1WK2A

Crystal structure of a hypothetical protein from thermus thermophilus hb8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
120
structure length
84
Chain Sequence
MERPKLGLIVREPYASLIVDGRKVWEIRRRKTRHRGPLGIVSGGRLIGQADLVGVPLYAWVLENAFRYEKPLHVPMFVDLSEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords HYPOTHETICAL PROTEIN
publication title Crystal structure of a hypothetical protein from thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 18
structure length 84
sequence length 120
ec nomenclature
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04266 ASCH ASCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.30 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Hypothetical protein. 1wk2A00
1WK2A 2E5OA 3IUWA 2Z0TA 1S04A 2KKUA 1XNEA 1TE7A 2DP9A
chains in the Genus database with same CATH superfamily
1SQWA 2AS0A 2CX0A 3LJCA 2FRXA 3D79A 4TZ4C 3IUWA 1ZE1A 4CI2B 1IT7A 3LWRA 1T5YA 1S04A 4CI3B 1ZS7A 2AB4A 1SGVA 3LDFA 2E5OA 3HJYA 3U28A 2J5VA 3ZV0C 3LWQA 2J5TA 2CWWA 3M6WA 3VSEA 3UAIA 3LWOA 4Q1TA 2RFKA 1XNEA 3M6VA 3C0KA 1TE7A 3M4XA 1ZBOA 1R3FA 2B78A 2P38A 1IQ8A 4DMGA 4CI1B 3MQKA 3M6UA 2AUSA 2APOA 2Z0TA 2ANEA 1K8WA 3HJWA 3LWVA 1ZE2A 2HVYA 1Q7HA 2DP9A 1WXWA 1J2BA 1WK2A 1IT8A 1R3EA 2EY4A 2CX1A 3HAXA 2Q07A 1UOYA 2KKUA 3LWPA 3M65A 1ZL3A 3M6XA 1WXXA
chains in the Genus database with same CATH topology
1WK2A 2E5OA 3IUWA 2Z0TA 4P78C 4C26A 1S04A 2KKUA 1XNEA 1WHZA 1TE7A 2DP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WK2 A;  2E5O A;  3IUW A;  2Z0T A;  1S04 A;  2KKU A;  1XNE A;  1TE7 A;  2DP9 A; 
#chains in the Genus database with same CATH topology
 1SQW A;  2AS0 A;  2CX0 A;  3LJC A;  2FRX A;  3D79 A;  4TZ4 C;  3IUW A;  1ZE1 A;  4CI2 B;  1IT7 A;  3LWR A;  1T5Y A;  1S04 A;  4CI3 B;  1ZS7 A;  2AB4 A;  1SGV A;  3LDF A;  2E5O A;  3HJY A;  3U28 A;  2J5V A;  3ZV0 C;  3LWQ A;  2J5T A;  2CWW A;  3M6W A;  3VSE A;  3UAI A;  3LWO A;  4Q1T A;  2RFK A;  1XNE A;  3M6V A;  3C0K A;  1TE7 A;  3M4X A;  1ZBO A;  1R3F A;  2B78 A;  2P38 A;  1IQ8 A;  4DMG A;  4CI1 B;  3MQK A;  3M6U A;  2AUS A;  2APO A;  2Z0T A;  2ANE A;  1K8W A;  3HJW A;  3LWV A;  1ZE2 A;  2HVY A;  1Q7H A;  2DP9 A;  1WXW A;  1J2B A;  1WK2 A;  1IT8 A;  1R3E A;  2EY4 A;  2CX1 A;  3HAX A;  2Q07 A;  1UOY A;  2KKU A;  3LWP A;  3M65 A;  1ZL3 A;  3M6X A;  1WXX A; 
#chains in the Genus database with same CATH homology
 1WK2 A;  2E5O A;  3IUW A;  2Z0T A;  4P78 C;  4C26 A;  1S04 A;  2KKU A;  1XNE A;  1WHZ A;  1TE7 A;  2DP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...