1WK2A

Crystal structure of a hypothetical protein from thermus thermophilus hb8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
120
structure length
84
Chain Sequence
b'MERPKLGLIVREPYASLIVDGRKVWEIRRRKTRHRGPLGIVSGGRLIGQADLVGVPLYAWVLENAFRYEKPLHVPMFVDLSEVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN
publication title Crystal structure of a hypothetical protein from thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 18
structure length 84
sequence length 120
ec nomenclature
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04266 ASCH ASCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.30 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Hypothetical protein. 1wk2A00
2E5OA 1WK2A 1TE7A 2KKUA 2DP9A 1XNEA 3IUWA 1S04A 2Z0TA
chains in the Genus database with same CATH superfamily
4Q1TA 2EY4A 1ZE2A 2DP9A 2AB4A 4CI3B 3UAIA 1SGVA 2B78A 2Z0TA 3M6VA 1SQWA 3LDFA 3LWRA 3M6WA 4CI2B 2CWWA 2E5OA 2J5TA 2RFKA 4CI1B 1TE7A 1J2BA 1IT7A 1WXWA 1IQ8A 2CX0A 3ZV0C 1WXXA 4DMGA 1K8WA 3HJYA 4TZ4C 3M6UA 3LJCA 1R3FA 3M65A 3LWQA 1R3EA 2AS0A 3M6XA 1ZBOA 1UOYA 1XNEA 3LWOA 3LWPA 1ZL3A 3U28A 3MQKA 1ZS7A 3VSEA 2J5VA 3HAXA 1IT8A 3M4XA 1ZE1A 1T5YA 3HJWA 2CX1A 3C0KA 2AUSA 2ANEA 1WK2A 3LWVA 2KKUA 3IUWA 1S04A 3D79A 1Q7HA 2P38A 2HVYA 2APOA 2Q07A 2FRXA
chains in the Genus database with same CATH topology
2E5OA 1WK2A 1TE7A 2KKUA 2DP9A 1XNEA 4C26A 3IUWA 4P78C 1WHZA 1S04A 2Z0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5O A;  1WK2 A;  1TE7 A;  2KKU A;  2DP9 A;  1XNE A;  3IUW A;  1S04 A;  2Z0T A; 
#chains in the Genus database with same CATH topology
 4Q1T A;  2EY4 A;  1ZE2 A;  2DP9 A;  2AB4 A;  4CI3 B;  3UAI A;  1SGV A;  2B78 A;  2Z0T A;  3M6V A;  1SQW A;  3LDF A;  3LWR A;  3M6W A;  4CI2 B;  2CWW A;  2E5O A;  2J5T A;  2RFK A;  4CI1 B;  1TE7 A;  1J2B A;  1IT7 A;  1WXW A;  1IQ8 A;  2CX0 A;  3ZV0 C;  1WXX A;  4DMG A;  1K8W A;  3HJY A;  4TZ4 C;  3M6U A;  3LJC A;  1R3F A;  3M65 A;  3LWQ A;  1R3E A;  2AS0 A;  3M6X A;  1ZBO A;  1UOY A;  1XNE A;  3LWO A;  3LWP A;  1ZL3 A;  3U28 A;  3MQK A;  1ZS7 A;  3VSE A;  2J5V A;  3HAX A;  1IT8 A;  3M4X A;  1ZE1 A;  1T5Y A;  3HJW A;  2CX1 A;  3C0K A;  2AUS A;  2ANE A;  1WK2 A;  3LWV A;  2KKU A;  3IUW A;  1S04 A;  3D79 A;  1Q7H A;  2P38 A;  2HVY A;  2APO A;  2Q07 A;  2FRX A; 
#chains in the Genus database with same CATH homology
 2E5O A;  1WK2 A;  1TE7 A;  2KKU A;  2DP9 A;  1XNE A;  4C26 A;  3IUW A;  4P78 C;  1WHZ A;  1S04 A;  2Z0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...