBA 4ARIA 1NXPA 2HPZA 1K3TA 3S29A 3ZY3A 1NU6A 3ONDA 1TT5A 4NMXB 1L5FA 1LFDB 4N0EA 2J5XA 3WK7A 3DDNA 5KNDD 5BSKA 3DZBA 4FQ7A 3P0JA 2QTGA 1V39A 4N3GA 1J1ZA 5AM3A 5CDHA 3TE6A 2NTEA 4ZCQA 4WY2A 3TEMA 3IPRA 4PG8A 3E6AA 2IH5A 2P67A 1B8VA 1NQXA 3IERA 3ONVA 3ACBA 3VU3A 2KSQA 2VDJA 3MILA 5FLKA 2HYIC 1G5HA 1ZZGA 4EB8A 2XGOA 3LVBA 3G2HA 3P9NA 3PXBA 1UJNA 2JFPA 2N75A 3HVUA 4M8IA 4MV1A 1EK0A 1Y6JA 2E89A 4PS0A 3DBLB 4FE7A 3RU9A 2WWHA 4LJ5A 2RHCA 1YJBA 2B3TA 2DC1A 3CJQA 1B00A 4OIMA 4EY4A 4EKYA 1JXOA 1ZVJA 4E15A 1CDDA 4HQRA 2P35A 2IQIA 3OETA 2VAPA 5ALQA 4U00A 3EW9A 4GNRA 2FWPA 1DWOA 1KI3A 1G1MA 4NKRA 4YFYA 1O4WA 5P21A 1U1EA 2Z57A 3A3OA 1Z0AA 4ENTA 4D8YA 2E4VA 3PC6A 1J2UA 4AX8A 5DI9A 3LBFA 4NV3A 5JJBA 1VJ5A 4W8GA 1UM9B 2IEIA 1E79A 3AETB 3CRNA 4MLDA 1KDZA 1HG0A 4B6OA 4Q3AA 2IOFK 1PX2A 1AJEA 1MGPA 3UPDA 1Q7CA 4A0SA 3KKKA 2JRCA 3Q72A 2P11A 1KJZA 1UR5A 2V5AA 3RC2A 1C8KA 4I4CA 1E9CA 1T5YA 2CXRA 3IYLW 5DSZA 7ABPA 2C2WA 1TD1A 3RTDA 2QUAA 1WBJB 4BDSA 2Q8NA 1XPOA 2HLNA 4X1IB 1AM4D 4BNXA 3WLPA 3ZWPA 2MCFA 2O07A 3SHVA 4JMLA 4U9HS 4P2BA 4L7QA 2GGSA 5E6SB 3KZCA 2J32A 3QVMA 4WY5A 4BVJA 2Y67A 4FMPA 1AKTA 3D2LA 3D4LA 1DQSA 4E88A 2XNCA 2BZSA 4QDJA 2DLDA 5FI3A 2V7EA 3V7UA 2XTAA 3C41J 1M6VA 4N5NA 4P3OA 1QRAA 1XQVA 5EJGA 1AMUA 2V7TA 4KVAA 2EAUA 1K4KA 3BM5A 3I83A 3RRYA 4ZOQI 3CRMA 1B8PA 4TKVB 3ZU5A 1IXZA 1U9ZA 1UCFA