3D79A

Crystal structure of hypothetical protein ph0734.1 from hyperthermophilic archaea pyrococcus horikoshii ot3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
167
structure length
167
Chain Sequence
IKHPLSKKDVKEIIAQLSQMFGEEIARKMLNKKDEVKVAEFDKTTEIILVNDKPMFIRRKDLIFPLVIALYNLSDEEDLRKWPRRVVVDEGAVPHILNGADVMAPGIVDADEGIKEGDFVFVVEEKYGRPLAIGIALMSGKVMKEKNRGKAVKVIHHARDKIWEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0734
publication title Crystal structure of hypothetical protein PH0734.1 from hyperthermophilic archaea Pyrococcus horikoshii OT3.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Unknown function
total genus 45
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF17832 Pre-PUA Pre-PUA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 3d79A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 3d79A01
2CX0A 1K8WA 1WXWA 2AS0A 2CX1A 3UAIA 4DMGA 1ZS7A 3D79A 1J2BA 2P38A 1IT7A 2J5TA 2J5VA 1IT8A 1IQ8A 1WXXA 1R3EA 1ZE2A 4Q1TA 3C0KA 1T5YA 3LDFA 2AB4A 1R3FA 2B78A 1Q7HA 1ZE1A 2Q07A 1SQWA 2CWWA 1ZL3A 3VSEA 1SGVA
chains in the Genus database with same CATH superfamily
1OCVA 1B27A 1TRPA 3M6WA 2GSPA 5STDA 3EF8A 4XDWA 3M6VA 1DYUA 2SBLA 2KRTA 2ML6A 3M6XA 1J2BA 2GBWB 4TX4A 4U13A 2BHMA 1IT7A 5ELJA 1MWTA 2W04A 1MGRA 5AYRB 5CF1A 1N8R4 1RCKA 4AKYA 4N6LA 4BL3A 5EEOA 3KCHA 1W00A 1V58A 5DREA 1BSEA 2CH9A 2IUJA 3ZG5A 2XGLA 1VQP3 4HM1B 2KF6A 1IVWA 1NNVA 2K0MA 4K61A 3V92A 5JPPA 3MWZA 1RNTA 2KF4A 1JNQA 3STDA 3H51A 1GOVA 3WOFB 1OUNA 3SOYA 1SJWA 1TFOA 1FGTA 4HM6B 1Q9EA 3F14A 2CWWA 4J5GA 4LSOA 1RNBA 1X1YA 1FZUA 2C11A 1RN7A 1E97A 3AHSA 1RTUA 1IV9A 1DMNA 1SIHA 2MF7A 1JRQA 4X2OA 1B3SA 3CCV3 1TE7A 3O8YA 1FW7A 2E2TA 3S5CA 1BNJA 2GEYA 4GL6A 5EVHA 2XRXB 4CPKA 1RGHA 4ILFA 1BRHA 5IERA 4RNTA 1PFPA 1UUVB 5AYSC 4FMAA 1BRNL 3G713 1PY3A 5HOHA 3GZRA 1T5YA 6GSPA 4RNYA 2ANEA 1BSAA 2JDIH 3KZTA 2YFJB 1A90A 4NREA 5IG0A 1SIIA 3NBBA 4L8OA 5FW5A 2R4IA 3X3YA 3X40A 4LYLB 3M6UA 4J5KA 1WMOA 3CCQ3 1I3IA 1W6GA 2RNTA 2F98A 5AEUB 1BVIA 1FA3A 3NHXA 4I5QA 1SGVA 1WK2A 3BNBA 4K1UA 1LOYA 3LOYA 3SVAA 2RBIA 2AS0A 2H0HA 3EHCA 1UCKA 4HM4B 4X2HA 5RNTA 1ROAA 1XNEA 3KKGA 2F5WA 2Y73A 4MEIA 3ER7A 2GEXA 1IQXA 1GMQA 5I97A 3FLJA 1OPYA 1YVSA 1RCLA 3WOEB 2ZL8A 3TDGA 4GSPA 3X3ZA 1W02A 1BRIA 3OWSA 1KD14 5IF6A 1RGLA 1UI8A 4RBNA 3S67A 2HMJB 1N9EA 4KVHA 1WQLB 1B21A 3CCM3 1IV7A 2XR8B 1YI23 3FG1A 3EBYA 2HMOB 3HK4A 3OWUA 1Q7HA 1JB5A 2Q07A 5M1AA 1N8QA 1O7WB 1YIJ3 1FGMA 1OH0A 1ZX2A 3FGYA 1STDA 3VSEA 3MHEA 1RLSA 2HMMB 1EEJA 3UL5A 1YJ93 1GSPA 2FGTA 1QAFA 2JQ5A 2M7OA 3EN1B 4KFEA 5AEWB 1EQKA 3OV4A 2OOVC 5IEOA 3EB8A 1BRJA 1VZZA 4FCJA 1G02A 1NU3A 5HGRA 1BSBA 4WFOA 3CCE3 1LVNA 1YIT3 1CEWI 3QK9A 2RFRA 1RKYA 2XFTA 3EBTA 3MYTA 3JUMA 2PZVA 2WO0A 3C0KA 4MMXB 3AMOB 1JN5A 2INXA 5AIFA 2AB4A 2CWUA 1JBRA 1K9M4 3V99A 2CIUA 4H61A 2GBXB 3IPTA 3CD63 1I2FA 3EQQB 3F8XA 1GMPA 3CNXA 1RDSA 1OACA 3NV0A 3JUNA 3DXOA 3BLZA 2OQEA 3D4AA 6RNTA 4R80A 3JUOA 2H0IA 2OWPA 5BU4A 3S28A 2OTL3 3G6E3 2F4YA 3D79A 2L1SA 1VQQA 3PZWA 4LEHA 4XBXA 3G16A 1BAOA 1TP6A 3ZV0C 1UCJA 4HM7B 3WMDA 4CCVA 4O3VA 4XB5A 3SX1A 2WOFA 1ISKA 4XM4A 1RN4A 1I3FA 4I4KA 2CFWA 2W9PA 1IVVA 4OUQA 4CDLA 3BB9A 1NDOB 1T2HA 1SARA 2GU3A 3CC43 1JBSA 2E2UA 2E2VA 2Z6BA 1Z1SA 1ZE1A 4BTXA 1SQWA 1X1WA 5M19A 4OK0A 3MPHA 1YHQ3 3LWPA 3PCSA 4HM2B 2Z0TA 2RSXA 2LYXA 1K8WA 4DMGA 1GOUA 3K63A 1JV2B 2P09A 3K7CA 3KSPA 1IYYA 2RCDA 3K5TA 3SOAA 3CCR3 2KXGA 2HVYA 3OXAA 2K54A 5ELUA 2F99A 5BIRA 4HZBB 1TU5A 1KQS2 4WP5A 2J5VA 3LTDA 5IEPA 1EKMA 4ORLA 7RNTA 1OHOA 3CPOA 3NBJA 1G0TA 1R3EA 1VQL3 2CWTA 1ASKA 4KZ1A 1W6YA 1O7PB 3U1WA 5IG5A 2MC8A 1QMAA 1OHPA 3RNTA 2B24B 2O9UX 3CCL3 1OF5B 1TTOA 1LRAA 3DY5A 1YGEA 1CYVA 1FUTA 3SEDA 1YJW3 3DUKA 2XSOB 3DH2A 1GY7A 3MQKA 1D6ZA 2Z7AA 3PYJA 4WYKB 5AIHA 3S29A 3OX9A 1UGIA 3EJVA 5A0OB 1IK3A 1ZBOA 3MSOA 2WGQA 4FR9A 1LNHA 2CC3A 3DGNA 2QIYA 1RGEA 1S723 1JB4A 3LH4A 1L5GB 2KAAA 3K0ZA 3RDEA 3GZXB 1VQN3 2B1XB 4HVNA 1YGWA 1LNIA 1UUWB 5CXOA 3DGLA 1VQO3 1WMNA 3Q3FA 3M4XA 3WODG 1BNGA 2AADA 2CFLA 3ZFZA 1WXXA 4FMCA 1MGWA 1JZOA 2HOHA 3LJCA 5AI1A 1A2PA 4LMIA 4EW5A 3VF1A 1IQYA 4L7KA 1RGKA 1TIJA 3D5IA 3Q1CA 1ULIB 2IYJA 3FF2A 1BRGA 1TJDA 2SARA 4G1MB 4IIAA 2ZA4A 1YNVX 4LZIA 4N6OB 1YJN3 2FNQA 1O7HB 2RFKA 1M1K4 2A15A 4IPBA 1RRHA 3CNMA 1Q814 1B2MA 1K41A 1WXWA 1NB5I 4R1KA 1A2VA 3MG3A 1QAKA 2H0GA 3DGMA 1HKXA 1VQ93 3U97A 1RHLA 2CFDA 5AIGA 1IQ8A 4DKIA 2IA7A 3D9RA 4HZ9B 3JUQA 3WR2A 5CF2A 2CHCA 1K734 1KSIA 3NM2A 1CQSA 3FZWA 1W4NA 1F8NA 3G4S3 2E5OA 1MWSA 1KC84 1K28A 3ALAA 3BNCA 1M9GA 3DM8A 3CC73 1GD3A 1GY6A 1TFKA 1X1UA 2RGQA 3MKIA 3WHOA 1DETA 1RN1A 2LQVA 1RRLA 1LQMB 2QGUA 1GS3A 3UJMA 3I553 3WA3A 1U8CB 4WHAA 1HYFA 2W56A 1Q40B 1O7MB 2STDA 3G8ZA 3VGNA 2CX1A 3A76A 1C7HA 4XBTA 1S5AA 1JKGA 2XF3A 3WA2X 3ROBA 1TUHA 2UX0A 1GMRA 3LTBA 2DP9A 3PGBA 2P0MA 1EG9B 1BSDA 4J8TA 2OOVA 1DVCA 2BNGA 3B4PA 3URPA 4EXRA 1O7NB 5KP1A 4L8PA 3FH1A 1WMPA 2QEX3 2CG0A 2AUSA 4CI3B 1VQM3 1DMMA 4EC6A 1I2EA 3UL6A 2YFLB 3BNDA 3D5GA 3LWOA 3EC9A 3GRDA 1W2B2 2B78A 3KFQC 1I0XA 1VQ53 1BNIA 2CWVA 3LTCA 3KIIA 1RGAA 3PXMA 3CCS3 2KF3A 3CCJ3 3AMOA 3GSPA 3NX0A 4TZ4C 2V1LA 4GB5A 1UI7A 3KSED 5KP4A 2KKUA 1ZGXA 1ULJB 2HMKB 3I0YA 1ZO2A 1N9JA 3I563 2W03A 4H3UA 2P38A 2KCDA 2IY2A 1QVG2 4O2HA 3U28A 2CG1A 3X3XA 5M18A 1ZE2A 3Q2PA 4R9KA 3RGRA 2CFGA 1JZDA 3NV0B 4RZMA 3AGOA 1UCLA 1I70A 3UB1A 1NB3I 3LMLA 3LDFA 1UOYA 1O7GB 2XGNA 3GZBA 2XH9A 2YFIB 3LZAA 1GD4A 3UNLA 1JBTA 3NXJA 3LT8A 2BIRA 2F86B 3OW22 3IUWA 2ZDJA 1HU9A 4HOHA 3HJYA 1BNEA 1IVXA 1FGOA 1EA2A 4N6MA 3K9MC 1A67A 1Q42A 4N6TA 1IDPA 4FMBA 3SLUA 1HZ1A 3CCU3 4HM8B 2W9QA 3F7XA 5AIIA 1BOXA 3M8CA 1BGSA 2BT3A 1GY5A 3LWRA 1NWWA 1RGCA 1FYSA 3MG1A 1FUSA 1RSNA 3FF0A 3N54B 1W01A 2FRXA 3FSDA 1R4YA 1V74A 3V98A 1BNSA 4JF8A 5CLKA 3DGYA 4J9AA 2K3DA 3NQYA 1RJOA 1SPUA 5JPUA 4N6V0 1NJI4 3CPW2 1Y4KA 3HI7A 3NM7A 3X42A 8CHOA 4HM0B 1QJGA 5FGOA 1E3RA 7GSPA 1PU4A 3OWYA 5GSPA 5LC6A 1E3VA 5DRVA 4N6NB 2APOA 3T0UA 3T8UA 2FXTA 1Q824 1IU7A 1VQ43 1D6UA 3ECFA 1FGQA 1NO3A 2ZHXB 4WYKA 4XBYA 4CI2B 3NBRA 2F56A 4WWUC 2CKFB 3CME3 1BNRA 3B4OA 3LYGA 1B2XA 5LC7A 4K90B 3H3HA 2J8XB 3PS8A 3IMAB 5G1LA 1G96A 1BIRA 1BANA 1U5OA 2W6JH 2ML5A 1BRSA 3B8LA 1DMQA 4O8SA 3LXUX 4R4KA 1N5HA 3X41A 1V57A 2IUKA 1A2KA 3AHWA 4BIRA 2R41A 2XEPA 1RGFA 3BNEA 3Q90A 3NUVA 1WTHA 1STFI 1ZL3A 3L0RA 1UDII 4HYZA 3M65A 1MWUA 3HAXA 3E99A 5D81A 3HZPA 5D82A 1GOYA 4BTWA 4EV2A 5D83A 1US1A 1YVBI 3F9SA 4KT3B 3B7CA 8RNTA 1PYLA 3S27A 5IW9A 3F8HA 4JRFA 2BMOB 4FCMA 4O02B 4AEQA 2GU1A 1BNFA 4Q53A 1CYUA 4ZM8A 1N5PA 1OGXA 2WGOA 4QWTA 1VQ83 1RGGA 1AVLA 4N6UA 3HIGA 2OTJ3 4EBGA 3GZYB 1K8A4 1I2GA 4HM5B 3A5EA 5BXQA 1BUJA 1AY7A 1ROVA 2D1WA 1LOVA 3HJWA 3PCRA 3N9HA 3RGAA 1VQ73 1OGZA 2UGIA 2L4VA 1Q7Y4 4BL2A 3HX8A 4HKVB 1T3BA 3FKAA 3F7SA 4HM3B 3J7Yd 1LQGC 4EYCA 4CJNA 4PEJA 4NHFA 1ZS7A 5CK6A 3ZG0A 3LWVA 2GXFA 3EE1A 3SXXA 4STDA 7STDA 1Q40A 3VSYA 1MOLA 4HAAA 2IMJA 2KF5A 5BVBA 4K1VA 2BMQB 2F5MA 4N3VA 3N8BA 1KWIA 1CH0A 3GWRA 1DE3A 1LOWA 1W5ZA 3IJEB 6STDA 4BTYA 2I9WA 3JVCA 9RNTA 2Z76A 1MWRA 3CU3A 3GAXA 2W56B 4FMDA 3SYUA 2W0QA 4MJDA 2D42A 1M904 5IG4A 3CXC2 1BSCA 1AVKA 1C54A 1M1XB 1JKGB 2EY4A 2P05A 1EUIC 1AQZA 2CX0A 3CMA3 1AV4A 2YX9A 5JBSA 4NPBA 3QRDA 1VQK3 3HIIA 4OVMA 1JJ22 2WOHA 1B20A 1I0VA 4LGQA 1QVF2 3FCSB 4EV5A 3T8NA 1BU4A 1JN5B 1VQ63 2HMNB 2P0XA 2C10A 2BMRB 2CFKA 4KFFA 1T2IA 3JUPA 3MG2A 1AR0A 4HJLB 1BRKA 3EX9A 1UCIA 1BUQA 1GYBA 3G0KA 3FG4A 3DMCA 3NQZA 2CK3H 1R3FA 1QALA 1R4CA 2OQEC 1D6YA 3BIRA 3KN4A 5EQLA 3CC23 3LTAA 1JB2A 3AGNA 1LXEA 3LWQA 2W2CA 5G2GA 2CW9A 4XDVA 1UUGB 1I8VA 1S04A 1UW1A 3LT9A 2PNCA 2BO9B 4RNZA 1MNLA 4GHOA 3UAIA 3FG3A 3DGOA 3HOHA 4BU4A 2O3OA 5G1KA 1IVUA 1W6CA 2Y74A 4AKZA 5IENA 1X1XA 2J5TA 1TRQA 2AAEA 3DZLA 4R9LA 3F40A 2OCTA 1IT8A 3BU4A 2C4BA 2Z77A 4FCZA 2UUGC 4Q1TA 4KFDA 4IT7A 4MMYB 3D3LA 5TGNA 2QA43 3KE7A 1B2UA 1OHSA 1UGHI 3WDGB 3EN8A 2XFSA 2BU4A 1LOXA 1WNHA 1B2SA 1W2ZA 1W7CA 5IG3A 1DVDA 1B2ZA 2XSHB 1FUWA 1OF5A 4HBRA 5KP3A 1Q864 2HMLB 1RMSA 1FGRA 4MMZB 4CI1B
chains in the Genus database with same CATH topology
2CX0A 1K8WA 1WXWA 2AS0A 2CX1A 3UAIA 4DMGA 1ZS7A 3D79A 1J2BA 2P38A 1IT7A 2J5TA 2J5VA 1IT8A 1IQ8A 1WXXA 1R3EA 1ZE2A 4Q1TA 3C0KA 1T5YA 3LDFA 2AB4A 1R3FA 2B78A 1Q7HA 1ZE1A 2Q07A 1SQWA 2CWWA 1ZL3A 3VSEA 1SGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CX0 A;  1K8W A;  1WXW A;  2AS0 A;  2CX1 A;  3UAI A;  4DMG A;  1ZS7 A;  3D79 A;  1J2B A;  2P38 A;  1IT7 A;  2J5T A;  2J5V A;  1IT8 A;  1IQ8 A;  1WXX A;  1R3E A;  1ZE2 A;  4Q1T A;  3C0K A;  1T5Y A;  3LDF A;  2AB4 A;  1R3F A;  2B78 A;  1Q7H A;  1ZE1 A;  2Q07 A;  1SQW A;  2CWW A;  1ZL3 A;  3VSE A;  1SGV A; 
#chains in the Genus database with same CATH topology
 1OCV A;  1B27 A;  1TRP A;  3M6W A;  2GSP A;  5STD A;  3EF8 A;  4XDW A;  3M6V A;  1DYU A;  2SBL A;  2KRT A;  2ML6 A;  3M6X A;  1J2B A;  2GBW B;  4TX4 A;  4U13 A;  2BHM A;  1IT7 A;  5ELJ A;  1MWT A;  2W04 A;  1MGR A;  5AYR B;  5CF1 A;  1N8R 4;  1RCK A;  4AKY A;  4N6L A;  4BL3 A;  5EEO A;  3KCH A;  1W00 A;  1V58 A;  5DRE A;  1BSE A;  2CH9 A;  2IUJ A;  3ZG5 A;  2XGL A;  1VQP 3;  4HM1 B;  2KF6 A;  1IVW A;  1NNV A;  2K0M A;  4K61 A;  3V92 A;  5JPP A;  3MWZ A;  1RNT A;  2KF4 A;  1JNQ A;  3STD A;  3H51 A;  1GOV A;  3WOF B;  1OUN A;  3SOY A;  1SJW A;  1TFO A;  1FGT A;  4HM6 B;  1Q9E A;  3F14 A;  2CWW A;  4J5G A;  4LSO A;  1RNB A;  1X1Y A;  1FZU A;  2C11 A;  1RN7 A;  1E97 A;  3AHS A;  1RTU A;  1IV9 A;  1DMN A;  1SIH A;  2MF7 A;  1JRQ A;  4X2O A;  1B3S A;  3CCV 3;  1TE7 A;  3O8Y A;  1FW7 A;  2E2T A;  3S5C A;  1BNJ A;  2GEY A;  4GL6 A;  5EVH A;  2XRX B;  4CPK A;  1RGH A;  4ILF A;  1BRH A;  5IER A;  4RNT A;  1PFP A;  1UUV B;  5AYS C;  4FMA A;  1BRN L;  3G71 3;  1PY3 A;  5HOH A;  3GZR A;  1T5Y A;  6GSP A;  4RNY A;  2ANE A;  1BSA A;  2JDI H;  3KZT A;  2YFJ B;  1A90 A;  4NRE A;  5IG0 A;  1SII A;  3NBB A;  4L8O A;  5FW5 A;  2R4I A;  3X3Y A;  3X40 A;  4LYL B;  3M6U A;  4J5K A;  1WMO A;  3CCQ 3;  1I3I A;  1W6G A;  2RNT A;  2F98 A;  5AEU B;  1BVI A;  1FA3 A;  3NHX A;  4I5Q A;  1SGV A;  1WK2 A;  3BNB A;  4K1U A;  1LOY A;  3LOY A;  3SVA A;  2RBI A;  2AS0 A;  2H0H A;  3EHC A;  1UCK A;  4HM4 B;  4X2H A;  5RNT A;  1ROA A;  1XNE A;  3KKG A;  2F5W A;  2Y73 A;  4MEI A;  3ER7 A;  2GEX A;  1IQX A;  1GMQ A;  5I97 A;  3FLJ A;  1OPY A;  1YVS A;  1RCL A;  3WOE B;  2ZL8 A;  3TDG A;  4GSP A;  3X3Z A;  1W02 A;  1BRI A;  3OWS A;  1KD1 4;  5IF6 A;  1RGL A;  1UI8 A;  4RBN A;  3S67 A;  2HMJ B;  1N9E A;  4KVH A;  1WQL B;  1B21 A;  3CCM 3;  1IV7 A;  2XR8 B;  1YI2 3;  3FG1 A;  3EBY A;  2HMO B;  3HK4 A;  3OWU A;  1Q7H A;  1JB5 A;  2Q07 A;  5M1A A;  1N8Q A;  1O7W B;  1YIJ 3;  1FGM A;  1OH0 A;  1ZX2 A;  3FGY A;  1STD A;  3VSE A;  3MHE A;  1RLS A;  2HMM B;  1EEJ A;  3UL5 A;  1YJ9 3;  1GSP A;  2FGT A;  1QAF A;  2JQ5 A;  2M7O A;  3EN1 B;  4KFE A;  5AEW B;  1EQK A;  3OV4 A;  2OOV C;  5IEO A;  3EB8 A;  1BRJ A;  1VZZ A;  4FCJ A;  1G02 A;  1NU3 A;  5HGR A;  1BSB A;  4WFO A;  3CCE 3;  1LVN A;  1YIT 3;  1CEW I;  3QK9 A;  2RFR A;  1RKY A;  2XFT A;  3EBT A;  3MYT A;  3JUM A;  2PZV A;  2WO0 A;  3C0K A;  4MMX B;  3AMO B;  1JN5 A;  2INX A;  5AIF A;  2AB4 A;  2CWU A;  1JBR A;  1K9M 4;  3V99 A;  2CIU A;  4H61 A;  2GBX B;  3IPT A;  3CD6 3;  1I2F A;  3EQQ B;  3F8X A;  1GMP A;  3CNX A;  1RDS A;  1OAC A;  3NV0 A;  3JUN A;  3DXO A;  3BLZ A;  2OQE A;  3D4A A;  6RNT A;  4R80 A;  3JUO A;  2H0I A;  2OWP A;  5BU4 A;  3S28 A;  2OTL 3;  3G6E 3;  2F4Y A;  3D79 A;  2L1S A;  1VQQ A;  3PZW A;  4LEH A;  4XBX A;  3G16 A;  1BAO A;  1TP6 A;  3ZV0 C;  1UCJ A;  4HM7 B;  3WMD A;  4CCV A;  4O3V A;  4XB5 A;  3SX1 A;  2WOF A;  1ISK A;  4XM4 A;  1RN4 A;  1I3F A;  4I4K A;  2CFW A;  2W9P A;  1IVV A;  4OUQ A;  4CDL A;  3BB9 A;  1NDO B;  1T2H A;  1SAR A;  2GU3 A;  3CC4 3;  1JBS A;  2E2U A;  2E2V A;  2Z6B A;  1Z1S A;  1ZE1 A;  4BTX A;  1SQW A;  1X1W A;  5M19 A;  4OK0 A;  3MPH A;  1YHQ 3;  3LWP A;  3PCS A;  4HM2 B;  2Z0T A;  2RSX A;  2LYX A;  1K8W A;  4DMG A;  1GOU A;  3K63 A;  1JV2 B;  2P09 A;  3K7C A;  3KSP A;  1IYY A;  2RCD A;  3K5T A;  3SOA A;  3CCR 3;  2KXG A;  2HVY A;  3OXA A;  2K54 A;  5ELU A;  2F99 A;  5BIR A;  4HZB B;  1TU5 A;  1KQS 2;  4WP5 A;  2J5V A;  3LTD A;  5IEP A;  1EKM A;  4ORL A;  7RNT A;  1OHO A;  3CPO A;  3NBJ A;  1G0T A;  1R3E A;  1VQL 3;  2CWT A;  1ASK A;  4KZ1 A;  1W6Y A;  1O7P B;  3U1W A;  5IG5 A;  2MC8 A;  1QMA A;  1OHP A;  3RNT A;  2B24 B;  2O9U X;  3CCL 3;  1OF5 B;  1TTO A;  1LRA A;  3DY5 A;  1YGE A;  1CYV A;  1FUT A;  3SED A;  1YJW 3;  3DUK A;  2XSO B;  3DH2 A;  1GY7 A;  3MQK A;  1D6Z A;  2Z7A A;  3PYJ A;  4WYK B;  5AIH A;  3S29 A;  3OX9 A;  1UGI A;  3EJV A;  5A0O B;  1IK3 A;  1ZBO A;  3MSO A;  2WGQ A;  4FR9 A;  1LNH A;  2CC3 A;  3DGN A;  2QIY A;  1RGE A;  1S72 3;  1JB4 A;  3LH4 A;  1L5G B;  2KAA A;  3K0Z A;  3RDE A;  3GZX B;  1VQN 3;  2B1X B;  4HVN A;  1YGW A;  1LNI A;  1UUW B;  5CXO A;  3DGL A;  1VQO 3;  1WMN A;  3Q3F A;  3M4X A;  3WOD G;  1BNG A;  2AAD A;  2CFL A;  3ZFZ A;  1WXX A;  4FMC A;  1MGW A;  1JZO A;  2HOH A;  3LJC A;  5AI1 A;  1A2P A;  4LMI A;  4EW5 A;  3VF1 A;  1IQY A;  4L7K A;  1RGK A;  1TIJ A;  3D5I A;  3Q1C A;  1ULI B;  2IYJ A;  3FF2 A;  1BRG A;  1TJD A;  2SAR A;  4G1M B;  4IIA A;  2ZA4 A;  1YNV X;  4LZI A;  4N6O B;  1YJN 3;  2FNQ A;  1O7H B;  2RFK A;  1M1K 4;  2A15 A;  4IPB A;  1RRH A;  3CNM A;  1Q81 4;  1B2M A;  1K41 A;  1WXW A;  1NB5 I;  4R1K A;  1A2V A;  3MG3 A;  1QAK A;  2H0G A;  3DGM A;  1HKX A;  1VQ9 3;  3U97 A;  1RHL A;  2CFD A;  5AIG A;  1IQ8 A;  4DKI A;  2IA7 A;  3D9R A;  4HZ9 B;  3JUQ A;  3WR2 A;  5CF2 A;  2CHC A;  1K73 4;  1KSI A;  3NM2 A;  1CQS A;  3FZW A;  1W4N A;  1F8N A;  3G4S 3;  2E5O A;  1MWS A;  1KC8 4;  1K28 A;  3ALA A;  3BNC A;  1M9G A;  3DM8 A;  3CC7 3;  1GD3 A;  1GY6 A;  1TFK A;  1X1U A;  2RGQ A;  3MKI A;  3WHO A;  1DET A;  1RN1 A;  2LQV A;  1RRL A;  1LQM B;  2QGU A;  1GS3 A;  3UJM A;  3I55 3;  3WA3 A;  1U8C B;  4WHA A;  1HYF A;  2W56 A;  1Q40 B;  1O7M B;  2STD A;  3G8Z A;  3VGN A;  2CX1 A;  3A76 A;  1C7H A;  4XBT A;  1S5A A;  1JKG A;  2XF3 A;  3WA2 X;  3ROB A;  1TUH A;  2UX0 A;  1GMR A;  3LTB A;  2DP9 A;  3PGB A;  2P0M A;  1EG9 B;  1BSD A;  4J8T A;  2OOV A;  1DVC A;  2BNG A;  3B4P A;  3URP A;  4EXR A;  1O7N B;  5KP1 A;  4L8P A;  3FH1 A;  1WMP A;  2QEX 3;  2CG0 A;  2AUS A;  4CI3 B;  1VQM 3;  1DMM A;  4EC6 A;  1I2E A;  3UL6 A;  2YFL B;  3BND A;  3D5G A;  3LWO A;  3EC9 A;  3GRD A;  1W2B 2;  2B78 A;  3KFQ C;  1I0X A;  1VQ5 3;  1BNI A;  2CWV A;  3LTC A;  3KII A;  1RGA A;  3PXM A;  3CCS 3;  2KF3 A;  3CCJ 3;  3AMO A;  3GSP A;  3NX0 A;  4TZ4 C;  2V1L A;  4GB5 A;  1UI7 A;  3KSE D;  5KP4 A;  2KKU A;  1ZGX A;  1ULJ B;  2HMK B;  3I0Y A;  1ZO2 A;  1N9J A;  3I56 3;  2W03 A;  4H3U A;  2P38 A;  2KCD A;  2IY2 A;  1QVG 2;  4O2H A;  3U28 A;  2CG1 A;  3X3X A;  5M18 A;  1ZE2 A;  3Q2P A;  4R9K A;  3RGR A;  2CFG A;  1JZD A;  3NV0 B;  4RZM A;  3AGO A;  1UCL A;  1I70 A;  3UB1 A;  1NB3 I;  3LML A;  3LDF A;  1UOY A;  1O7G B;  2XGN A;  3GZB A;  2XH9 A;  2YFI B;  3LZA A;  1GD4 A;  3UNL A;  1JBT A;  3NXJ A;  3LT8 A;  2BIR A;  2F86 B;  3OW2 2;  3IUW A;  2ZDJ A;  1HU9 A;  4HOH A;  3HJY A;  1BNE A;  1IVX A;  1FGO A;  1EA2 A;  4N6M A;  3K9M C;  1A67 A;  1Q42 A;  4N6T A;  1IDP A;  4FMB A;  3SLU A;  1HZ1 A;  3CCU 3;  4HM8 B;  2W9Q A;  3F7X A;  5AII A;  1BOX A;  3M8C A;  1BGS A;  2BT3 A;  1GY5 A;  3LWR A;  1NWW A;  1RGC A;  1FYS A;  3MG1 A;  1FUS A;  1RSN A;  3FF0 A;  3N54 B;  1W01 A;  2FRX A;  3FSD A;  1R4Y A;  1V74 A;  3V98 A;  1BNS A;  4JF8 A;  5CLK A;  3DGY A;  4J9A A;  2K3D A;  3NQY A;  1RJO A;  1SPU A;  5JPU A;  4N6V 0;  1NJI 4;  3CPW 2;  1Y4K A;  3HI7 A;  3NM7 A;  3X42 A;  8CHO A;  4HM0 B;  1QJG A;  5FGO A;  1E3R A;  7GSP A;  1PU4 A;  3OWY A;  5GSP A;  5LC6 A;  1E3V A;  5DRV A;  4N6N B;  2APO A;  3T0U A;  3T8U A;  2FXT A;  1Q82 4;  1IU7 A;  1VQ4 3;  1D6U A;  3ECF A;  1FGQ A;  1NO3 A;  2ZHX B;  4WYK A;  4XBY A;  4CI2 B;  3NBR A;  2F56 A;  4WWU C;  2CKF B;  3CME 3;  1BNR A;  3B4O A;  3LYG A;  1B2X A;  5LC7 A;  4K90 B;  3H3H A;  2J8X B;  3PS8 A;  3IMA B;  5G1L A;  1G96 A;  1BIR A;  1BAN A;  1U5O A;  2W6J H;  2ML5 A;  1BRS A;  3B8L A;  1DMQ A;  4O8S A;  3LXU X;  4R4K A;  1N5H A;  3X41 A;  1V57 A;  2IUK A;  1A2K A;  3AHW A;  4BIR A;  2R41 A;  2XEP A;  1RGF A;  3BNE A;  3Q90 A;  3NUV A;  1WTH A;  1STF I;  1ZL3 A;  3L0R A;  1UDI I;  4HYZ A;  3M65 A;  1MWU A;  3HAX A;  3E99 A;  5D81 A;  3HZP A;  5D82 A;  1GOY A;  4BTW A;  4EV2 A;  5D83 A;  1US1 A;  1YVB I;  3F9S A;  4KT3 B;  3B7C A;  8RNT A;  1PYL A;  3S27 A;  5IW9 A;  3F8H A;  4JRF A;  2BMO B;  4FCM A;  4O02 B;  4AEQ A;  2GU1 A;  1BNF A;  4Q53 A;  1CYU A;  4ZM8 A;  1N5P A;  1OGX A;  2WGO A;  4QWT A;  1VQ8 3;  1RGG A;  1AVL A;  4N6U A;  3HIG A;  2OTJ 3;  4EBG A;  3GZY B;  1K8A 4;  1I2G A;  4HM5 B;  3A5E A;  5BXQ A;  1BUJ A;  1AY7 A;  1ROV A;  2D1W A;  1LOV A;  3HJW A;  3PCR A;  3N9H A;  3RGA A;  1VQ7 3;  1OGZ A;  2UGI A;  2L4V A;  1Q7Y 4;  4BL2 A;  3HX8 A;  4HKV B;  1T3B A;  3FKA A;  3F7S A;  4HM3 B;  3J7Y d;  1LQG C;  4EYC A;  4CJN A;  4PEJ A;  4NHF A;  1ZS7 A;  5CK6 A;  3ZG0 A;  3LWV A;  2GXF A;  3EE1 A;  3SXX A;  4STD A;  7STD A;  1Q40 A;  3VSY A;  1MOL A;  4HAA A;  2IMJ A;  2KF5 A;  5BVB A;  4K1V A;  2BMQ B;  2F5M A;  4N3V A;  3N8B A;  1KWI A;  1CH0 A;  3GWR A;  1DE3 A;  1LOW A;  1W5Z A;  3IJE B;  6STD A;  4BTY A;  2I9W A;  3JVC A;  9RNT A;  2Z76 A;  1MWR A;  3CU3 A;  3GAX A;  2W56 B;  4FMD A;  3SYU A;  2W0Q A;  4MJD A;  2D42 A;  1M90 4;  5IG4 A;  3CXC 2;  1BSC A;  1AVK A;  1C54 A;  1M1X B;  1JKG B;  2EY4 A;  2P05 A;  1EUI C;  1AQZ A;  2CX0 A;  3CMA 3;  1AV4 A;  2YX9 A;  5JBS A;  4NPB A;  3QRD A;  1VQK 3;  3HII A;  4OVM A;  1JJ2 2;  2WOH A;  1B20 A;  1I0V A;  4LGQ A;  1QVF 2;  3FCS B;  4EV5 A;  3T8N A;  1BU4 A;  1JN5 B;  1VQ6 3;  2HMN B;  2P0X A;  2C10 A;  2BMR B;  2CFK A;  4KFF A;  1T2I A;  3JUP A;  3MG2 A;  1AR0 A;  4HJL B;  1BRK A;  3EX9 A;  1UCI A;  1BUQ A;  1GYB A;  3G0K A;  3FG4 A;  3DMC A;  3NQZ A;  2CK3 H;  1R3F A;  1QAL A;  1R4C A;  2OQE C;  1D6Y A;  3BIR A;  3KN4 A;  5EQL A;  3CC2 3;  3LTA A;  1JB2 A;  3AGN A;  1LXE A;  3LWQ A;  2W2C A;  5G2G A;  2CW9 A;  4XDV A;  1UUG B;  1I8V A;  1S04 A;  1UW1 A;  3LT9 A;  2PNC A;  2BO9 B;  4RNZ A;  1MNL A;  4GHO A;  3UAI A;  3FG3 A;  3DGO A;  3HOH A;  4BU4 A;  2O3O A;  5G1K A;  1IVU A;  1W6C A;  2Y74 A;  4AKZ A;  5IEN A;  1X1X A;  2J5T A;  1TRQ A;  2AAE A;  3DZL A;  4R9L A;  3F40 A;  2OCT A;  1IT8 A;  3BU4 A;  2C4B A;  2Z77 A;  4FCZ A;  2UUG C;  4Q1T A;  4KFD A;  4IT7 A;  4MMY B;  3D3L A;  5TGN A;  2QA4 3;  3KE7 A;  1B2U A;  1OHS A;  1UGH I;  3WDG B;  3EN8 A;  2XFS A;  2BU4 A;  1LOX A;  1WNH A;  1B2S A;  1W2Z A;  1W7C A;  5IG3 A;  1DVD A;  1B2Z A;  2XSH B;  1FUW A;  1OF5 A;  4HBR A;  5KP3 A;  1Q86 4;  2HML B;  1RMS A;  1FGR A;  4MMZ B;  4CI1 B; 
#chains in the Genus database with same CATH homology
 2CX0 A;  1K8W A;  1WXW A;  2AS0 A;  2CX1 A;  3UAI A;  4DMG A;  1ZS7 A;  3D79 A;  1J2B A;  2P38 A;  1IT7 A;  2J5T A;  2J5V A;  1IT8 A;  1IQ8 A;  1WXX A;  1R3E A;  1ZE2 A;  4Q1T A;  3C0K A;  1T5Y A;  3LDF A;  2AB4 A;  1R3F A;  2B78 A;  1Q7H A;  1ZE1 A;  2Q07 A;  1SQW A;  2CWW A;  1ZL3 A;  3VSE A;  1SGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...