2AS0A

Crystal structure of ph1915 (apc 5817): a hypothetical rna methyltransferase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
396
structure length
396
Chain Sequence
b'MARVVVDAQAARAIGKGAMIVFKKGVVRVEGDIKPGDIVEVYTRGGKFLGKGFANPNSNIMVRIVTKDKDVEINKDLFKRRIKKANEYRKKVLKYTNVYRMVYGEADYLPGLIVDRFNDIASLQISSAGMERFKLDVAEAIMEVEPGIETVFEKNTGRSRRREGLPEIERVLLGKEKYRTIIQEGRAKFIVDMRGQKTGFFLDQRENRLALEKWVQPGDRVLDVFTYTGGFAIHAAIAGADEVIGIDKSPRAIETAKENAKLNGVEDRMKFIVGSAFEEMEKLQKKGEKFDIVVLDPPAFVQHEKDLKAGLRAYFNVNFAGLNLVKDGGILVTCSCSQHVDLQMFKDMIIAAGAKAGKFLKMLEPYRTQAPDHPILMASKDTEYLKCLFLYVEDMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1915
publication title The crystal structure of a novel SAM-dependent methyltransferase PH1915 from Pyrococcus horikoshii.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 130
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase
A PF17785 PUA_3 PUA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2as0A01
3.30.750.80 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA RNA methyltransferase domain (HRMD) like 2as0A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2as0A03
4FT4A 2BM8A 4E32A 3OU7A 1FBNA 1RI2A 3M6WA 2YXDA 4E2YA 5CVVA 4LECA 3RODA 3UJ8A 3BXOA 4Z2YA 3BT7A 2ZLBA 4POOA 5LSAA 1SG9A 3HA5A 2C7OA 3PS9A 4GC5A 1T43A 4C04A 3G5LA 2YVLA 1KHHA 1NV9A 3C0KA 2FPOA 4OBWA 4FP9A 2UYQA 3IV6A 3AJDA 4X63A 2QE6A 3ID6C 3P71T 3B3FA 2AZTA 2FK7A 1B42A 5E1OA 1QYRA 5K0NA 3HCFA 3DULA 3LGAA 4XUCA 3SMQA 2IGTA 2GPYA 1ZGAA 3QV2A 4XCXA 1VBFA 2OXTA 2P40A 3H2BA 3LHDA 2ADMA 3G88A 3HEMA 4P7KA 3FPHA 4AX8A 3GGDA 3Q7EA 3TOSA 2PWYA 5HIJA 3DMFA 3JWIA 2NXNA 1JTEA 1NV8A 2P7IA 4OBXA 4RVHA 4X60A 5K0LA 2NXJA 5CIYA 5U4XA 2E5WA 4PCAA 4HH4A 1ZKDA 3Q87B 1L3CA 2Y1XA 2QM3A 3EVAA 1JQEA 5JUWA 5EIFA 4C03A 3GRVA 3UJ6A 3BZBA 4YV1A 3I9FA 2BR5A 2BH2A 3THSA 2G1PA 1DL5A 1BOOA 5IKMA 3A7DA 1YFLA 3HVIA 2IIPA 2ZW9A 4HTFB 3K6RA 2AOWA 3I58A 5IH3A 2B2CA 3B89A 3SSNA 3HNRA 5EMJA 2QY6A 4EKIA 2AOTA 3EVGA 5C9ZA 4OA5A 4E30A 2IP2A 5DT2A 2AR0A 2BR4A 5JR3A 1KPIA 2NYUA 5K0JA 3PVCA 1AV6A 3MB5A 3PB3A 4BP3A 3NWBA 3KQWA 5LR6A 2ZZMA 4KRGA 3KR0A 3ELUA 4RTJA 1X1BA 1KP9A 3A27A 3EVBA 1IQ8A 5DTMA 2ZCJA 5F2KA 3FYDA 4QTTB 3PFGA 2ERCA 2B9EA 2V74B 2ZSUA 1VL5A 2O06A 3B3JA 3ELWA 4PGHA 3PTAA 2YTZA 5CVJA 2VZ9A 1KXZA 2ZIGA 1Z3CA 2PLWA 1HNNA 3CJTA 5CM2Z 5H02A 4M38A 4DCGA 1XCJA 3TMAA 3QOXA 3SGLA 1QAOA 5DSXA 3E7PA 5DLYA 3VSEA 3P97A 4R6XA 5BW4A 1YF3A 4YV0A 2CX1A 2ONYA 3I5UA 4U7PB 3LBFA 4PYIA 3FYCA 1WY7A 3MAGA 3P2KA 3A7EA 2OB1A 4YMHA 2PXCA 1EAMA 5BXYA 1K8WA 4EMSA 2PV0A 3CCFA 3TQSA 1O9HA 3CC8A 2OYRA 4BLUA 5E1MA 5K01A 4PIPA 1R8XA 3GDHA 4IV8A 2PBFA 4LG1A 2IBSA 3EGVA 2BM9A 3IYLW 3NWEA 4E2XA 1SQFA 1ZQ9A 2FK8A 4MQ4A 5HIKA 5CD1A 3LSTA 5EMKA 2DULA 5D1HA 3C6MA 4QPPA 3KR1A 2PY6A 4KIFA 4R05A 4MHTA 3FZGA 1SUIA 3R0QA 3GWZA 4C05A 2G70A 1RJGA 4RSRA 5KVAA 5B1SA 5DM2A 4YUYA 4OQEA 2ESRA 4NECA 9MHTA 1IXKA 3HTXA 1NW5A 2WK1A 3RW9A 4ER7A 3PLAE 1IM8A 3OFJA 1M6EX 3ERCA 2XVMA 3G2OA 3HVKA 2CX0A 1I9GA 4BP1A 3KKZA 3MGGA 1SQWA 3G5TA 3P9KA 3DUWA 4U7TB 4FSXA 5K09A 3GCZA 5KS2A 2UYHA 3G8AA 2P7HA 1Q7HA 5GM2A 2YXEA 4H0NA 3G7UA 3KQVA 4Y2HA 3TRKA 2ONZA 2EG5A 4HRAA 2JG3A 3UAIA 2CMHA 1G6Q1 3E8SA 4P7JA 5D1NA 5DRYA 3KR2A 3SSOA 3EMBA 3C3YA 3TKYA 5C1IA 4E2ZA 3UJAA 2AOXA 1V39A 2J5TA 2Q41A 1G8SA 3KPYA 3G2PA 3HVJA 3D2LA 4QQKA 3T7SA 4R8RA 3ANXA 2NP6A 3FRHA 1BC5A 1R74A 1JR4A 1JG3A 2GH1A 2OBFA 2P3QA 3ORHA 3P2IA 5DRTA 3SM3A 4CXMA 4QPNA 2O0LA 4IV0A 3UA4A 2ZIEA 2KW5A 2XYVA 4PYKA 4AZTA 4YV2A 1MJFA 4FGZA 4KIGA 2ZULA 2I7CA 4AZVA 4RTPA 4GOLD 3LECA 5EG5A 3TR6A 5HZMA 4X61A 4PONA 3NW9A 3DOUA 3L8DA 1HMYA 3UFBA 5DM1A 2B3TA 3LDGA 5E9JA 1QANA 3BWCA 4RTNA 1WXXA 2OKCA 4PWYA 1UWVA 4OQDA 1EQAA 5DM4A 1Q0TA 3LDFA 1WG8A 3HCBA 4RTSA 2IH5A 1VQ1A 1U2ZA 3GNLA 3LDUA 1TW2A 1VPTA 5DTQA 5EHGA 3PX2A 5HIIA 1O9GA 4YUZA 4RTLA 1Q0SA 3FTEA 2AN3A 3HCCA 2ZTHA 1JG2A 3QOWA 3DH0A 1YUBA 2YUIA 3O31A 3O4FA 2FRXA 4IWNA 5HFJA 3THRA 1MHTA 4CWAA 2P1DA 4MTLA 2AOUB 5E1DA 3EMDA 1XDUA 5KQSA 3GO4A 3MHTA 2AN5A 2B25A 1XVAA 4RVGA 1J2BA 3FPGA 4FT2A 2AS0A 5E8RA 3JWGA 2ZZKA 3SX0A 2PJDA 2AVDA 2H11A 1QZZA 1ZL3A 1QAMA 5EVJA 3KQSA 2P8JA 3BKWA 3CJRA 3LL7A 2P38A 2AN4A 1TW3A 3CKKA 3R24A 3V8VA 5GIPE 2ZZNA 4PIMA 5CUQA 5EEGA 5CCXA 1EJ0A 1I4WA 4O29A 2DPMA 3G89A 7MHTA 4HSGA 3D79A 3MQ2A 3E23A 3FPFA 3G2QA 4QVKA 4RTOA 2O05A 3M4XA 1F3LA 2JHPA 3P9NA 3SR4A 1SKMA 3IHTA 1NE2A 1ZG3A 5T6BA 4K6MA 3U81A 5EMMA 3UWPA 1G8AA 4CKBA 3KR9A 4DZRA 3KQOA 2VDVE 1X19A 2UZ4A 1WZNA 2P3OA 5HEKA 3HA7A 3UJBA 5K05A 2IDKA 4QDJA 2O07A 3P8ZA 4DMGA 1JTFA 5KQRA 3SSMA 2HR1A 1RI5A 4DQ0A 2CMGA 2V7EA 5E2BA 3OZTA 4C06A 2XBMA 1XTPA 3OZSA 1AQIA 5EIWA 3UJCA 1JG4A 2PVCA 1R3FA 3M70A 3P2EA 5DM0A 5EZSA 1SVUA 5ICFA 4A6DA 2NXEA 2XYRA 3BKXA 3OPNA 2ZFUA 1N7IA 2YQZA 2PGXA 3FUUA 4QVGA 3VYWA 3FTCA 1NKVA 3NVKI 2ZVJA 5GOZA 3HA3A 5EC8A 2FHPA 3FRIA 2ZBPA 3FUXA 2NP7A 3KQYA 1L3IA 1G55A 1FJXA 4OX9Y 5CVEA 4GUAA 3NDIA 1ORHA 3FPEA 2FCAA 4GOND 4E31A 4ER3A 1L1EA 1R6AA 2IDJA 5FA5A 3JWHA 3F4KA 4PYJA 3AXSA 2HWKA 1G60A 1XJ5A 2JH9A 3NJRA 1JSZA 3LKZA 5EKUA 1IY9A 4C4AA 4BLVA 1VLMA 5T64A 4YUXA 2ZWVA 4QQNA 2P3LA 1R3EA 5EZQA 3KQPA 2Z6UA 1BHJA 4PYOA 1XDSA 5K0FA 4PINA 1AQJA 2EJTA 3GRZA 4RYLA 4XUEA 1NW3A 1P39A 2HNKA 4HGYA 1PJZA 2Z6QA 4DKJA 5E2AA 3HCAA 2P41A 3AWIA 3GXOA 3HCEA 2QRVB 3NDJA 4HTFA 5E9QA 1RJFA 5DTRA 3KPVA 1Y8CA 3FUTA 5P8WA 1KIAA 2N47A 2AB4A 5FQOA 2ORED 1ZGJA 2CKDA 3A4TA 4GQBA 3TLJA 3C3PA 4M37A 5EMLA 5GWXA 4X1OA 5DSTA 1YB2A 3KPWA 3HCDA 3BWMA 4FSDA 5CVDA 2F8LA 5C0OE 3DLIA 4EK9A 1JQ3A 4CTKA 2ZBRA 1I1NA 3HM2A 3MTEA 5CCBA 1NT2A 3R9XB 3FTDA 4BY9E 3DXXA 3FPJA 3CVOA 4R8SA 2GAFA 4WVLA 2AVNA 1R00A 4LWPA 2EJUA 2GLUA 3B7PA 4V0RA 4Y30A 5FWDA 3UZUA 3CBGA 3GRYA 5FA8A 5E1BA 2CWWA 2JHCA 4YMGA 4RVFA 5FULA 1EG2A 4DA4A 1KYWA 4BLWA 4EQZA 2G72A 2IFTA 3DXYA 5HILA 3LKDA 4PGGA 4IKPA 3KQQA 5FQNA 3EVEA 1NW8A 3EEOA 4V0QA 4FS8A 2VDUE 2WA2A 3EEYA 5GINE 3T7RA 3JWJA 2PX2A 4DF3A 4UOEA 4F85A 3ER9A 3ELYA 4XUDA 2YXLA 3MTIA 2B78A 2I9KA 2OY0A 5ICGA 1FPQA 3DMGA 1TPYA 4HG2A 4KDCA 5GM1A 4MIKA 2Q07A 3BWYA 3MERA 3DP7A 5LQAA 4GEKA 3SXJA 5EGSA 3GJYA 5BW5A 2HTEA 3VC1A 2P35A 3GRUA 3LCCA 2WA1A 4GOMD 5DXJA 5F2NA 4QTUB 2K4MA 5ICCA 3ELDA 1WXWA 2I6GA 4RV9A 5EPEA 4ER6A 5ICEA 5LQKA 2C7RA 1L9KA 3TM5A 1F38A 1RI3A 5DPMA 3TPZA 2AOTB 4PYMA 3BGDA 3LX6A 3UA3A 2NXCA 3OCJA 3KQMA 4RWZA 3RIEA 4YUVA 2R3SA 5FTWA 1KPGA 3P9CA 4CKCA 3FTFA 1EIZA 1FP2A 3K0BA 3KQTA 3OU2A 4PYQA 3R3HA 4R6WA 5CVUA 1KYZA 2OO3A 1YFJA 1YZ3A 3LCVB 4PCLA 5FCDA 3EVCA 3AXTA 3OFKA 3PX3A 3I64A 3REOA 2PWPA 2G71A 3KPJA 4GBED 5ERGB 4ER0A 2PXXA 3OE4A 5M5BA 1X1CA 4KVZA 4AZWA 1XXLA 3DXZA 4RTRA 4L7VA 3UJDA 2IH4A 1SUSA 3BGVA 3LCUA 3EGIA 4KDRA 2A14A 3PFHA 3P9IA 3OZRA 4DCMA 1M6YA 2FYTA 2PX4A 2PX5A 1VP3A 4E2WA 5LQCA 1VE3A 5HIMA 4CKEA 4MWZA 2IH2A 2NNWB 1XDZA 3FUVA 3NVMB 3B3GA 4HC4A 2LD4A 3DR5A 4E70A 4A6EA 3M6UA 3KPUA 4GF5A 2AOVA 3O7WA 4RTKA 4JXJA 1JQDA 3UBTA 2IBTA 3MCTA 1SGVA 2H1RA 1D2CA 3AY0A 4QDKA 2GB4A 4RX1A 3S68A 4ER5A 4P58A 4P7GA 3UJ9A 3BUSA 4PYLA 1VP9A 2IPXA 2GS9A 3M6XA 4FR0A 3SVZA 3TM4A 5K8VA 5KYGA 3EVDA 5DX0A 5LQJA 1PRYA 5DWQA 1ZS7A 1D2HA 5MHTA 1ZE1A 4X41A 3EVZA 2EX4A 5EOVA 1DUSA 5LQUA 2ZBQA 1O54A 3KU1A 1ORIA 5FHRA 2JHAA 1NW6A 1WS6A 5FUBA 5K0GA 5K03A 1KPHA 1N2XA 1ZE2A 4FZVA 2AOUA 5EQJB 2YX1A 2G8NA 3A26A 1X1DA 2H00A 4GC9A 2OB2A 4YUWA 5E9WA 3DTNA 4GOOD 5FHQA 2VDWA 1OR8A 4E33A 3TFWA 1L3BA 1JSXA 1R18A 3DMHA 1QAQA 5EEHA 5K0CA 3TKAA 1NW7A 4G56A 5LQRA 2J5VA 1XCLA 3LPMA 3VC2A 5GIOE 2JH8A 1ZHFA 1INLA 5LQNA 4M7RA 5K0EA 1P91A 3MCZA 3T0IA 4C07A 4RVDA 2ZWAA 3T7TA 5HOQA 3E05A 4RTQA 4Q1TA 5FWAA 1UIRA 2UYOA 3GU3A 3PT9A 3ER8A 2YR0A 3ME5A 5K0BA 1SQGA 2PT9A 3CGGA 2CL5A 2GA9A 2PXAA 3NTVA 2XVAA 3IEIA 2QYOA 5EKXA 1IT8A 5G02A 4CTJA 2UYCA 3I53A 2PT6A 4DM3A 4KWCA 8MHTA 2EFJA 1R8YA 5DX8A 1D2GA 4EVIA 2JJQA 3GIWA 5BP7A 2R6ZA 1RI1A 1M0EA 3G2MA 2PKWA 3BGIA 2ZIFA 5F2OA 3EVFA 1G38A 1T5YA 4HGZA 1NBIA 1P1BA 3UJ7A 1IT7A 2C7QA 1H1DA 1X1AA 3LBYA 1YZHA 4LWOA 5FADA 4RTMA 2Y1WA 3OU6A 3NMUF 3FUWA 2VS1A 3OE5A 5T67A 3WSTA 2PX8A 10MHA 1P1CA 1RJDA 1AF7A 3A25A 3BWBA 3X0DA 1RJEA 2BZGA 2I62A 3CJQA 3DLCA 3KHKA 4P7FA 1UFKA 3B5IA 2HV9A 4OA8A 3EPPA 3HP7A 3EGEA 1BKYA 1VIDA 4B17A 3G8BA 4F84A 2BR3A 2HMYB 2Z6AA 1EJ6A 5DXAA 2OPBA 1JG1A 4PYNA 1DCTA 3M33A 4ISCA 2O57A 4M36A 5DX1A 4C08A 3V97A 3GRRA 4KW7A 5GP1A 4ATNA 4PNEA 4EKGA 2C7PA 2QRVA 3C6KA 2PSSA 3R6TA 4ZTBA 1RI4A 2XYQA 4AUKA 3HVHA 5EHIA 1N7JA 3M6VA 1KR5A 4WXHA 5E8JA 4F86A 1NBHA 2VP3A 4AZSA 1FP1D 2OZVA
chains in the Genus database with same CATH superfamily
4C6SA 4MR7A 4ZAGA 3FPKA 3FHOA 3FIUA 1NNI1 3ZXSA 1ULSA 4Q7EA 3KDAA 2J8ZA 4YRQA 5DKFA 3THYB 4MW1A 5CK5A 2ODPA 2QMEA 1RWVA 4HDMB 5BYKA 5J3JA 2PT7A 1W5BA 3PPXA 4C22A 1T9ZA 4POOA 5LMNB 3KX2A 2II6A 1SPXA 1THNB 3INTA 3OE1A 2DOKA 4N82A 4L4XA 2I1WA 4GC5A 4F12A 1RQ2A 2LCFA 3I2FA 1FMCA 5HJ5A 2OBNA 3RSGA 3WLHA 3PC6A 1S4QA 1DZ3A 1PWXA 4CQMB 4QTPA 1II8B 5A4KA 3NGMA 3P71T 4EEZA 1D6JA 4JJGA 1B42A 4P9NA 4A0HA 4MWEA 3KSAC 1JGTA 3LGAA 4TXLA 4RXTA 1J5EB 2OXTA 1XTUA 1MC4A 4MNTA 2FDRA 4V3CA 1KMNA 3RTBA 3ZVKA 3OQOA 3VR6A 2CLLB 4JOBA 5FV7A 1KTIA 2YNMC 1PWEA 3IBSA 2ZE8A 3NGXA 4JIMA 4MLPA 4ND6A 3K70D 4CEIB 1DIHA 2DPXA 3EGDB 2NSDA 3HRKA 4JAVC 3TQOA 3LQKA 3WLIA 3I5XA 1YZVA 4QM6A 4JGGA 4HH4A 3M89A 2Y67A 1Z47A 2CL0X 3SQWA 1UJMA 1Y0BA 3ZHYA 2PJRA 5EIFA 1YSCA 2QUBA 4X90A 2FWNA 1MB3A 1MNQA 2H65A 4HZUA 4WK2B 1L4MA 1SU7A 3LY9A 1G64A 1YJCA 4ZGWA 5JYBA 4JWKA 4PWZA 2PSEA 4X66B 1DC3A 2GAAA 2XRFA 1QLWA 1FLAA 3LIIA 5EJ2A 2AB0A 1QO0A 4BQIA 2BGJA 4MAFA 4V0NA 4G41A 1BJKA 1G3RA 3N7AA 1IFXA 3EVGA 2FVYA 4QM7A 3J7AC 2PGAA 1Z0ZA 2Q0XA 2OD9A 2WQZA 2Z9CA 3K9CA 2B92A 2A0XA 2F2TA 3C87A 2VP5A 3IBFA 4JB8A 3ZDDA 3IUJA 2X7XA 5AQ1A 5AJXA 4MQ6A 2RMKA 3PNBA 3QV1A 3PZRA 4PEVA 1ODTC 1T25A 2AXQA 4ND1A 3QIVA 2XW6A 5AK5A 5CA0F 4IVRA 4DANA 1JHYA 3B3JA 3L7BA 3B20A 1QWSA 5DI3B 1XRNA 4ARZA 5IABA 1F48A 1IQPA 5C8YA 1C9NA 3T1OA 4MUAA 4IWXA 1QCCA 5HA5A 3WLTA 4DIKA 4OHVA 3T3NA 2I4NA 3GUVA 3OY2A 1LBHA 1YDHA 2EFCB 4RQAA 2Y6UA 1DIAA 1DEAA 4R6XA 5KWJA 4RK5A 2WY2D 1AVTA 2ILTA 2J9GA 3NS7A 3IOMA 3II6X 3W34A 1T4DA 2RI6A 1ECLA 4FB4A 3LW7A 1R4NA 1A8PA 4FDMA 3DZGA 4EBBA 3AFOA 2X5NA 2H2HA 1JEQA 4P0PB 2DHRA 4QXPA 5HJ7A 3IYLW 3P0IA 3F8TA 3JX9A 3NWEA 3PT5A 1B76A 4KJXA 3T9EA 3K0SA 3UANA 5HIKA 1RQ7A 4JBNA 3PXDA 1T0HB 1G8HA 2DULA 1PR2A 2H54A 3C6MA 4GNRA 3IKLA 3PKIA 4Q3EA 5B53A 2HNBA 5JH7B 4DABA 4YRDA 3Q3CA 3SKYA 4Z1OA 4UZSA 3C3BA 4NC9A 4AP9A 2E7ZA 3R75A 2DFLA 2VAMA 4D74A 1OFUA 1V25A 4JX9A 1UINA 2XPCA 2QSYA 1T5SA 3KKZA 2BP7A 4NE9A 2R8XA 2QLLA 3KFVA 4G8BA 3TLGA 1A5AB 4Q3OA 1YK1A 4YDRA 2C2KA 1P9RA 3G8AA 4HDOB 3RYHB 2HLNA 4BAGA 3G7UA 1ZCAA 2VP9A 3L7MA 3PD1A 4OQPA 5DK6A 3W7AA 4Q5IA 4ZQHA 5K3CA 2X9QA 3DMTA 1VLQA 1U2GC 2Q4TA 4OIMA 2V7VA 5F78A 4G5GA 4YQYA 2AL7A 4ZTZB 4AY3A 1SU4A 4QEZA 1X7WA 2J0SA 1KWKA 2HJHA 2Q41A 3ZDAA 3E5HA 3DMRA 3IJRA 5JSFA 2HRDA 4QQKA 3TG2A 5A6SB 3LQ1A 5LP1A 1TZ2A 2O5RA 2HIGA 4YRBA 3U4HA 4K8RB 1YR6A 2FA9A 3KT6A 1S8FA 5FUYA 2SECE 3PE4A 2PLAA 4QT0A 1UP4A 1UC5B 1MJFA 2FSGA 2P2DA 2XUHA 3LWQA 2Y66A 3L3BA 3AZQA 5EUBA 1YC2A 4AULA 1KOFA 1K6JA 2FUG1 1A77A 3K5HA 3NU1A 4GOLD 3I5AA 3DD1A 5AJYA 2YIMA 3UMJA 3VJLA 1IAVA 3AGPA 2FSVA 1DT5A 1NVDA 2C61A 4J3FA 1E5VA 2F00A 3VOAA 3PYMA 1DBWA 5ALQA 2WPDD 3LKVA 4PZPA 4OYYA 4EFNA 4EMBA 1YC5A 2IH5A 4H9GA 3H2IA 3MILA 4Z9YA 1CR0A 3GLFE 5LBUA 4U2CA 5P21A 3RFUA 3EQ6A 2HU5A 4D9BA 5KSOA 3R7SA 2EV9A 3C3MA 4GH5A 1LRKA 1QOPB 5D00A 4ALNA 4AN1A 2RB5A 4BMOB 4QSHA 1KY5A 5JS8A 2WF9A 3RYIA 2HSDA 1P62B 2IYNA 3A3KA 4P38A 3OA0A 3VU8A 4C20A 4URVR 2AT1A 2R0QC 4BNZA 4P0QB 5KC8A 3L0BA 4EJSB 5AKXA 5AVSA 1H66A 1C7QA 3L7AA 1RMTA 5IAGA 1KMIY 1MZVA 2Q9CA 4RVGA 2B7LA 2IYWA 4CV0A 3AGQA 2AS0A 2BCEA 1JAZA 3DNMA 5LP6F 5A4IS 3DQZA 1EUDB 1GTVA 1QIKA 2WJJA 5T4BA 3RSHA 1DRUA 3VJMA 4AY4A 2J1LA 3JQCA 3HO1A 1KJQA 2WUFA 4GZ3A 4D02A 3O3NB 4YPOA 3HN2A 7MDHA 2CLFB 3ACCA 4KUGA 3OAAA 1QCDA 2OYCA 3DDHA 3IQDB 2P9CA 4YJGA 4DXAA 4QOJA 3SQLA 1PJ3A 4FW9A 4WJZA 2XMPA 1W36B 1N3IA 1Z7WA 3T4XA 5SY9A 3L7OA 1J90A 5IULC 4KLCA 5G0UA 4DZRA 4AXBA 1X19A 1VRCA 3B7WA 1BU5A 3QI7A 1U7PA 4MULA 1G7CA 4UPVA 2O4CA 3G2JA 5K3AA 1MO2A 1UAGA 1JTFA 3FJYA 2ZRGA 3BD6A 5K4HA 3Q3JB 3O9VA 4M1EA 1EX9A 2JFPA 4LDQA 3RG2A 4NV3A 4CM9A 4OXNA 2RJ3A 2C4MA 1KS9A 2WYUA 3MBIA 3BKXA 4LRQA 2F67A 2PTHA 3VYWA 1OTXA 2PGXA 4DIUA 2OV2A 3GN1A 4ZWNA 5CBPA 1N6FA 3HA3A 1AO0A 2HQ1A 2W2TA 3KQYA 2KM1A 3O74A 4L0QA 3E1SA 4UAUA 1G55A 4M1WA 1Z07A 4EY4A 4RDIA 1YQ9A 2GXSA 4NMHA 2CUNA 3ZBQA 5BR4A 4RHFA 1D2MA 1PEYA 4REQA 1TMYA 2XWBF 1MOQA 1V8DA 3ULKA 1AV6A 1R7RA 1I32A 4P98A 3TB6A 1N6EA 2YNMA 4H60A 2TMYA 1RHJA 5HP4A 2GYVA 2O3SA 5KVCA 1AQJA 4Q3KA 1P8JA 1QGYA 3EQ9A 2UKDA 3ZE8A 2ZIXB 3LBNA 4DMLA 3CR8A 4AO6A 4N54A 3VKUA 1BMDA 1KVRA 1T26A 4TN1A 4NNPA 3NC0C 4W9RA 1FDIA 5D51S 2PUHA 3E5RA 4B5KA 4S2UA 3O1HB 3WC4A 3RSOA 1KIAA 2Q7DA 3E5MA 2EKPA 1FS5A 3C41J 4HDNA 4MJ3A 4WJKB 3WYBA 2VHUA 3UHFA 4LK3A 3E2MA 1RPZA 1PK9A 3IMCA 3KQLA 2RBEA 4E7OA 1GPDG 3QBEA 4WUTA 2P2SA 4FQ7A 5EJGA 1IOVA 1MNAA 3AHJA 2OYSA 2B1QA 1PI3A 3NHAA 3I01M 1J97A 3OMLA 1DBSA 4IZOA 4B7ZA 1GAEO 2QZ9A 1U3TA 2O23A 3QMPA 3Q40A 4Q1BA 1Q7RA 4Q18A 2XA2A 1ZYUA 3VPXA 1UDCA 2LKCA 4TTIA 3MMNA 4CMCA 3U9LA 3BJZA 4UQOA 5BR1A 5CFMA 1QHHA 1SGWA 2Q4BA 4H3SA 2ZUEA 3FSEA 1WB9A 1ZW1A 2IF2A 5DYNA 3O4VA 1W75A 4M9RA 1VB3A 4JNCA 1AH2A 2OBLA 3DJYA 4RVFA 4MPPA 3K9QO 1DAIA 5J9FA 2R86A 2IFTA 5G1PA 5DNEA 4PHFA 2QX6A 3LMKA 3FZYA 3OD1A 1NBOA 1ULHA 1NW8A 1X7YA 3IAXA 2WZQA 4FEGA 4CPDA 3F2IA 3HDYA 4IVNA 5H9VA 1B8VA 1QNLA 3UXEA 1BPLA 1E94E 3EBOA 3HB1A 4ZCTA 3ZNOA 3G5AA 1ZU5A 3KSDO 1RS0A 3K72B 4PTZA 5HJ2A 2ZRMA 2JH3A 5ICGA 4NEHB 1JJ7A 4L02A 5E4YA 1FBTA 4XW2A 4BWGA 5C7YA 2VPYA 3WWZA 1SZDA 1MRZA 3C98A 2C83A 1WBDA 4KHPB 3H0KA 4FOLA 3ECCA 2POCA 1D09A 3ZWOA 4Q3BA 4W5JA 3WB1A 4RKQA 4ZYUA 2I78A 4ZJPA 4N8EA 2ORIA 4KVAA 4P31A 1OFTA 3DO6A 1K88A 2YZMA 2YJGA 1L4KA 2NXCA 4IZHA 3PDIB 3D6HA 1D2EA 4PBSA 1ZL0A 4Y9UA 4MI1A 1P7VA 2DH5A 5FTWA 4CKCA 3R9XA 4D3DA 3ISVA 2XWSA 4EKIA 1Q1BA 3S2IA 4BUCA 1OLXA 1YZ3A 3D7MA 1CJCA 1F14A 2ZXFA 1CY2A 4NU8X 1NHWA 4RQUA 4EUKA 3MK31 1GFIA 2G71A 2RHTA 4FXPA 4N6GA 3PHCA 3K9WA 3SF0A 1FTQA 2WIFA 4IHJA 4O2BA 5ILQA 5JD6A 1U1DA 4YAWA 2VXYA 3BORA 1F5NA 2W11A 4O33A 3STYA 2RI1A 3LF1A 1ODJA 1U2GA 2PQMA 2PVPA 2X86A 4D96A 1SFRA 2JA1A 5C8YB 2Z6VA 2BFFA 5GGYA 2PGJA 1EAYA 2Y0PA 4UDXX 4FM9A 1EFKA 1SH7A 4YJ3F 2IXTA 5ALHA 1RCTE 4GWLA 4DV5B 3D02A 1D5CA 1HLPA 2RGDA 3B3GA 1U9CA 3CG0A 4GSYA 5C81A 5KYWA 2E87A 4BE7B 1MC5A 1Z26A 3IIMA 3KPUA 4HI0E 1R4NB 4IXWA 3LQRA 5AT1A 3VUEA 1ZBOA 3P7MA 1NUPA 3QX8A 5EIBC 4JUIA 3A32A 4HWSA 2PLRA 3KL4A 4JB0A 2RBKA 2D2IA 4FOOA 3WNVA 1PFYA 2DT5A 2IL1A 3OEYA 4Q3NA 4DJAA 4ENVA 1O94C 4DUGA 1SM4A 4WSOA 2XLBA 3KT3A 4AWBA 2P5YA 4OHWA 1UDXA 1Y4SA 4J2OA 4B34A 5BUQA 1XO1A 1RM4A 2IF0A 4HAYA 5EOVA 4RH0A 1DUSA 1XTKA 1JG7A 1Y63A 2ZBQA 1H4TA 2UYGA 3IPCA 1N5KA 3L46A 1M34E 1J9ZA 3PHHA 5EQJB 4HWOA 2RG7A 3PDUA 2G8NA 2C5HA 1C0LA 1YO6A 4CF6A 1YKSA 1U0TA 3KLPX 2BP7B 3GEMA 2HIMA 3TLGB 4A03A 1J00A 4YAIA 1PL7A 2AJ8A 1NLUA 3OA2A 4II7A 4UVHA 3A6PC 1AMUA 1V16A 1YA4A 2XR1A 4JJZA 5EJEA 5LQRA 3CURA 5H80A 3T5BA 4ENPA 4AJHA 3PJGA 1E6LA 1SVSA 4YWJA 4AJNA 2EX0A 3EZ7A 1WKCA 1ZDMA 1YIOA 2BHRA 3B6JA 3OSZA 4ZA2A 1HR0B 4QBIA 3UMBA 4DV1B 1L5QA 1X7WB 4GHWA 4Y2TA 2QL9A 3O0DA 2FF5A 5KB3A 2XGJA 4CBVA 4G5SA 4EFMA 3Q9NA 4UREA 2YR0A 3DTYA 2R6FA 4G1MB 1RD4A 1Y3HA 1FCFA 1L5YA 1O97C 1U0FA 2B99A 2IXGA 3JY6A 5AHOA 4RV5A 2ZSEA 4CF3A 3UXYA 4CI9A 4CTJA 2NPOA 4UQLA 1XYYA 2Y0CA 3MYYA 3OUTA 2B4YA 4HY3A 3UT0A 5IJ0A 1HT3A 3DW1X 4R7ZA 4ZK2A 4IS2A 2GCPA 2VCYA 1ZM7A 5GADl 3KXPA 4LY3A 4WOBA 4IDGA 3X44A 3AB8A 3OUZA 1IEWA 3KVOA 4FFMA 2Z57A 2PUBA 1RP1A 4U2KA 1QIMA 3IV9A 3VBEA 2QYHA 1NN3A 1QFZA 1U80A 1RM3A 2B3DA 2BGNA 4BMCA 5IKPA 5TLSA 3EISA 3KVRA 4BIIA 3WTCA 1K6EA 4JJ7A 3L7YA 2X9NA 1K7SN 3HY6A 4RQTA 2CE7A 3CLTD 3ILSA 1W49A 3FFWA 1NY6A 1HEUA 1VJTA 2P4HX 3BD9A 4FKZA 4H1TA 4P22A 1U0EA 4MO9A 2R7NA 1T6BY 3FYHA 2QG9A 1TEXA 3IUYA 4Q4AB 1CUCA 2ORWA 2J5RA 2ZE6A 4UZEA 4ZOLA 2DR0A 3W6UA 2IYEA 3RYIB 1ZN8A 1EFPB 1QQ6A 2BOVA 3FLEA 3K5PA 4NI5A 2Z5GA 5I48A 2IIBA 2NVBA 1V7QA 4IHQA 2ZB2A 1LSSA 2VN8A 2J6IA 3JWPA 3NTXA 3EOAI 4IUYA 1BO6A 3FR8A 4LE2A 1F6WA 3WNBA 2D1YA 2DU8A 3M33A 1NULA 2W98A 2OR3A 3N53A 4ISCA 1T8PA 4M36A 1Z6TA 1OF1A 2C4UA 1Y9AA 3VDNB 1MT0A 2E6UX 2QM0A 1XD9A 4OAQA 2AX4A 1OT5A 2PSSA 4RABA 1ADYA 4R31A 3HDVA 2PX0A 1LQ2A 4QAQA 1E63A 5BV8A 1QG4A 1ISRA 4WXHA 5E8JA 4Q48A 1BRMA 4W4TA 4WXPA 5FPYA 4LKRA 2VQFB 2VP3A 3H8SA 1D7AA 1QNFA 2OZVA 3Q7SA 2GNPA 4QDZA 4BNIA 4YJGB 2LKDA 4XX0B 4BX9A 4MP6A 4L72A 4NE2A 2ISQA 2XNKA 3IFSA 3ED1A 3PKZA 4TMWA 2A1UA 4WKOA 2BSAA 3BXOA 3O9MA 5JZVA 4XYEA 3M9WA 3SM9A 1NVWQ 1SG9A 1TT5A 1XZQA 2FAXA 2C7OA 1ZX1A 2XITA 1TUIA 2QS9A 4C04A 4KXFB 3OH8A 2EW1A 2FPOA 2GT1A 4ROSA 5EP3A 3BYZA 3HDQA 2RAPA 3KUKA 1H4VB 1PJRA 3NHLA 5AVWA 2Y77A 4XWAA 5CLFA 2HA7A 2H1IA 1CY1A 1VG9B 3ETEA 3KWJA 3L84A 4UASA 5CBPB 4JBXA 1N0IA 1PZFA 4IVQA 4RHCA 1USVA 5AICA 4AS2A 4XCXA 5CEFA 2H1OA 5H3CA 3K6SA 3HR4A 3PGKA 1S2IA 3S5JA 1Z0DA 2DLNA 5K0LA 1JDZA 5AYVA 1FP6A 1GSHA 3HJGA 4IF6A 3WWYA 3AETA 4ZAXA 4FCTA 4C21A 4MGZR 3A05A 3JR3A 1ADBA 3EVAA 2QM3A 2R6CA 3E8XA 3KKQA 1GILA 3GFSA 4A16A 2ZUTA 4AAYA 3SOZA 1DO2A 3QTTA 4CI0B 3ZQUA 4TVSA 3CXUA 4RPKA 1E2DA 2H4FA 1U3CA 4XLZA 4A0FA 4JI5B 3NG1A 4CFSA 5IJZA 3GJ8A 3P0HA 4RZUA 3WOVA 4MV6A 4RKFA 2HM7A 3E9RA 2QZJA 3TOXA 3V8NA 4TKLA 3QWFA 2ZBDA 2CFCA 2HF7A 3D6NB 1A88A 2NT4A 4OA5A 2EXXA 4NOLA 1C7JA 2FRVA 3H8VA 4HDNB 4N7JA 2GJ4A 1Z2AA 4H3KB 4ZT5A 1X86B 1P6XA 3EHEA 1R1DA 1XA0A 4BO0A 5JR3A 2XE7A 2ID4A 1LGYA 4GFDA 2L42A 1NDHA 2HCJB 4G8JA 4CU5A 4WACA 1RBYA 1BD4A 3GCXA 4EA7A 3CE6A 4X3OA 1BDMA 2ERCA 3GFQA 3UATA 4JKYA 1AS2A 5CNMA 1JJFA 2GAJA 2C3YA 1JJVA 1HSOA 2OO7A 2P0EA 3FPSA 2JGDB 3KKMA 5DHRA 3EXEA 3V4LA 1T5DX 1JT2A 3R7WA 2XGSA 3DDUA 4MW7A 3T34A 3QEAZ 1D1TA 1QHHB 1NXTA 3HLTA 3TMAA 4JR2A 1MU0A 1L5SA 5E4FA 1WOYA 1W5TA 3W1WA 1H2EA 1KK3A 2VJMA 4GT1A 5DLYA 1UMDA 2UXDB 2EWWA 1SBHA 4LF8B 3MGKA 1ZIXA 3N8DA 4U7PB 1P7WA 1XE3A 1QHXA 2D7JA 4D0NA 3EPKA 1X7YB 2ZAMA 4L0DA 3TQSA 1HO3A 4BLUA 4J0QA 1R8XA 2D06A 3GDHA 3QG1A 2MINA 1P75A 4TWZA 1DQPA 4G85A 1Q74A 3WVNA 4FIZA 4J03A 1RMYA 4A0GA 2CC2A 1SXGA 1T9DA 2ZUVA 3CWQA 3LSTA 3JAKB 3R5SA 4ZAVA 1Z74A 4PYRA 1C1HA 5FOWA 4GR9A 3WDLA 2AG1A 4V1CA 4K9NA 4M54A 3FZGA 4B3CA 4O4IA 4PZEA 5BW8A 1YCDA 1Q91A 4V03A 2XB2A 4YUYA 1NVKA 1O2DA 1O94A 1QV7A 2VTEA 4GX2A 4Q03A 3I9LA 4PO8A 1U1FA 2WK1A 2Z83A 3GH1A 2QAGC 4JQYA 1RHUA 2LE0A 3H2GA 2G76A 3OCVA 3SHQA 4F11A 1TK2A 4QUJA 5LKAA 3SFZA 2BWJA 3KE8A 1J5PA 1W5AA 4H15A 3T7JA 5K4GA 4IY1A 2GETA 2V4UA 4MB6A 5GM2A 3PQ6A 3WYFA 3SJUA 5A0TA 1JVNA 3ZJTA 1Q7TA 3ITEA 3I42A 5A3SA 2CLMB 1OLXB 1OYOA 3QPWA 5EQFA 1DV1A 4OJMX 1UBFA 5D1NA 5HUQA 3IT0A 2QD5A 2HMAA 4MCJA 4BZPA 4FK8A 3EH1A 4OHMA 4PLYA 2KX7A 3KPYA 4BO1A 4BV8A 4IHJB 4O2BB 2YV5A 1YBMA 1WEKA 2VKTA 4TRMA 4Y1EA 3RB8A 2ZRIA 4NVRA 2R87A 3QEMA 3THWB 2RGNC 4UD6A 2P3QA 5DRTA 1Y8RA 2GPJA 1V45E 4QBFA 4YAJA 1Z15A 5TQ0A 2BFFB 1P31A 3N2LA 3IV7A 3IUPA 1WUYA 1X87A 1OI7A 4JNKA 5E95A 4J43A 1PLKA 4X6LA 1GKKA 2C1ZA 2ET6A 4QZVA 5JTUA 3VYRB 1KKUA 2A4MA 1I0IA 2AMYA 1RBZA 2PKCA 3KWFA 4GPIB 3WK9A 5KYWB 2OSVA 2NO7A 4Y2QA 5EZYA 4MPDA 3HABA 2H07A 3QU5A 1BVRA 4EIWA 1HGXA 1DFGA 2HHCA 4RSMA 2BFMA 1EFRD 3KBOA 5JT1A 1UXGA 1P0IA 5EZ5A 3GT0A 3WGVA 4S1PA 2RH9B 3GNLA 3LDUA 5HK8A 4BVEA 3QW4B 4JFRA 5DHTA 1J4AA 3DL7A 2O2CA 1IN4A 3EIUA 3IIEA 3ANNA 1JG2A 1F0YA 3QOWA 3FB4A 2I4OA 4RE5A 4V2IA 1AMNA 4BKQA 3ZWDA 5IAEA 3RIXA 4R1NA 2XZDA 1ISFA 5AIBA 3ZW8A 1JPVA 3NAGA 1Z2PX 1FFSA 4H59A 1EA7A 1KGDA 5I7WA 1E3MA 1XV5A 5HR5A 1SG6A 3WG9A 1VKNA 4QREA 3PICA 4Z54A 5H8WA 1U99A 3GDOA 1HT0A 3RS0A 2W8BB 4JBHA 4WASA 3ZZUA 1V16B 1Y7TA 2AJTA 2HJ9A 4FYMA 3KQSA 1DPGA 1PZXA 5ERYA 4WY5A 4ZVRA 4Y7DA 4ITRC 1T8UA 5JHGB 1D3AA 3QHAA 4RIFA 3TD2A 1LZKA 2OQRA 3WAKA 2DEUA 1EJ0A 1I4WA 1M5TA 1BW9A 2H1WA 2PBZA 3EEIA 3EXHC 4NBKA 5DBGA 4RJ2A 5A9TA 2GHRA 1V41E 1WPRA 3T1YB 1JAHA 1M2HA 1UWKA 2JHPA 2NOAA 2XYGA 3A2NA 1HOTA 1IPFA 4UUMA 4FGUA 2QTMA 3N7UA 4EKEA 3KB6A 1GZHB 3EH7A 4CKBA 1G20A 2BGUA 2QN2A 3KR9A 1F4VA 4F4IA 3LDAA 4RE6A 1EGMB 4PQYA 1KMHA 3LLCA 5C1OA 2BJVA 1O0SA 1P17A 3KSRA 3PHIA 2O07A 2HUPA 2Z2XA 2WI8A 3IELA 4XQEA 3Q9LA 5F7XA 3WV4A 5IJ0B 4I81A 1R10A 2GJKA 2X9GA 3IVCA 2HVYA 2O5CA 2QRUA 3NT2A 4X97A 5C5CA 3ZDZB 3CBQA 4YCAA 2NV0A 3FTCA 4ZU3A 3H5WA 3LLSA 5EC8A 2NP7A 2PHZA 5ALKA 2FX2A 2R48A 2UAGA 2CDCA 3WIUA 1MUUA 3A36A 1B23P 2RJNA 4L4RA 4NLLA 4WLUA 3E82A 1FX0A 5TT1A 1FJXA 3EVNA 5IEJA 3L0IB 3VDQA 2RD2A 3I62A 3T7DA 1K6XA 3UB3A 5L4LA 3FNIA 2A5LA 4K2HA 2ZXUA 4M1OA 4ZOLB 2QM7A 4MUEA 1SQ6A 3QGMA 3C74A 3HYRA 3ANMA 3JQQA 5CYGA 4MVJP 3F98A 3I9JA 5IJXA 3HZHA 4A5SA 2QN9A 3EIQA 4QASA 3HFSA 2FB9A 3M6FA 3QQ5A 2H7CA 1TILB 1X8JA 2CD9A 5KDOA 2V4MA 1NJ2A 2Q4RA 2G4LA 2RIRA 4H7DA 5ESXA 3UICA 4E51A 2A1IA 3KPVA 3F7OA 2ZYVX 2O3JA 1Q6ZA 3O4RA 2W4MA 3JW8A 5CX4A 1XCBA 3AR4A 3Q41A 5MN5A 2FN9A 2JJ2D 2J0UA 2IYLD 2JFZA 4CIXA 4EVQA 2F8LA 2R79A 3ICCA 2RAVA 3MA0A 1ISHA 2AEEA 4RGBA 4KOEC 3SS9X 5HBGA 5BMOA 3JU3A 4I36A 1SVIA 3IB6A 4KL8S 4WH0A 3W3AA 1TT5B 1MXFA 1VKZA 3QU4A 4YS6A 3ZK7A 3A3YA 2ZI9A 1KRXA 1U7TA 1W4AA 1S9HA 4F2HA 3B6ZA 1R00A 4KIJA 1FVOA 2FOLA 3B6IA 3I6IA 1K2VN 3WICA 7ABPA 3QX7A 4DARA 4OYHA 1AK2A 1ZWKA 3N9IA 5H59A 3EFEA 1YQXA 3TLKA 3VDRA 4A0SA 4B80A 4D0RA 1T2UA 2RE8A 3AUFA 1D0VA 3NRBA 4RCVA 4UUAA 3NEYA 1KY3A 5JTTA 1WQ3A 5CITA 1DCMA 1G8FA 4PGGA 2EZTA 5GJBA 2LIVA 5LJIA 1DJQA 3SS8A 2X1MA 1Y33E 5A1JA 3T3PB 2CJWA 1PTJC 2QM8A 3PQ5A 5TJHA 3V46A 3EEOA 1N2CE 2YUTA 1MVOA 2FSFA 4KYTA 4D4MA 3WXBA 3JQFC 1N6HA 1BDJA 1P9WA 1ISIA 3P19A 3IH8A 1QM5A 2ROQA 2Z8YA 4KK3A 5L40A 1MMFB 1DS6A 1W1WA 3AETB 3QYPA 4S0ZA 3E9CA 3GAFA 3OX2A 3W4IA 1MO6A 4KWTA 2DQZA 3CNBA 4NBWA 1KARA 1Z62A 2L0XA 1E9EA 4V0SA 3I3OA 5EYPA 5KNBA 3CX6A 3MWFA 4J7UA 1LFDB 5K4AA 221PA 1VG0B 5ARDA 1LQTA 1DBVO 1ZK3A 2DP4E 1C4XA 2GF0A 4GG1A 2IWHA 4KQ1A 4ZCMA 4PXSA 4CTOA 1MGPA 3A1FA 3OCYA 3W3ZB 4DPMA 4C6RA 5BWNA 1TQ2A 1Z29A 1AHNA 1VKOA 2H0RA 2WP8J 1AUVA 1Q2XA 3A6FA 2G88A 2IOQA 1S2MA 4M88A 5EPEA 4R9SA 2DB3A 1L9KA 1F5SA 1JSRA 1T3LA 4H35A 2FLVA 4R3UC 2GYWA 4H0FA 5THQA 1BKSB 2EP5A 2FOIA 2X15A 3PRYA 4UHJA 2QAGA 1HQCA 4C78A 4LBVA 4CJXA 2R7LA 1S3FA 4TTAA 5CX1A 3HKBA 3JYHA 4RDXA 1B3BA 1LSUA 1T1EA 2ZRFA 4NFSA 3RYCA 2CVPA 3BVPA 3OFKA 3ND8A 5I9SA 4IDOA 2R1VB 4M0MA 2HO4A 3KHSA 1W0JA 3VSDA 1A5SB 5JOQA 5K5EA 1Z2OX 5KNDD 3BG5A 5KVSA 2QA5A 3I2YX 1HDEA 2IH4A 4XQCA 3R7WB 1AX9A 1MENA 4E14A 2Y8EA 1CS0A 4NV0A 2VJMB 2YDXA 2KBEA 1UMDB 2IH2A 3FUVA 4D5GA 2YZ2A 2RGNA 4HDSB 3LP5A 2I33A 3AL2A 1EVIA 1H1TA 4OQMA 2RGGA 5TGZA 5BWBA 3AKZA 4WEQA 2AOVA 2DXIA 1CUEA 5CIWA 3IR6A 4TV9A 4QDKA 3AY0A 3L9WA 4BC1A 1KA9H 4Z49A 2BFOA 5HRUA 1NVMB 2MINB 2PS9A 3CPJB 5B30A 1NRIA 1SEPA 1GGKA 3E27A 6PFKA 1JFLA 2GHTA 5DX0A 4BVAA 2ACWA 4JV5B 2CYCA 1H2YA 1AKEA 5DULA 4BN4A 1FC6A 1T0PA 2H8KA 2WMNB 3PTLA 1VSBA 4HOYA 4UBLA 5BT9A 4BVLA 1XKQA 4K9RA 2AQ8A 2ZP1A 1ZIYA 1HFEL 2QTBA 1JA9A 3NDPA 3EGWA 4RIEA 4FZVA 1CW2B 4GE3A 4U9IS 4DGFA 3P5SA 4P4GA 421PA 1WUHS 1JQLB 4KXLA 3HB9A 5JD3A 3VPBA 2IEAA 1ESDA 1ES9A 1IIBA 4HNGA 4A7PA 1P77A 1QZUA 3DOOA 1JSXA 1NF3A 3DMHA 4HZIA 1J25A 4GUDA 4J4HA 3FTNA 4ZDKA 4OLAA 2ZSKA 3W05A 4R84A 2NPIA 3H1EA 1J2UA 2P0YA 3IJPA 1HDCA 2ZWAA 4C0QC 1Y1PA 3OEHD 5FUVA 1H4XA 4IQ8A 1A5ZA 2AQHA 2B7BA 2NTJA 2WJGA 3FMIA 4HVLA 1PJAA 2WNSA 3GU3A 3ER8A 4ZK6A 3QEMB 1RZVA 3IAS1 3EXHA 1Y8RB 5TQ0B 2PU7A 2DCMA 3MJCA 1VCHA 2RAFA 4WKBA 2C0PA 2UYCA 3LLUA 2V7QA 4CHGA 1I5EA 2WVJA 4NPHA 1T9HA 2EFJA 1UBNA 2W2XA 3PNYA 2W2OA 1I36A 3S2UA 4RZSA 3TQFA 1ZKMA 3MUOA 4G37A 2H51A 1CUAA 1UPBA 2W2MA 4LYGA 4PPFA 2DUWA 1RR6A 2FPLA 2OQIA 2ZGVA 3CB4A 4L8LA 2N75A 5EZYB 1SWVA 1UMKA 1G38A 2R5NA 1AUZA 2ZYRA 2RCYA 2P27A 3HGTA 3O1JC 5BSTA 5AVTA 5JQGF 4L8FA 4NZYA 3AX6A 1EUCA 1ZZGA 1XWFA 2XT0A 1FCJA 4FI3F 4GGPA 4LOIA 4TRNA 5F5XA 2IQIA 4RELA 2NU9A 3FUWA 3U1TA 1BXRA 3OE5A 4ANFA 4KQCA 1E6WA 4NX2A 3HJFA 1XWIA 4QLBA 2WJHA 2LCIA 2PIAA 3Q7PA 4KQFA 4HH3C 1KE1A 4RJTA 4FLFA 1PR5A 1R9JA 2FDXA 3DDCA 2W6MA 1BKYA 4NZOA 4B17A 5E6RA 4GLJA 1S5PA 1G21E 1UKZA 1D1QA 1I1HA 3BXXA 1S2NA 4MKIA 4PO9A 5FOUA 3SI7A 3TAXA 2GBLC 4M9ZA 3VVBA 5G4LA 2QUZA 4IUBS 4KFUA 3TVDA 3UPTA 2PQ2A 3N5KA 1FUEA 2OTCA 4UBJA 2GASA 2Z9BA 5GP1A 1FNBA 4GI3A 3GLHE 3SZOA 4IZIA 2DFPA 3AI2A 3R6TA 2YWGA 2FW8A 3UN1A 2Z2IA 4G9EA 4RD3A 3DEZA 3D7NA 5B2FA 1XRLA 3UAOA 4DDMA 4TUYA 1GUYA 1GCAA 1BW9B 1M5UA 3E6AA 3GEIA 4AZSA 4RH3A 2BUBA 4UHDA 2P9JA 5D3MB 4EP1A 3B3AA 4C1BA 1M1YA 5LQDA 1P4RA 3G7NA 4PNZA 2P11A 3MCAA 3VI3B 2YS7A 4EW6A 4L50A 4MR9A 2YXDA 1JEOA 3OTQA 1WF6A 1G20B 3TIGA 4CKBB 5FBVB 2PUCA 4WHMA 1OFUX 3EN0A 2GJAA 1UFVA 1KMHB 2M2IA 2C7VA 1QIIA 4FYKA 3VFDA 1ZRSA 4R9UC 1N3YA 1T43A 4QU0A 5JXGA 3PG5A 1Y4AE 4EG1A 1IUKA 1SHTX 4KWEA 3ICWA 1J2YA 1ZXXA 1ZGZA 1E89A 3DEKA 4KMSA 4DGHA 2RSLA 3TBKA 1Q20A 2WHYA 1KIMA 3FGOA 2V7XA 3K7EA 3MLAA 3B3FA 3H99A 2GN8A 2PD3A 3ADPA 5CDFA 1RXYA 2GOYA 2R62A 4YHBA 1P44A 1AGRA 1VE9A 2X2OA 3F5SA 1YXMA 4LQCA 5J40A 4GM1A 4KU4A 1BYIA 2GPYA 2ZTMA 1EK5A 1KU6A 3MJTA 4B7CA 1D4OA 3Q3HA 4H1VA 2XE6A 1SQ5A 3GP5A 4OM8A 1FX0B 2P9ZA 2IUSA 4ZCQA 4ZREA 3H6GA 4EBFA 2NZVG 3PJFA 1F6BA 4OBXA 1RWBA 2QTVA 2Q99A 5U4XA 4M0EA 4OHPA 3U3XA 2O7RA 1NATA 5WRFA 1PTJA 1ZKDA 4I4CA 3BFXA 3L43A 3LWPA 1JFVA 5GJVC 2IZ1A 3L6RA 5JUWA 2PCLA 3NONA 3IUQA 4P84A 5EE1A 1OI2A 1PWHA 2HMSA 2QRMA 2ZRQA 3FLAA 1WXDA 3JQFA 4IYJA 1SZJG 3DFMA 3FSGA 1GYRA 3QJGA 4O08A 4OY3A 5IXSA 4LYAA 1R4AA 5ICSA 4CIBA 2C84A 3NH6A 4X00A 4B0PA 1X6VA 2JCVA 2P65A 4G0OA 5BT8A 1SC1A 4EI7A 4MKZA 1IJBA 3I58A 4RCYA 1G5FA 1Q3TA 4PSUA 1TKBA 2GD1O 3BIJA 4NBRA 1E3LA 2VXBA 5E6SA 2YWBA 1AN9A 2GZAA 3MPUA 1OIXA 5BN4B 2VOJA 4E15A 2RB4A 1XYVA 2J0UB 1XDBA 2VHEA 2ZYDA 1IK6A 5K0JA 4FGJA 4JXZA 1VHQA 2VLBA 3EBLA 2OXFA 5KQPA 2G63A 2R2GA 4UEKA 4KRGA 4PS1A 3NVDA 5DNVA 2HDHA 3AEUA 1SG0A 2Y76A 2XDQA 3RTDA 1VJ0A 4E5PA 3M81A 4KGDA 1FU8A 1PZMA 1RNLA 1Z8HA 4GPEA 4UOZA 1A7JA 5IF3A 4DRZA 3K4PA 4KXUA 3GI1A 4XKJA 3RUDA 2YBEA 4M38A 4MVYA 2FH5B 2AKYA 2PZMA 4QBKA 4J1NA 4QOGA 3LOUA 3RSQA 1X1TA 3SZRA 1AXRA 3VHXA 4DJFC 3PBKA 3VSEA 1Y4ZA 3O95A 4HCJA 5IDWA 1H42A 4BLSA 3MWYW 1A8SA 1BMQA 2CNDA 3GZ4A 4HAUA 3I5UA 4J0CA 4YQEA 4W1SA 5E6UA 2OPHA 4DSOA 1PW7A 4ZGGA 3P2KA 4ESEA 1ZM3A 1X9GA 2PXCA 2CJWB 1CLEA 4P82A 3ZGNA 5AUQA 3UTDA 3O8DA 2QU8A 4IV8A 2QE7D 3HJAA 1BHSA 1WTAA 1NQTA 3G0OA 3KRTA 2Q1WA 3OQVA 2GXUA 1SQFA 4MQ4A 3X2FA 1DC5A 4E2XA 5CD1A 4DBLE 1FPMA 1RYZA 2JI9A 4BVBA 3HSYA 2X8AA 2HBRA 2AJDA 2PY6A 3M5DA 4JDPA 4LRYA 4KQXA 3PCRB 5L51A 3CNHA 1OFIA 1XLWA 3BEOA 4NOJA 4RSRA 3R9KA 3D6AA 2BSQA 1YMUA 2HKIA 2ESRA 2J85A 1WIWA 1XA4A 4M3NA 1Q1QA 2G0NA 1RIFA 1EEHA 3ZU3A 1Z2NX 4UD2A 4ER7A 2XVMA 3B85A 4MO2A 5C5IA 3LUCA 2RHHA 4KQJA 1UZAA 3G5TA 1JDTA 2O7SA 2ZYTX 3NXKA 3P9KA 2WD9A 4Q01A 5C35A 4FSXA 4WNIA 1BJTA 1G1AA 1M7GA 2QAGB 3OZIA 4FIDA 1HLDA 2M6KA 3DZIA 3LX5A 3VSBA 5B6JA 3DT9A 4W5NA 2IIVA 2W0MA 1UK9A 1GLGA 3S1AA 3UMRA 3HKBB 3BB1A 4P7JA 3WGQA 1I0LA 2QVCA 3RYCB 1XQYA 3LXXA 1I24A 4EEKA 1RABA 2G9QA 3MTQA 3NM5A 3UJAA 1B14A 2BYTA 2PZFA 1GPYA 1G8SA 3LVFO 4GPAA 1L5KA 2C8VA 1ZPDA 2JK1A 3STXA 4E2FA 4Z51A 1HG1A 4EGJA 3GDFA 2NUAA 3ANXA 1APBA 2NP6A 1R74A 3NUQA 1JU9A 2LWIA 3P2IA 1E5LA 1GPAA 2NO9A 3VNBA 4EA9A 1KFBB 1MG5A 1TUEA 1TKAA 4IKEA 1CS0B 4QPNA 3UHJA 4M49A 1GVHA 4MRNA 2XYVA 1XTQA 3NEPX 4G1EB 2YCLA 4WLVA 5JEEA 1GO2A 1OROA 3IUEA 4MUXA 4C0XA 2UVDA 4FJ0A 2FWAA 3CH6A 3GBPA 1OLOA 4X61A 1JKJA 3DOUA 3WIOA 3DHYA 4KQ9A 3CZPA 2WB4A 2IGBA 3TFQA 1Z4PX 3GEDA 4JJKA 2R8PA 3BWCA 4N18A 4AECA 3GEHA 1URPA 2HPZA 4TZ6A 5INTA 1CPYA 1CJUC 1ADJA 1YR7A 1QG0A 1DJMA 1E3JA 3LDFA 3QXHA 3I30X 4QYTA 4ZC1A 4WCDA 1ZSYA 2C82A 1IBCA 3ZY5A 1GQSA 4FFSA 4JEHA 1EVJA 5I9IA 1UBSB 1IHYA 2N9UA 4TKZA 1G0NA 1U9YA 1BCRA 1R37A 3HVUA 2ZRCA 5FTKA 4ZZ1A 1U9IC 1HURA 4MGIR 5DVZA 5AKJA 1Z7YA 2VNKA 1ICEA 1QGUA 4PHHA 4JUBA 5KQSA 3L8HA 3VZCA 5AUNB 4RL4A 4A91A 4LDAA 3DXFA 2DX7A 2QLMA 2ZZKA 5LIPA 5G53C 4I19A 1XAJA 4YAFA 1QAMA 5KREA 3W8EA 4OI2A 1FFGA 1OX4A 2GBLA 3W06A 4O29A 2WHQA 5HGJA 4EY3A 4XIJA 4DJ5X 5BW5A 1V2HE 3LUHA 4BMXA 2XDWA 3F3KA 1DQRA 2A5GA 2JLWA 3JQAA 3Q88A 5IKXA 2ZYHA 3SE7A 3CWZA 1TEVA 1C9YA 2X0IA 3OEEA 3KXLA 2VJQA 1R0CA 1WZNA 3G9UA 4EA8A 1OH6A 4DC1A 2XCOA 4MVWA 1P18A 5ECYA 4F60A 3V4FA 3TMKA 2NTVA 1J22A 4ZXPA 2XBMA 3AKEA 1YZQA 1AQIA 2AI3A 3P0FA 3DBLA 4RS3A 4JR0A 3P1JA 1F6DA 3TRFA 1CUUA 1R0SA 1CX9B 1GL9B 2WM8A 1ONOA 2GCOA 1OILA 3AF5A 1H5UA 1W7AA 2CEKA 1EUCB 2B8WA 1XKXA 3HKCA 4MQEA 1J49A 1IBRA 1RSZA 2FGJA 2YFKA 5DYYA 4LHEA 4WADA 2NU9B 3BFVA 1BXRB 5EESA 5C52B 1HEIA 2B2XA 2VF2A 3B82A 3WJ2A 4LPKA 3F90A 1XMOB 3ITNA 4N3GA 3E3AA 3MAJA 1NXQA 2FW1A 3KE9A 4KP7A 3WR5A 2F3SA 1HA3A 2DVMA 3FYUC 1POWA 4HNQA 4PYOA 1JHAA 1LCIA 4L8WB 5C3MA 4MQUA 7YASA 3PI7A 1PZHA 3QVJA 3RADC 1KVTA 3GMSA 3LM8A 3PITA 4NU0A 3I61A 1GDTA 3CUVA 1V9SA 1P1RA 3H9JA 3QI2A 4NJOA 3EYWA 3GDWA 5DTRA 2H4JA 2QYSA 4KFRA 3ZLVA 3KD2A 3UMYA 4CNBA 4UXJA 2NZJA 3GCGA 1ESEA 2YH2A 1LI4A 1ZSVA 4G4SO 1Q1ZA 2VDNB 4HX5A 4KK4A 3OZBA 1K8QA 2GCEA 3UUGA 1F9AA 1M1YB 1OW3B 1ISGA 3DF9A 4H1UA 5C0OE 5A4FS 4L9RA 1HT2E 4MR9B 3ROGA 4JR1A 4KBYA 2NX2A 1G6KA 4OP1A 2BD0A 2GO1A 4A5OA 3AIIA 1FX1A 2A9PA 1KI8A 1TZBA 1JUDA 3J7TA 5EE3A 4A2CA 4BY9E 4MZXA 4FE3A 3MWLA 1ESZA 2Q5OA 4RHXA 4LVOA 1K7YA 4GYWA 4D3YA 1GV0A 2OZPA 2GLUA 3GFRA 4D6PA 2F7SA 1OZAA 2XSZA 3FXAA 3WQSB 3RARA 3DO8A 4R1TA 4K6CA 1YZNA 4TTJA 4KO8A 1ZR2A 1WVIA 2JIRA 2WSLA 4HLUC 2ENUA 3DF7A 4CIWA 3HCOA 5JAIA 3Q85A 4J1TC 4QOFA 1E2EA 1VBKA 3ZE2B 2AUSA 2E1RA 4HPXB 1JLHA 3A1EA 1AKUA 1D07A 3D8RA 4V0QA 4DW8A 1JQKA 2BEKA 2FEXA 2VDUE 3OICA 2C4WA 5CFRA 4UW9A 3FWPA 1UH5A 2VUSA 1FEZA 4UEJA 2QTVB 2PX2A 1QVZA 2GK4A 1BHO1 4Z86A 4JLJA 1BCSB 4LJ9A 4F85A 1IZ8A 2F6RA 2D6FA 1O08A 1U2TA 2G25A 3UCEA 1U0RA 1FPQA 5AP9A 2HJSA 3L7DA 4H7KA 5JMPA 3UQYS 3F6BX 3K0EA 3ZU4A 4YAEA 4E5DA 4MICA 5HKKD 5A3RA 4URFA 4II3A 1OAAA 4NONA 3WMEA 1JJBA 1ADCA 1JR3A 2JLUA 5DLEA 1YH3A 2K4MA 4L5IA 1WXWA 4P4UA 2KLNA 1GZ6A 3N7TA 4L4ZA 4M0PA 4RADA 3AHDA 4K9QA 4JODA 1BTOA 2AFVA 2I3BA 5E6SB 2GERA 5FTMA 2V7WA 5LOVB 1ZIPA 4QXMA 2DQ4A 1MTZA 5JJBA 4XAQA 1SUFA 3HN6A 2DSTA 3OU2A 3BX1A 1KR2A 2IXEA 2QVLA 3UYLA 3ODPA 2O1EA 3WFIA 5J4KA 4M1YA 4B3SB 5JW6A 2JRLA 1CZUA 3R9IA 1TQDA 3AEUB 1NTRA 3USCS 4H08A 1AHHA 3HBNA 3FDXA 2FQYA 4R0MA 3A6LA 5FBLB 4BFVA 1PZNA 3W9SA 1YE3A 2WG2A 3SQNA 2NU7A 5LIRA 4EHAA 1K3UB 1QBKC 3L8CA 3VHXB 3G1WA 2G17A 5HIMA 2XF2A 4UPEA 3TNJA 3OZAA 4ZYTA 1BEZA 5E6UB 3AH8A 1JWBB 1KORA 1QIGA 2QJWA 2VBGA 2ZYWX 1LFAA 3O3CA 4J4TA 3C6ZA 2WU4A 2RDMA 4JXJA 4P4TA 3RVDA 3TBHA 4GI1A 4RX1A 4ACBA 4CHTA 5ADWA 2GB4A 1CKEA 2O2IA 2PZKA 1CG6A 3MLBA 4JXKA 2VHJA 4TLDA 2Q1TA 2BELA 1SY7A 2QTNA 4FFBA 4WE3A 3PSAA 2E5LB 1YE8A 1VL8A 3KTAB 4XYBA 4YJ2A 4DIOA 1Q15A 1VHDA 2VWGA 4X41A 3UGJA 1ZVMA 2WYOA 3N8HA 2JIDA 3FYSA 3F7TA 1TLTA 2B1JA 4D79A 3HO6A 5D5HA 1ZN9A 4PGAA 4DXHA 4FR5A 4P33A 4ZOAA 2E82A 1TO6A 1TM7E 2WFMA 3AUTA 3OPMA 1H2FA 2OB2A 4D0LB 5E9WA 3IE0A 1R5JA 1U9IA 2VDWA 1H8EA 1C8KA 2PUDA 1TVEA 3SIXA 1N8SA 4LYEA 5D8DA 2YYSA 1L2TA 5KOHA 3DMYA 1NXWA 1XCLA 1NBME 3U0BA 3L0PA 1N1GA 1VJRA 1XG5A 3AVQA 4MCHA 3GVPA 1P33A 3S1AB 2C95A 4KMRA 3D2CA 4G0MA 2YN2A 4Q1TA 1T6XA 5JIBA 4UHHA 4C0HA 4BTLA 2NUAB 3DBRB 4R16A 4GM0A 4DEYA 2WWIA 1SQGA 3Q1LA 3FB1A 1QR2A 2FJ0A 3UW1A 4PNHA 1H94A 3N2NA 3RBXA 4I6GA 3ADCA 2AXEA 4TXHA 1IT8A 1DQZA 2C99A 1M1UA 3JALA 4OQQA 4DA8A 4ZARA 3S29A 1SIOA 4O5AA 3WRVA 3H5NA 1EXVA 2BGMA 4AIIA 1WU7A 3GIWA 3KFLA 4EFDA 2R6ZA 4JI2B 1CYEA 2FP3A 2OV1A 2LTAA 4KIUA 1JKJB 5E2IA 3EVFA 2WIAA 3LQ4A 4CG2A 3IERA 4B2PA 4EYQA 1IHPA 2AZMA 2C54A 4OHUA 3I0NA 1XPRA 3ZD9A 1YGYA 2JDID 2OV8A 4L78A 5EUWA 2I8CA 3F6EX 3H17A 1NAHA 1J23A 5EIAA 1CUBA 3OIDA 3PUJA 1K89A 4C4PA 1GVNB 3EF1A 4TYNA 2O8CA 3TTYA 1K5DA 1R5BA 2G08A 3QA3E 4KV7A 3RSCA 2FGKA 2AH5A 4TSFA 2BZGA 2F59A 1Q7CA 2BKVA 1T4BA 3NI2A 1KQGA 4XJSA 2A0KA 4AJIA 5FORA 4BECA 3RRJA 4V0ME 4DR5B 1EXNA 3RI3A 1DZIA 2V0GA 3ZLTA 4JT4A 4D97A 3PNKA 5DYTA 3A9TA 2AMJA 5DBEX 5IEBA 4ATNA 4TTTS 4URHA 3T41A 4BN5A 2AEFA 3A9VA 3ZW7A 4BTVA 1G59A 4NCAA 3C6KA 3BJEA 3FYUA 3HCRA 4CFZA 2FEWB 1MP0A 3FYTA 4KODA 1OX4B 2VDPB 5AOBA 1JG6A 3ROXA 1W88A 3UJ3X 2ZRDA 5IXJA 4CUKA 4IO1A 1NBHA 4RANA 3NFRA 1H0SA 3O75A 1ZMBA 3GZNA 3MMPA 2DWQA 3HSKA 1M76A 4E32A 1L9XA 1NM5C 1CQZA 7REQA 1FBNA 3I37X 4KWIA 2JFBA 3IIIA 3CISA 4K81B 3AINA 3UJ8A 2ID9A 3C3EA 1A1VA 3UJHA 3CXRA 2ZLBA 5CM9C 3PFWO 4ARAA 5KWSA 2BLLA 3VC3A 1EDOA 2QXUA 1UMCA 2EARA 3DOFA 1IHUA 1UOPA 4DLBA 4I5DA 4NJMA 1YASA 4LJ6A 3E3LA 3COVA 3JWEA 4WWHA 3H5IA 2GD6A 4XVRA 4KRFA 1PAUA 3PJDA 3I72A 4FHEA 4K9MA 2WKPA 3SC3A 1EB8A 1MB9A 5TARA 4FYJA 1X0VA 4J4BA 3L93A 721PA 4WXMA 1AGNA 3SMQA 5FWYA 3IB3A 1QHIA 3NXSA 2EBHX 3HKCB 4KBGA 1HL7A 4MQEB 3T9BA 2EQAA 1ZRHA 4GBMA 2FUG6 3REFA 2J4FA 3K53A 4MPJA 2VTVA 1W2GA 1DARA 2XCQA 3Q7RA 3M5CA 1BUZA 1CB0A 4HLUA 3VYSB 3ZCVA 2FKAA 3JWIA 4PNPA 1JTEA 5J5AA 4X60A 4LTNA 4M1QA 1H6BA 3TQQA 2NXJA 1K75A 4J1TA 5JV5A 1DRVA 2Y9PB 1HZZC 2X3FA 1T3HA 3AEZA 4L2IA 4O4LA 3BWVA 2IW1A 4HRYA 4L4UA 1KKLA 3N6XA 2BGIA 3MTAA 2HPHA 1THGA 5JVDA 1E8MA 1QO9A 1XL0A 3JS5A 5AW1A 3CHYA 2HDNB 2CHFA 2WSYB 3NEJA 2JZCA 5J5CA 3ZYZA 4I50A 4EZBA 3HVIA 3DGEC 3VNQA 1L8LA 2J3JA 1KZ6A 2AX3A 2OZLA 3GH3A 5G0TA 3X1MA 4ZYZA 1OH7A 3VNUA 2B35A 5I9NA 1WZCA 1Y34E 4GYJA 2H48A 2JKZA 1A72A 3A1DA 2IP2A 1UIMA 1XROA 5GV7A 2CUKA 2YZNA 1DP4A 3D0QA 4IHKA 2V1XA 2FOXA 5G3ZA 1QTNA 2ATVA 5HS4A 4UNSA 3IBYA 3KR0A 1ABEA 2G77B 3EJ6A 3OTIA 3G0IA 3LUGA 1SBTA 3B1ZA 4QTTB 1NURA 2XQFA 2VDJA 4YNBA 5F2EA 3VR2A 5ADHA 2W2QA 3HBFA 3W6PA 4ZFNA 1OWPA 2JFXA 4Z0TA 2VOEA 3THOA 2V3CC 1JKXA 2CLOB 1AC5A 1PHRA 1E2GA 5DM60 1SR8A 3FPAA 4M8LA 2BZ1A 4KLNA 1M10A 4GP6A 5BVHA 2O7NA 3PUIA 1ZXLA 3FJ1A 1IWPB 4AKTA 4JLDA 4HNSA 1LV8A 5F3DA 2PSDA 2YMQA 1FLDA 1TF7A 1UUFA 5IC6A 1X2BA 4K9PA 5GY7A 1NMQA 4C7KA 2JBAA 3DUPA 2G6BA 5ALYA 5AW7A 2G28A 1L6RA 1IWBB 1QVVA 2C3UA 3EIWA 4I4TA 3PUXA 1VFPA 1AM4D 1TECE 3UAVA 1ZNWA 5EMKA 3H2HA 3E03A 3UKOA 1IN7A 1SA0A 1RW4A 2X19A 4KIFA 4LDJA 2P62A 1MPXA 1ZRMA 3EW7A 4DSUA 1YVPA 3R0QA 1FFYA 3PJRA 1IZZA 1H6CA 3DW3X 2YKGA 3HRHA 3JZDA 2QPLA 4NECA 4BC0A 1A4UA 3B52X 1NW5A 2BGGA 4M1ZA 1UANA 2EZUA 2VWPA 3G2OA 4KR3A 4AJJA 2B0CA 1EU1A 1GUAA 4F56A 2WWYA 2PUFA 1ZGHA 1YVDA 4C14A 3GCZA 2P9HA 1NVUQ 3FLBA 3WB0A 3GGJA 5HZKA 4C2UA 1K6MA 4XRRA 1CD5A 3SDBA 3GNQA 1M1NA 1CUHA 3EE6A 4GO1A 4Q1VA 5ALDA 5E7JA 1G6Q1 5CDTA 5KTKA 1X8KA 1MW8X 2X8BA 3CSDA 3O7MA 5CNJA 5PGMA 2OUIA 3W5VA 4D3SA 2ZJZA 4F4CA 3TDKA 5EJFA 5FI5A 3U39A 3UWMA 1FJ2A 1EVLA 4YCSA 5JHHB 1RPNA 2P90A 4PPYA 3UBMA 1DG1G 3DBHA 4HDCA 3CH7A 4W82A 4N0MA 4WLFA 2FR0A 4LF5B 2A5JA 3N0RA 6CHYA 1ID8A 4E0BA 2WE8A 2WIKA 3I1JA 3LXRA 1UL1X 1ORTA 1ACMA 1RWWA 1P4HA 1FNNA 4PFJA 2YW2A 3V1MA 1EWTA 1LPMA 1RRMA 3WXMA 3LC1O 4KR0A 3UAYA 4AFNA 2BHSA 2UZ0A 2GGSA 2GLXA 1NXPA 3F7NA 1B8UA 4XE5A 3ZDEA 4O6VA 1ZCZA 3KJXA 4P8RA 5FOQA 5K45A 1TYZA 4FFBB 4G5FA 3IUBA 3IVXA 3I4CA 4ZOEA 3WBBA 4RTLA 4YJ2B 1ZL2A 2FFQA 1LW6E 5KYYA 2D5LA 4XFKA 3GJ7A 2JLCA 3HCCA 3BXPA 1GAWA 3O4FA 4XB6B 3LHKA 1GNLA 3UGTA 4TMZA 4R0NA 3OFVA 3ZKAA 2MT9A 1N0UA 2R8RA 2XHZA 2YV4A 3A31A 4MTLA 4UOQA 3S2YA 1AHPA 2QGFA 3ZDBA 1SBQA 1QMGA 1E5QA 3HEBA 3SX0A 3H7AA 1VDZA 3JWGA 3OCUA 2VDWB 3G49A 4LYJA 3AB3A 5AW2A 4A23A 5AVOA 2Q1SA 1SBNE 1R3DA 2ES4A 3MGCA 4MVJA 1OFHA 2YFQA 2P38A 5ERXA 5KOHB 3O91A 5L7WA 5C80A 1DTEA 3HUEA 5L3SB 1AURA 5EXEA 2ANEA 1WD5A 3D79A 5DWDA 4ZU6X 1VCMA 2IPMA 1F3LA 3HDGA 4PGMA 1XZFA 2I0FA 1J0XO 2Z5LA 1NE2A 1ZG3A 2XNDD 1T36A 2JC3A 3ZHXA 4QE3A 4I8DA 2UZ4A 3JVDA 4H2DA 4OL0A 4OPMA 1GOTA 4HQOA 3HA7A 3OG9A 2W42A 3H4IA 5DXFA 4CNQA 5KQRA 1XWWA 3JALB 1GN9A 3WBKA 1NM5A 2GVZC 4G0QA 4HZGA 2VSFA 4ZT3A 1DXHA 5CT8A 3GT3A 4PG7A 3KOWA 2YC4C 1U90A 2PVCA 3P2EA 3LDHA 4Q1FA 3TL6A 3WE7A 2HHAA 3QJ5A 2HPAA 2VO1A 2A2ZA 3EAQA 3IEXA 5CLHA 3T3DA 4D4LA 3W2GA 4MWSA 2WOOA 1L0BA 1EK1A 1NC3A 3B8HA 3KLNA 3W4KA 3FUXA 4PFKA 3WL8A 3GLGA 3C43A 3WIEA 2GSDA 4O2AF 2WF8A 4YTEA 1MKYA 5D6OA 3VYTB 1GXSA 1KDRA 4E11A 4MARA 2OHIA 3U60B 4RD2A 3NDIA 3PXXA 1WUJS 4F71A 2O8CB 4E31A 3PIIA 1CUSA 3EZ6A 5B2EA 5JCPA 1CERA 3C48A 1G0OA 3AXSA 4UPDA 3MS7A 4CIYA 1X15A 3PF8A 1VLMA 4PF1A 4C87A 4QQRA 4UCQA 4MWOA 4RYLA 1OZFA 5F4ZA 3SBXA 1P39A 3OTWA 1HZZA 3FA2A 2JI8A 1GT91 5DN6A 2FMXA 3TEMA 5E2AA 3HCAA 2EQBA 4I1RA 3T5TA 3V4ZA 3IQZA 3BDIA 4HEHA 1RJFA 1YHNA 2BVNA 1L1RA 3EK2A 1NOKA 1CV2A 5FF9A 4F6LA 1SKYB 1W88B 2GZDA 2Y71A 3M6AA 3HPRA 2XI4A 1NI4A 1OVMA 2A5YB 3GZNB 5CVDA 3D7LA 1AN0A 1EP2B 4XLLA 3C7AA 5IJ9A 4C2TA 3ZV0C 3LWOA 3UQZA 4EEXA 1E2UA 1IL0A 1G6OA 5BN3A 4FN4A 4BBAA 7REQB 4BJHB 5IZ4A 2V5AA 4BX3A 1JQJC 1P2SA 2GEKA 4CMEC 4R3WA 4X6YA 2NZUG 4KAJA 2B8NA 2NZYA 1UMCB 1RE1A 3U4QB 3DVLA 2JFYA 1MJGM 2CLSA 4NJMB 3UOWA 2QVYX 4XIYA 3EIFA 3DAPA 4S1OA 4TT3A 1ZD2P 4DN6A 4HDRB 1FL9A 1P9OA 2FUNB 3HO8A 1QQ5A 2ZJ6A 2IYUA 4G0YA 1JDJA 1BFKA 2FW7A 3CS3A 1GPWB 2O3TA 2W58A 4RM3A 4DSTA 4RF4A 3ZDXB 5DN9A 4P2GA 3QNMA 1RBMA 4BMDA 3OP1A 2QMYA 1ZK4A 4OU5A 3SYLA 3DUFA 2C2GA 4M60A 4AI6A 5DLDA 1KF0A 3EEQA 4PZDA 3GPCA 2F1OA 2NPFA 5B58C 1FC0A 4ZDJA 5I4IA 4B3HA 1K08A 4DCSA 5KTNA 4ZYYA 1T29A 4XVCA 4U2EA 4PM4A 4PC7A 3RIHA 4DG9A 3GAMA 3ICOA 4B8ZA 4L2IB 1KAHA 4O4LB 2XXJA 1YBFA 1N0WA 1XSEA 1A27A 3H18A 3C1OA 5JVDB 1TLLA 3I0MA 5ECWA 5KDDA 4QGHA 1T3GA 1ZM9A 1TL7C 1UXHA 2FEMA 4GI7A 4D4KA 1VI2A 3DMDA 1YRWA 1OBCA 2HTEA 2VG8A 2YVKA 1TO2E 3BQNB 5TC4A 5H0IA 4L15A 4TTVA 5ALPA 1QLHA 2A58A 3WTBA 1P5HA 4RV9A 7GPBA 1E3WA 2SKDA 5ALXA 2OZLB 1QTQA 5BUCA 2I7TA 3DG9A 2IK8A 5ALLA 5KNBH 1C8VB 3BGDA 4PAGA 4B3XA 1RLIA 3KQMA 4L8VA 1ZINA 5E0OA 1J6UA 1GCIA 8LDHA 2FMUA 3P9CA 4FMDB 4DPKA 5FX2A 3C24A 3K0BA 3KQTA 5CVUA 3LXUX 4F6RA 4POAA 3DE1X 4MKHA 2DPLA 3LHIA 4J7CA 4FYWA 3EVCA 3UHPA 4LGCA 4F2GA 1QB7A 3U62A 1K8ZB 1NLYA 1VPLA 4L3VA 2PUTA 3JQDA 1DJNA 3N59A 3OE4A 4MSUA 3RFXA 2C29D 1OKKA 4JL6A 1EVYA 5EWJA 1EYZA 3DXZA 4ZO6A 1KO8A 2Z3ZA 3DE7X 3HRIA 4YB8A 2QDXA 3LBHA 2R6AA 3MN1A 4R2WA 4QIHA 4KR2A 1O5TA 3LO8A 2QN6A 5BVHB 1EZ1A 1ZMXA 2NNWB 3TZBA 3P96A 5KNCA 4JN6B 1WD7A 4UHEA 2WLTA 4I66A 4YGXB 1FP7A 3TR0A 3FKQA 3GK3A 1KAMA 3NCTA 3OJOA 2XB4A 1WDTA 2YRXA 1HDIA 1SGVA 2ZU6A 3O4GA 4OJQA 1BS2A 5HKOA 4PPQA 3QVUA 4F91B 2JBAB 2YWEA 4JGBA 2X0RA 2XODA 5IXYA 1P6QA 4JH0A 4HXYA 4RLSA 1U3UA 5LZ9A 4I4TB 5I3ZA 1T2NA 5TQJA 1KH2A 4FGSA 3B7GA 1ZS7A 1SA0B 1LVGA 3AHCA 1B8NA 2JIBA 3WLNA 2EX4A 1WB4A 5G0WA 2P9TA 3N6VA 5CRIA 5FHRA 1I7LA 1KVSA 2QLFA 2ZETA 3CUEF 2WSSA 3COWA 5FNVF 3V2IA 2A94A 3JV7A 4KDFA 4O1IA 4L07A 3RC7A 3VMFA 4J7XA 2FETA 2Z30A 3A26A 5HXAA 1N0VC 4TWRA 2FMFA 1UJ2A 2JGRA 1ULAA 3RS5A 2OGTA 1TDJA 2OILA 1F17A 3LRXA 1L3BA 3L6EA 3CEAA 4XGKA 5B3AA 3T4PA 1I3OA 5DGHA 1ZC4A 1ZHFA 1INLA 2PWAA 3LW8A 2DJIA 4PX3A 3L49A 3IJ5A 2PRIA 3FHCB 5AK3A 3L1JA 1Z13A 5GV8A 4RXMA 3TDMA 5JJKA 2ZBFA 3VR2D 4RTQA 4TGLA 2ZYSA 4HXEB 4QO7A 1WMDA 2YYZA 4V3BA 4ZZ3A 3TTTA 2W2PA 2VC2B 2PLNA 2CL5A 3DBHB 3U7EB 2BRUC 2JFFA 2XVAA 2O6HA 3BC1A 5CA1F 2PT6A 3ETNA 2PA3A 8MHTA 3FCUB 2CYBA 4FMBB 1D2GA 4H3VA 3ESQA 1HKHA 2O7QA 5IT0A 1L4UA 1TTQB 3PQ4A 2ZUDA 1I5OA 2HX1A 3DLBA 3IHBA 3EIOA 4OJKA 2E1PA 5FUWA 3RVMA 1NBEA 2FG5A 4XWGA 2KHZA 3Q8XB 4MAAA 1YU6A 1P1BA 1RYFA 2AFIB 3EODA 5FB3A 2RGCA 3QU9A 3C3DA 4EPYA 2IDMA 2ZVDA 3DQQA 3RHSA 3CNOA 3EDCA 3U7GA 4DA6A 3O03A 4WOKA 3KJQA 2VYVD 3B6MA 1JHRA 4GR4A 5T67A 2XQIA 3WFJA 2BTQA 2IA5A 3B12A 4ECEA 4TQ9A 5KYYB 2H1LA 3U6KA 5JY1A 1JW9B 5ED4A 5H70A 1IUPA 3RREA 3VGPA 3UC9A 2YOGA 3CJQA 3EEBA 2JIZD 3F6YA 4P7FA 4US0R 3EW9A 3FZNA 4UTOA 1ORVA 3UK0A 2FQQA 2YY5A 2Z08A 4XWTA 2JJYA 3V4OA 1HQDA 2HY7A 4LRXA 5FBZA 3WB9A 3ZZ1A 4JL5A 1JG1A 4MDYA 5DX1A 3VSAA 4RLHA 2WJ4A 3BE5A 2JZOA 1Z08A 1CY4A 2K6GA 2Y1EA 4X44A 3HH8A 3L8FA 2QL7A 3D3UA 4Y2YA 2H1HA 1PVOA 1MQ9A 3ZG6A 1LDBA 2BTOA 3LBIA 4EW1A 4MDHA 1JHVA 3OPYI 4DILA 4J9UE 5CLGA 2ZANA 3OMXA 2P91A 4B47A 4YRSA 4TS3A 1TCVA 1Q17A 4Q1CA 4FDVA 4BO3A 3EYAA 4L5YA 1ZUIA 4L0MA 2JGFA 4FEYA 3OKCA 3O5AA 1C9EA 5EE5B 3M6WA 1T36B 1YCFA 3U49A 5HQ3A 4LECA 4BX8A 4CEHA 1ZXBA 1LVHA 4INZA 3ISJA 3AGEA 4BNJA 4O8CA 2GEVA 3OIWA 2HMTA 4BPBA 2JGLA 1RKQA 2DT8A 2I4IA 3KWMA 1WZUA 1FXWA 1VKHA 2YHAA 3FWYA 3WJ1A 2ZI5A 4ML3A 2W6JD 4QNNA 3BH0A 4CMEA 4BCBA 3VPFA 1G8JA 1MB4A 4BO9A 4XQ9A 1CRQA 3PWKA 3V6MA 1N5LA 4D3ZA 4V1CB 1OXMA 1WK2A 5F76A 3GLGB 2B30A 4QRHA 5LLDA 3A8TA 3QFSA 3A4IA 1VL1A 4BATA 3ZGZA 2NO5A 3I9V1 1UQRA 2D8MA 2NXNA 3HDJA 4GVLA 2DZDA 2HA3A 2AJLI 4HWTA 1JA1A 3KSUA 4HYYA 2XNCA 4II2A 4MWCA 2R8BA 4PCAA 2W6IA 2W6QA 2Q5JA 1F51E 1N9GA 3LPDA 3ZLBA 4F6CA 2ZM5A 4GECA 3T54A 2AN9A 4DG5A 2PSHA 4IH9A 1XUOA 1SNYA 4NARA 3A10A 4R41A 1E1KA 1NN5A 1VCOA 2IHTA 1YVRA 4X8LA 5IS2A 1U7XA 1YI1A 4DVGA 5HZHA 3MB8A 4EVSA 5CFZA 4EY5A 1W47A 3ZN2A 2OESA 1L7DA 1XZHA 2ZW9A 2KMLA 1LDYA 5EA2A 5KYNA 4TWIA 2D74A 4YDQA 1SVMA 5EMJA 1EESA 4H4CA 4MR8A 4IIUA 3K5WA 1NI4B 3ED5A 1CE8A 1QYXA 2LXNA 2UDPA 4K2AA 2Z8YM 1B41A 4NNOA 5I9LA 2C42A 2QJFA 1UBGA 3HYTA 3FWNA 3L0OA 5IJ9B 1NXOA 2ZUBA 1OMOA 2G5GX 2B94A 4K8OA 2HWXA 5CTJA 5BN3B 5IUJC 5I8WA 1VYUA 1CP3A 3HPQA 1X1BA 3F8SA 5C1PA 5K6TA 5JQGA 1NN1A 2IEZA 1DKMA 5F35A 3BZWA 4I5IA 1GPMA 1T1GA 5F21A 5SICE 1BZYA 3B70A 3VZSA 4ZGBA 4BVFA 3ETDA 2ZIGA 4NYIQ 1YB7A 1Z3CA 3OO0A 3PNMA 4RHEA 4RJKA 3TLCA 1PGJA 5F98A 3WIBA 1C8BA 5IHPA 1AO3A 3IHAA 4GICA 1M8PA 4GMFA 3TGLA 3NBKA 2GUWA 1BA3A 3AY3A 2QUIA 3ZWWA 4ETWA 1T1IA 4S0XA 1ELOA 4QICA 1NZFA 5FEUA 4W7SA 3F1KA 3DUFB 3A7EA 5BWLA 4TN5A 1OXKB 5TRTA 1YR8A 2AC4A 1JYSA 4FEAA 4KMOA 2JJ8A 3G0CA 4F4DA 1P1JA 3ROFA 2HYIC 3G0DA 1R0KA 4ACAA 4L6AA 2PGLA 1Z06A 2EIHA 3DLAA 3FCOA 3JRXA 1U2DC 1S01A 4HNRA 4MS3A 1PFKA 2OT3B 4MHTA 2FMIA 2C5BA 3B1WA 5L3RA 3M9LA 3L7JA 3KYBA 4HB4A 3L6OO 5DK4A 3V7UA 1W96A 3DQPA 3AEQB 4QLAA 1QGED 5CFQA 1G2PA 4BTEA 1D4ZA 2JIOA 1C3EA 1H22A 5CXSA 1FJGB 2TMGA