1WK2A

Crystal structure of a hypothetical protein from thermus thermophilus hb8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
120
structure length
84
Chain Sequence
MERPKLGLIVREPYASLIVDGRKVWEIRRRKTRHRGPLGIVSGGRLIGQADLVGVPLYAWVLENAFRYEKPLHVPMFVDLSEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN
publication title Crystal structure of a hypothetical protein from thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 18
structure length 84
sequence length 120
ec nomenclature
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04266 ASCH ASCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.30 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Hypothetical protein. 1wk2A00
2KKUA 1S04A 1TE7A 2E5OA 1WK2A 1XNEA 2Z0TA 2DP9A 3IUWA
chains in the Genus database with same CATH superfamily
2P38A 1ZE1A 3LWOA 2FRXA 1ZS7A 1T5YA 2B78A 3LJCA 3M6WA 1WK2A 2J5VA 3M6UA 4Q1TA 4CI2B 1SQWA 2DP9A 2J5TA 2Z0TA 4CI1B 3LWQA 2CX1A 3LWVA 1J2BA 2KKUA 2CWWA 1ZBOA 2ANEA 1SGVA 3M65A 3U28A 3VSEA 1ZE2A 1IQ8A 2E5OA 3M6VA 2CX0A 1XNEA 2AUSA 2Q07A 4CI3B 3M4XA 1Q7HA 1ZL3A 3C0KA 3HJWA 1S04A 1TE7A 3HJYA 1IT7A 2APOA 2AS0A 2RFKA 3D79A 3LWPA 1R3FA 1R3EA 1UOYA 4TZ4C 1WXWA 3LDFA 1WXXA 4DMGA 2HVYA 1IT8A 1K8WA 3HAXA 3M6XA 2AB4A 3UAIA 3MQKA 2EY4A 3LWRA 3ZV0C 3IUWA
chains in the Genus database with same CATH topology
2KKUA 1S04A 1TE7A 2E5OA 4C26A 1WK2A 1XNEA 4P78C 1WHZA 2Z0TA 2DP9A 3IUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKU A;  1S04 A;  1TE7 A;  2E5O A;  1WK2 A;  1XNE A;  2Z0T A;  2DP9 A;  3IUW A; 
#chains in the Genus database with same CATH topology
 2P38 A;  1ZE1 A;  3LWO A;  2FRX A;  1ZS7 A;  1T5Y A;  2B78 A;  3LJC A;  3M6W A;  1WK2 A;  2J5V A;  3M6U A;  4Q1T A;  4CI2 B;  1SQW A;  2DP9 A;  2J5T A;  2Z0T A;  4CI1 B;  3LWQ A;  2CX1 A;  3LWV A;  1J2B A;  2KKU A;  2CWW A;  1ZBO A;  2ANE A;  1SGV A;  3M65 A;  3U28 A;  3VSE A;  1ZE2 A;  1IQ8 A;  2E5O A;  3M6V A;  2CX0 A;  1XNE A;  2AUS A;  2Q07 A;  4CI3 B;  3M4X A;  1Q7H A;  1ZL3 A;  3C0K A;  3HJW A;  1S04 A;  1TE7 A;  3HJY A;  1IT7 A;  2APO A;  2AS0 A;  2RFK A;  3D79 A;  3LWP A;  1R3F A;  1R3E A;  1UOY A;  4TZ4 C;  1WXW A;  3LDF A;  1WXX A;  4DMG A;  2HVY A;  1IT8 A;  1K8W A;  3HAX A;  3M6X A;  2AB4 A;  3UAI A;  3MQK A;  2EY4 A;  3LWR A;  3ZV0 C;  3IUW A; 
#chains in the Genus database with same CATH homology
 2KKU A;  1S04 A;  1TE7 A;  2E5O A;  4C26 A;  1WK2 A;  1XNE A;  4P78 C;  1WHZ A;  2Z0T A;  2DP9 A;  3IUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...