3D79A

Crystal structure of hypothetical protein ph0734.1 from hyperthermophilic archaea pyrococcus horikoshii ot3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
167
structure length
167
Chain Sequence
IKHPLSKKDVKEIIAQLSQMFGEEIARKMLNKKDEVKVAEFDKTTEIILVNDKPMFIRRKDLIFPLVIALYNLSDEEDLRKWPRRVVVDEGAVPHILNGADVMAPGIVDADEGIKEGDFVFVVEEKYGRPLAIGIALMSGKVMKEKNRGKAVKVIHHARDKIWEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein PH0734.1 from hyperthermophilic archaea Pyrococcus horikoshii OT3.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Unknown function
molecule keywords Putative uncharacterized protein PH0734
total genus 45
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF17832 Pre-PUA Pre-PUA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 3d79A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 3d79A01
2J5VA 3VSEA 1ZL3A 1WXWA 1WXXA 3UAIA 1SQWA 2CWWA 3C0KA 1IT8A 2CX1A 1IT7A 1ZS7A 1ZE1A 3D79A 2P38A 2CX0A 2AS0A 4Q1TA 2Q07A 2AB4A 2B78A 1J2BA 1K8WA 1Q7HA 1SGVA 1IQ8A 3LDFA 4DMGA 1ZE2A 2J5TA 1R3EA 1R3FA 1T5YA
chains in the Genus database with same CATH superfamily
5CK6A 4KFFA 5LC7A 1JZDA 2BMOB 1QJGA 5LC6A 3M6VA 4XM4A 1UCKA 2W9PA 3ROBA 1Y4KA 3FG3A 3GZRA 3NX0A 4L8OA 1OCVA 1TE7A 1Q824 2E2TA 3FH1A 3LWQA 3Q90A 2IA7A 4WWUC 1BSDA 3HX8A 2FXTA 1LOXA 1NDOB 4TZ4C 2W03A 5IG5A 3UL5A 2BIRA 1GYBA 3F8HA 2GBXB 1W6GA 2ZDJA 1C7HA 3OWSA 1N5PA 3MKIA 1QVG2 1AVLA 3JVCA 3AMOA 3NQYA 1M9GA 3ZFZA 2Z6BA 3JUMA 4JRFA 2KF4A 3F40A 3OV4A 2CIUA 3WR2A 5IEPA 1KC84 4FCZA 2Z0TA 2HMNB 1WXWA 3ZG0A 2KKUA 1UUGB 2PZVA 3HI7A 4R9LA 4J9AA 3AMOB 4KZ1A 2H0GA 4WP5A 7STDA 1VQM3 1M1XB 1SARA 2UX0A 4N6V0 1VQP3 1W2ZA 3EBTA 1Q9EA 3NV0B 1WMPA 3T8UA 1EUIC 1O7MB 1B3SA 2GXFA 3A76A 3CCQ3 1YJ93 4QWTA 1GSPA 3M8CA 5EQLA 1Z1SA 5BU4A 4N6UA 3LTCA 1IDPA 2KAAA 1GOUA 3LYGA 3D4AA 3G0KA 1RGCA 4BIRA 1N5HA 2BMRB 4IIAA 4J5GA 5IEOA 3KCHA 5JBSA 3BLZA 3AHWA 4FCMA 1B2UA 1R3FA 1LVNA 3KFQC 1DVCA 1RGFA 4R1KA 1IVVA 3TDGA 1YI23 2OCTA 3VSEA 2SARA 4I5QA 4N6NB 4J5KA 1O7WB 3UAIA 2L4VA 5EVHA 3I553 1Q7Y4 4RNYA 3FF2A 3S27A 3X3ZA 1BIRA 1A2PA 4HM4B 2F56A 2RFKA 3LH4A 2OTJ3 3L0RA 4EC6A 2QA43 2M7OA 4HJLB 1UW1A 4HVNA 1BSCA 4XB5A 2AUSA 1TFOA 4ILFA 3S29A 1I3FA 3LXUX 5IERA 4NHFA 5KP1A 2P0MA 1LQGC 3DGNA 1RGHA 1OGXA 2B1XB 1FGRA 3K63A 1W6YA 1CQSA 3LT9A 4DKIA 1NO3A 2MC8A 1ULIB 4BL3A 3CC73 5TGNA 1FGMA 1DMNA 6STDA 3CNXA 1YIJ3 3RNTA 4MMXB 2GBWB 1UDII 3F7SA 1W4NA 3VGNA 2W56B 2L1SA 4CDLA 8CHOA 2XFSA 3HZPA 1ASKA 1IT8A 3O8YA 1KSIA 2ML6A 4N6MA 4PEJA 1JBTA 1TUHA 3CCM3 1BUQA 4L8PA 4X2HA 3FF0A 4AEQA 5IG4A 1RGAA 1KQS2 1B2ZA 1UGIA 5KP4A 2B78A 2K3DA 2OQEC 1O7NB 8RNTA 1IK3A 1NB5I 1PYLA 2XF3A 3CNMA 3NBBA 1MGRA 2O3OA 1ZBOA 4G1MB 1O7PB 3LDFA 2HMJB 3FKAA 3WMDA 1CH0A 7RNTA 2J5TA 7GSPA 2ML5A 5ELJA 5AYSC 2UUGC 3EE1A 4HOHA 1LOVA 3X40A 1I2EA 4K61A 3ZG5A 1OHPA 3CC43 2XGLA 1RMSA 2F4YA 2RBIA 2YFIB 3AHSA 3C0KA 1JB5A 2I9WA 2LYXA 2CFGA 3PGBA 4RNZA 1K8A4 4KFEA 1ZE1A 4LMIA 4LYLB 1RN7A 2F86B 3T0UA 3CMA3 2KCDA 2P38A 3MSOA 1FGTA 2XSHB 1A2KA 3GRDA 3STDA 3V98A 3LZAA 1J2BA 4CI2B 1RRHA 1B20A 1VQO3 3K7CA 4JF8A 2W56A 2XSOB 1BU4A 3M4XA 1OH0A 3HOHA 3BNBA 3PS8A 1DYUA 1YVSA 2C10A 2FRXA 3MG1A 3EF8A 4KT3B 1EG9B 3RGRA 3FZWA 1BRSA 2WGQA 1TJDA 4N6LA 1O7GB 2HMMB 2V1LA 2HMOB 5IG3A 3EN1B 3S28A 1SQWA 1G0TA 3LMLA 3EX9A 2DP9A 5FGOA 3FSDA 2CX1A 1N9EA 3PCSA 1GMRA 3U97A 1UCIA 1LQMB 2QGUA 4HM1B 1T2IA 1DMMA 1OF5A 2CK3H 4XBXA 2IUKA 5CXOA 1K9M4 6GSPA 3G713 2W6JH 4WYKB 3DGYA 1T3BA 1Q7HA 3I0YA 3IJEB 3IUWA 1BUJA 1UUWB 1B2SA 1YNVX 2JQ5A 2A15A 3ER7A 3MG2A 4R9KA 1VQK3 2OTL3 1BSAA 4HKVB 2RCDA 3X3YA 3G4S3 1RGEA 3SX1A 5BIRA 2XGNA 1X1UA 4IPBA 5D83A 3DH2A 1VZZA 1I2GA 2GSPA 1JBRA 1EQKA 1FYSA 4STDA 3CCS3 4BTWA 3HAXA 1RCKA 5JPUA 1V58A 1ZX2A 3GWRA 1WK2A 2EY4A 1BRHA 3ZV0C 1T2HA 3N9HA 4AKZA 1VQN3 5AIIA 1YIT3 3KSED 1IVUA 1YVBI 2CG1A 1VQ93 1UOYA 4GL6A 1BRNL 1B2MA 3MQKA 3NBRA 4H61A 4CCVA 4DMGA 1U8CB 3NM7A 2XFTA 3GSPA 3Q2PA 3JUQA 1YJN3 4LZIA 3LWVA 5KP3A 4EV2A 4O8SA 2E2UA 1HU9A 2C4BA 2CWTA 2UGIA 4EBGA 3BU4A 3DUKA 3QRDA 3H3HA 4BTYA 1AQZA 1TRPA 2FGTA 1GY6A 1OGZA 1SPUA 1AY7A 4RBNA 1SJWA 5JPPA 5D81A 1IQYA 3FG4A 1GOVA 3D5IA 3S5CA 1BGSA 1QVF2 3OX9A 1AR0A 1F8NA 2RGQA 2W9QA 3FCSB 4CPKA 3M6UA 1BNSA 1RRLA 2YFLB 2CG0A 2RFRA 1D6ZA 3BNCA 4BL2A 3CCR3 1K8WA 1W5ZA 3LWOA 1WMNA 3DGOA 3DXOA 3PCRA 1LNIA 1IQXA 2CH9A 1ZO2A 1YHQ3 1YGWA 4HM8B 3VSYA 5IF6A 1DE3A 1T5YA 3CPW2 1BRJA 3BIRA 1US1A 2GU1A 2CWUA 2WO0A 1JRQA 2B24B 5FW5A 1BAOA 1S04A 4OUQA 1STDA 5EEOA 4HM7B 4R80A 3E99A 1B27A 3F14A 4HM6B 5AIGA 3KKGA 3BNDA 1ISKA 6RNTA 3SYUA 1SIIA 3N54B 1BNGA 1D6YA 2APOA 1EKMA 1PY3A 2W2CA 3DMCA 1Q864 1OPYA 2CWVA 3CME3 2WOFA 1JJ22 1K41A 1JZOA 1WNHA 3NHXA 2SBLA 3FG1A 4N6TA 3U1WA 4HM2B 5IW9A 3MWZA 2CC3A 3NBJA 1IVWA 1JV2B 1QAFA 1GY5A 1TRQA 4OK0A 4OVMA 2Y74A 1GD3A 3EHCA 2H0IA 1N8QA 3LT8A 1IV9A 2LQVA 4FMBA 3RDEA 4CJNA 1FGQA 1WTHA 3ECFA 3NV0A 2XRXB 4LSOA 1ZL3A 4FMCA 2F99A 2K54A 1GMQA 2OOVC 3EBYA 1EEJA 1VQQA 3KZTA 4MMZB 1K28A 4K1UA 4BTXA 1RNBA 4XBTA 3HJWA 1MOLA 3WODG 1IT7A 3DGMA 4K90B 5AEUB 2BU4A 1IVXA 3EJVA 1RN4A 3NXJA 4KFDA 2KF5A 4EXRA 2INXA 3H51A 1JNQA 2QEX3 1W2B2 2CX0A 1R4CA 5RNTA 4Q1TA 1RLSA 2Q07A 2Y73A 3GZYB 3JUNA 1HZ1A 3OWYA 3F8XA 5AIFA 4N3VA 3X3XA 2GU3A 1SIHA 3K5TA 3EQQB 1S5AA 1X1XA 3MPHA 1I2FA 1FUWA 1JB2A 1VQL3 3CCU3 4XDWA 3KSPA 3D5GA 3I563 1DVDA 3SOYA 1TIJA 1GS3A 1BRKA 2KF6A 1BNIA 1FUSA 1I0VA 3CPOA 3PXMA 1S723 2OOVA 1UCJA 4NPBA 1I8VA 2ZA4A 3FLJA 3KN4A 1DETA 1GY7A 1IU7A 3LOYA 3Q3FA 1I3IA 5HGRA 3UB1A 1VQ53 4MJDA 1ZGXA 2AS0A 1RSNA 3BNEA 1K734 1BSEA 3OXAA 5ELUA 1CYUA 1YGEA 1FZUA 1QMAA 3KE7A 2BNGA 2KXGA 2R4IA 3B7CA 1IQ8A 3K9MC 4Q53A 2J8XB 3PZWA 1ZE2A 1LRAA 2KRTA 2OWPA 2IYJA 1FA3A 4L7KA 5A0OB 1CEWI 3HJYA 2Z77A 3IMAB 1D6UA 1WMOA 4HAAA 2BHMA 1QALA 1HYFA 1ULJB 3U28A 1V74A 4HM0B 4HM3B 2IUJA 3UL6A 4U13A 1MWTA 1TP6A 4N6OB 1IYYA 5BVBA 1BNRA 1RDSA 4ORLA 1MWUA 2RNTA 1BOXA 3G16A 1RHLA 4TX4A 3D79A 1KWIA 2H0HA 5BXQA 1VQ73 3G6E3 1W02A 2ANEA 2ZHXB 1GMPA 5D82A 3CC23 1RGLA 1LNHA 1BANA 4WFOA 2MF7A 5IG0A 3CCV3 2GEYA 5M1AA 1I0XA 1Q40B 1BRIA 1AVKA 1CYVA 2D42A 2JDIH 2HOHA 3A5EA 3EN8A 3NQZA 1LOWA 3B4PA 4X2OA 2HMKB 1OHOA 1W7CA 1OHSA 2F98A 3HIIA 3LTBA 5AIHA 1BNJA 2RSXA 2W04A 4R4KA 3T8NA 1IV7A 3WHOA 2IMJA 1VQ43 2WGOA 1U5OA 1TFKA 4FMDA 2F5WA 4MMYB 1QAKA 2CFWA 2KF3A 4HZ9B 5CLKA 3GZBA 2E2VA 4O3VA 1JN5A 1OACA 4WHAA 1FGOA 2W0QA 3SXXA 3LTAA 5AYRB 2AADA 3CCL3 2HMLB 3WOFB 5G1LA 3M6XA 3MYTA 3UJMA 1BSBA 1BVIA 4NREA 1UI7A 3MHEA 1AV4A 1O7HB 1RN1A 4MEIA 1STFI 1M1K4 1VQ83 1VQ63 1NU3A 1Q42A 2BT3A 2CFLA 2GEXA 2CHCA 1L5GB 3LWPA 3CXC2 3JUPA 3PYJA 2BO9B 3WDGB 3B8LA 3IPTA 3DM8A 2AAEA 1X1YA 1BRGA 1MWRA 3EB8A 1SGVA 2XH9A 5CF1A 1RKYA 3EC9A 4AKYA 3NM2A 1N8R4 2O9UX 4BU4A 5AI1A 1JN5B 3M65A 2XEPA 3NUVA 3CU3A 2Z76A 2D1WA 5DREA 4HYZA 1NNVA 3OW22 4EW5A 1UCLA 4IT7A 5STDA 2F5MA 2C11A 1JKGB 4LGQA 4CI1B 1DMQA 1RNTA 1MNLA 3B4OA 1ZS7A 1UUVB 1A67A 1UGHI 3G8ZA 1M904 2IY2A 5GSPA 3DGLA 4RZMA 3N8BA 1RTUA 3KIIA 2FNQA 3GAXA 1NB3I 2XR8B 2E5OA 5IENA 2WOHA 1W01A 1BNFA 3CCE3 1W6CA 3LWRA 2CKFB 1E3VA 3F7XA 5AEWB 4FR9A 4HZBB 1R4YA 3S67A 1RGKA 4HM5B 1R3EA 1BNEA 5M18A 4K1VA 1I70A 1OF5B 4O02B 2CFKA 4J8TA 1NJI4 2ZL8A 3HIGA 2K0MA 5HOHA 3J7Yd 5CF2A 1X1WA 3URPA 3ALAA 1MWSA 1XNEA 1FUTA 1G02A 3OWUA 4ZM8A 3LJCA 2CFDA 1E3RA 3RGAA 1GD4A 1GOYA 2HVYA 4LEHA 3SEDA 5DRVA 2AB4A 2P0XA 1W00A 5I97A 1JKGA 3HK4A 3FGYA 4O2HA 3X42A 3X41A 1EA2A 3GZXB 1TU5A 3WA2X 4GHOA 3CD63 5M19A 1JB4A 3SVAA 1HKXA 3MG3A 1N9JA 1A2VA 1G96A 2QIYA 3Q1CA 2YFJB 3SLUA 1RGGA 3UNLA 3V99A 3WOEB 3AGOA 3DZLA 1PU4A 2CW9A 3LTDA 2J5VA 1WQLB 2BMQB 2R41A 1KD14 4XDVA 3WA3A 5G1KA 4I4KA 1WXXA 3JUOA 3SOAA 3D9RA 2CWWA 4FMAA 1Q40A 2YX9A 5G2GA 3V92A 4H3UA 1JBSA 9RNTA 1NWWA 2P09A 1YJW3 3AGNA 4WYKA 1FW7A 2PNCA 1LXEA 4KVHA 1MGWA 1RCLA 1LOYA 4EV5A 3F9SA 1RJOA 2OQEA 1UI8A 1TTOA 2P05A 4RNTA 1ROVA 3QK9A 1C54A 1B21A 1A90A 2Z7AA 4GB5A 4GSPA 1V57A 3VF1A 3CCJ3 1PFPA 1B2XA 4CI3B 1E97A 2STDA 1OUNA 3D3LA 4HBRA 4XBYA 3M6WA 4FCJA 4EYCA 1Q814 1ROAA 3DY5A 3K0ZA 3BB9A
chains in the Genus database with same CATH topology
2J5VA 3VSEA 1ZL3A 1WXWA 1WXXA 3UAIA 1SQWA 2CWWA 3C0KA 1IT8A 2CX1A 1IT7A 1ZS7A 1ZE1A 3D79A 2P38A 2CX0A 2AS0A 4Q1TA 2Q07A 2AB4A 2B78A 1J2BA 1K8WA 1Q7HA 1SGVA 1IQ8A 3LDFA 4DMGA 1ZE2A 2J5TA 1R3EA 1R3FA 1T5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5V A;  3VSE A;  1ZL3 A;  1WXW A;  1WXX A;  3UAI A;  1SQW A;  2CWW A;  3C0K A;  1IT8 A;  2CX1 A;  1IT7 A;  1ZS7 A;  1ZE1 A;  3D79 A;  2P38 A;  2CX0 A;  2AS0 A;  4Q1T A;  2Q07 A;  2AB4 A;  2B78 A;  1J2B A;  1K8W A;  1Q7H A;  1SGV A;  1IQ8 A;  3LDF A;  4DMG A;  1ZE2 A;  2J5T A;  1R3E A;  1R3F A;  1T5Y A; 
#chains in the Genus database with same CATH topology
 5CK6 A;  4KFF A;  5LC7 A;  1JZD A;  2BMO B;  1QJG A;  5LC6 A;  3M6V A;  4XM4 A;  1UCK A;  2W9P A;  3ROB A;  1Y4K A;  3FG3 A;  3GZR A;  3NX0 A;  4L8O A;  1OCV A;  1TE7 A;  1Q82 4;  2E2T A;  3FH1 A;  3LWQ A;  3Q90 A;  2IA7 A;  4WWU C;  1BSD A;  3HX8 A;  2FXT A;  1LOX A;  1NDO B;  4TZ4 C;  2W03 A;  5IG5 A;  3UL5 A;  2BIR A;  1GYB A;  3F8H A;  2GBX B;  1W6G A;  2ZDJ A;  1C7H A;  3OWS A;  1N5P A;  3MKI A;  1QVG 2;  1AVL A;  3JVC A;  3AMO A;  3NQY A;  1M9G A;  3ZFZ A;  2Z6B A;  3JUM A;  4JRF A;  2KF4 A;  3F40 A;  3OV4 A;  2CIU A;  3WR2 A;  5IEP A;  1KC8 4;  4FCZ A;  2Z0T A;  2HMN B;  1WXW A;  3ZG0 A;  2KKU A;  1UUG B;  2PZV A;  3HI7 A;  4R9L A;  4J9A A;  3AMO B;  4KZ1 A;  2H0G A;  4WP5 A;  7STD A;  1VQM 3;  1M1X B;  1SAR A;  2UX0 A;  4N6V 0;  1VQP 3;  1W2Z A;  3EBT A;  1Q9E A;  3NV0 B;  1WMP A;  3T8U A;  1EUI C;  1O7M B;  1B3S A;  2GXF A;  3A76 A;  3CCQ 3;  1YJ9 3;  4QWT A;  1GSP A;  3M8C A;  5EQL A;  1Z1S A;  5BU4 A;  4N6U A;  3LTC A;  1IDP A;  2KAA A;  1GOU A;  3LYG A;  3D4A A;  3G0K A;  1RGC A;  4BIR A;  1N5H A;  2BMR B;  4IIA A;  4J5G A;  5IEO A;  3KCH A;  5JBS A;  3BLZ A;  3AHW A;  4FCM A;  1B2U A;  1R3F A;  1LVN A;  3KFQ C;  1DVC A;  1RGF A;  4R1K A;  1IVV A;  3TDG A;  1YI2 3;  2OCT A;  3VSE A;  2SAR A;  4I5Q A;  4N6N B;  4J5K A;  1O7W B;  3UAI A;  2L4V A;  5EVH A;  3I55 3;  1Q7Y 4;  4RNY A;  3FF2 A;  3S27 A;  3X3Z A;  1BIR A;  1A2P A;  4HM4 B;  2F56 A;  2RFK A;  3LH4 A;  2OTJ 3;  3L0R A;  4EC6 A;  2QA4 3;  2M7O A;  4HJL B;  1UW1 A;  4HVN A;  1BSC A;  4XB5 A;  2AUS A;  1TFO A;  4ILF A;  3S29 A;  1I3F A;  3LXU X;  5IER A;  4NHF A;  5KP1 A;  2P0M A;  1LQG C;  3DGN A;  1RGH A;  1OGX A;  2B1X B;  1FGR A;  3K63 A;  1W6Y A;  1CQS A;  3LT9 A;  4DKI A;  1NO3 A;  2MC8 A;  1ULI B;  4BL3 A;  3CC7 3;  5TGN A;  1FGM A;  1DMN A;  6STD A;  3CNX A;  1YIJ 3;  3RNT A;  4MMX B;  2GBW B;  1UDI I;  3F7S A;  1W4N A;  3VGN A;  2W56 B;  2L1S A;  4CDL A;  8CHO A;  2XFS A;  3HZP A;  1ASK A;  1IT8 A;  3O8Y A;  1KSI A;  2ML6 A;  4N6M A;  4PEJ A;  1JBT A;  1TUH A;  3CCM 3;  1BUQ A;  4L8P A;  4X2H A;  3FF0 A;  4AEQ A;  5IG4 A;  1RGA A;  1KQS 2;  1B2Z A;  1UGI A;  5KP4 A;  2B78 A;  2K3D A;  2OQE C;  1O7N B;  8RNT A;  1IK3 A;  1NB5 I;  1PYL A;  2XF3 A;  3CNM A;  3NBB A;  1MGR A;  2O3O A;  1ZBO A;  4G1M B;  1O7P B;  3LDF A;  2HMJ B;  3FKA A;  3WMD A;  1CH0 A;  7RNT A;  2J5T A;  7GSP A;  2ML5 A;  5ELJ A;  5AYS C;  2UUG C;  3EE1 A;  4HOH A;  1LOV A;  3X40 A;  1I2E A;  4K61 A;  3ZG5 A;  1OHP A;  3CC4 3;  2XGL A;  1RMS A;  2F4Y A;  2RBI A;  2YFI B;  3AHS A;  3C0K A;  1JB5 A;  2I9W A;  2LYX A;  2CFG A;  3PGB A;  4RNZ A;  1K8A 4;  4KFE A;  1ZE1 A;  4LMI A;  4LYL B;  1RN7 A;  2F86 B;  3T0U A;  3CMA 3;  2KCD A;  2P38 A;  3MSO A;  1FGT A;  2XSH B;  1A2K A;  3GRD A;  3STD A;  3V98 A;  3LZA A;  1J2B A;  4CI2 B;  1RRH A;  1B20 A;  1VQO 3;  3K7C A;  4JF8 A;  2W56 A;  2XSO B;  1BU4 A;  3M4X A;  1OH0 A;  3HOH A;  3BNB A;  3PS8 A;  1DYU A;  1YVS A;  2C10 A;  2FRX A;  3MG1 A;  3EF8 A;  4KT3 B;  1EG9 B;  3RGR A;  3FZW A;  1BRS A;  2WGQ A;  1TJD A;  4N6L A;  1O7G B;  2HMM B;  2V1L A;  2HMO B;  5IG3 A;  3EN1 B;  3S28 A;  1SQW A;  1G0T A;  3LML A;  3EX9 A;  2DP9 A;  5FGO A;  3FSD A;  2CX1 A;  1N9E A;  3PCS A;  1GMR A;  3U97 A;  1UCI A;  1LQM B;  2QGU A;  4HM1 B;  1T2I A;  1DMM A;  1OF5 A;  2CK3 H;  4XBX A;  2IUK A;  5CXO A;  1K9M 4;  6GSP A;  3G71 3;  2W6J H;  4WYK B;  3DGY A;  1T3B A;  1Q7H A;  3I0Y A;  3IJE B;  3IUW A;  1BUJ A;  1UUW B;  1B2S A;  1YNV X;  2JQ5 A;  2A15 A;  3ER7 A;  3MG2 A;  4R9K A;  1VQK 3;  2OTL 3;  1BSA A;  4HKV B;  2RCD A;  3X3Y A;  3G4S 3;  1RGE A;  3SX1 A;  5BIR A;  2XGN A;  1X1U A;  4IPB A;  5D83 A;  3DH2 A;  1VZZ A;  1I2G A;  2GSP A;  1JBR A;  1EQK A;  1FYS A;  4STD A;  3CCS 3;  4BTW A;  3HAX A;  1RCK A;  5JPU A;  1V58 A;  1ZX2 A;  3GWR A;  1WK2 A;  2EY4 A;  1BRH A;  3ZV0 C;  1T2H A;  3N9H A;  4AKZ A;  1VQN 3;  5AII A;  1YIT 3;  3KSE D;  1IVU A;  1YVB I;  2CG1 A;  1VQ9 3;  1UOY A;  4GL6 A;  1BRN L;  1B2M A;  3MQK A;  3NBR A;  4H61 A;  4CCV A;  4DMG A;  1U8C B;  3NM7 A;  2XFT A;  3GSP A;  3Q2P A;  3JUQ A;  1YJN 3;  4LZI A;  3LWV A;  5KP3 A;  4EV2 A;  4O8S A;  2E2U A;  1HU9 A;  2C4B A;  2CWT A;  2UGI A;  4EBG A;  3BU4 A;  3DUK A;  3QRD A;  3H3H A;  4BTY A;  1AQZ A;  1TRP A;  2FGT A;  1GY6 A;  1OGZ A;  1SPU A;  1AY7 A;  4RBN A;  1SJW A;  5JPP A;  5D81 A;  1IQY A;  3FG4 A;  1GOV A;  3D5I A;  3S5C A;  1BGS A;  1QVF 2;  3OX9 A;  1AR0 A;  1F8N A;  2RGQ A;  2W9Q A;  3FCS B;  4CPK A;  3M6U A;  1BNS A;  1RRL A;  2YFL B;  2CG0 A;  2RFR A;  1D6Z A;  3BNC A;  4BL2 A;  3CCR 3;  1K8W A;  1W5Z A;  3LWO A;  1WMN A;  3DGO A;  3DXO A;  3PCR A;  1LNI A;  1IQX A;  2CH9 A;  1ZO2 A;  1YHQ 3;  1YGW A;  4HM8 B;  3VSY A;  5IF6 A;  1DE3 A;  1T5Y A;  3CPW 2;  1BRJ A;  3BIR A;  1US1 A;  2GU1 A;  2CWU A;  2WO0 A;  1JRQ A;  2B24 B;  5FW5 A;  1BAO A;  1S04 A;  4OUQ A;  1STD A;  5EEO A;  4HM7 B;  4R80 A;  3E99 A;  1B27 A;  3F14 A;  4HM6 B;  5AIG A;  3KKG A;  3BND A;  1ISK A;  6RNT A;  3SYU A;  1SII A;  3N54 B;  1BNG A;  1D6Y A;  2APO A;  1EKM A;  1PY3 A;  2W2C A;  3DMC A;  1Q86 4;  1OPY A;  2CWV A;  3CME 3;  2WOF A;  1JJ2 2;  1K41 A;  1JZO A;  1WNH A;  3NHX A;  2SBL A;  3FG1 A;  4N6T A;  3U1W A;  4HM2 B;  5IW9 A;  3MWZ A;  2CC3 A;  3NBJ A;  1IVW A;  1JV2 B;  1QAF A;  1GY5 A;  1TRQ A;  4OK0 A;  4OVM A;  2Y74 A;  1GD3 A;  3EHC A;  2H0I A;  1N8Q A;  3LT8 A;  1IV9 A;  2LQV A;  4FMB A;  3RDE A;  4CJN A;  1FGQ A;  1WTH A;  3ECF A;  3NV0 A;  2XRX B;  4LSO A;  1ZL3 A;  4FMC A;  2F99 A;  2K54 A;  1GMQ A;  2OOV C;  3EBY A;  1EEJ A;  1VQQ A;  3KZT A;  4MMZ B;  1K28 A;  4K1U A;  4BTX A;  1RNB A;  4XBT A;  3HJW A;  1MOL A;  3WOD G;  1IT7 A;  3DGM A;  4K90 B;  5AEU B;  2BU4 A;  1IVX A;  3EJV A;  1RN4 A;  3NXJ A;  4KFD A;  2KF5 A;  4EXR A;  2INX A;  3H51 A;  1JNQ A;  2QEX 3;  1W2B 2;  2CX0 A;  1R4C A;  5RNT A;  4Q1T A;  1RLS A;  2Q07 A;  2Y73 A;  3GZY B;  3JUN A;  1HZ1 A;  3OWY A;  3F8X A;  5AIF A;  4N3V A;  3X3X A;  2GU3 A;  1SIH A;  3K5T A;  3EQQ B;  1S5A A;  1X1X A;  3MPH A;  1I2F A;  1FUW A;  1JB2 A;  1VQL 3;  3CCU 3;  4XDW A;  3KSP A;  3D5G A;  3I56 3;  1DVD A;  3SOY A;  1TIJ A;  1GS3 A;  1BRK A;  2KF6 A;  1BNI A;  1FUS A;  1I0V A;  3CPO A;  3PXM A;  1S72 3;  2OOV A;  1UCJ A;  4NPB A;  1I8V A;  2ZA4 A;  3FLJ A;  3KN4 A;  1DET A;  1GY7 A;  1IU7 A;  3LOY A;  3Q3F A;  1I3I A;  5HGR A;  3UB1 A;  1VQ5 3;  4MJD A;  1ZGX A;  2AS0 A;  1RSN A;  3BNE A;  1K73 4;  1BSE A;  3OXA A;  5ELU A;  1CYU A;  1YGE A;  1FZU A;  1QMA A;  3KE7 A;  2BNG A;  2KXG A;  2R4I A;  3B7C A;  1IQ8 A;  3K9M C;  4Q53 A;  2J8X B;  3PZW A;  1ZE2 A;  1LRA A;  2KRT A;  2OWP A;  2IYJ A;  1FA3 A;  4L7K A;  5A0O B;  1CEW I;  3HJY A;  2Z77 A;  3IMA B;  1D6U A;  1WMO A;  4HAA A;  2BHM A;  1QAL A;  1HYF A;  1ULJ B;  3U28 A;  1V74 A;  4HM0 B;  4HM3 B;  2IUJ A;  3UL6 A;  4U13 A;  1MWT A;  1TP6 A;  4N6O B;  1IYY A;  5BVB A;  1BNR A;  1RDS A;  4ORL A;  1MWU A;  2RNT A;  1BOX A;  3G16 A;  1RHL A;  4TX4 A;  3D79 A;  1KWI A;  2H0H A;  5BXQ A;  1VQ7 3;  3G6E 3;  1W02 A;  2ANE A;  2ZHX B;  1GMP A;  5D82 A;  3CC2 3;  1RGL A;  1LNH A;  1BAN A;  4WFO A;  2MF7 A;  5IG0 A;  3CCV 3;  2GEY A;  5M1A A;  1I0X A;  1Q40 B;  1BRI A;  1AVK A;  1CYV A;  2D42 A;  2JDI H;  2HOH A;  3A5E A;  3EN8 A;  3NQZ A;  1LOW A;  3B4P A;  4X2O A;  2HMK B;  1OHO A;  1W7C A;  1OHS A;  2F98 A;  3HII A;  3LTB A;  5AIH A;  1BNJ A;  2RSX A;  2W04 A;  4R4K A;  3T8N A;  1IV7 A;  3WHO A;  2IMJ A;  1VQ4 3;  2WGO A;  1U5O A;  1TFK A;  4FMD A;  2F5W A;  4MMY B;  1QAK A;  2CFW A;  2KF3 A;  4HZ9 B;  5CLK A;  3GZB A;  2E2V A;  4O3V A;  1JN5 A;  1OAC A;  4WHA A;  1FGO A;  2W0Q A;  3SXX A;  3LTA A;  5AYR B;  2AAD A;  3CCL 3;  2HML B;  3WOF B;  5G1L A;  3M6X A;  3MYT A;  3UJM A;  1BSB A;  1BVI A;  4NRE A;  1UI7 A;  3MHE A;  1AV4 A;  1O7H B;  1RN1 A;  4MEI A;  1STF I;  1M1K 4;  1VQ8 3;  1VQ6 3;  1NU3 A;  1Q42 A;  2BT3 A;  2CFL A;  2GEX A;  2CHC A;  1L5G B;  3LWP A;  3CXC 2;  3JUP A;  3PYJ A;  2BO9 B;  3WDG B;  3B8L A;  3IPT A;  3DM8 A;  2AAE A;  1X1Y A;  1BRG A;  1MWR A;  3EB8 A;  1SGV A;  2XH9 A;  5CF1 A;  1RKY A;  3EC9 A;  4AKY A;  3NM2 A;  1N8R 4;  2O9U X;  4BU4 A;  5AI1 A;  1JN5 B;  3M65 A;  2XEP A;  3NUV A;  3CU3 A;  2Z76 A;  2D1W A;  5DRE A;  4HYZ A;  1NNV A;  3OW2 2;  4EW5 A;  1UCL A;  4IT7 A;  5STD A;  2F5M A;  2C11 A;  1JKG B;  4LGQ A;  4CI1 B;  1DMQ A;  1RNT A;  1MNL A;  3B4O A;  1ZS7 A;  1UUV B;  1A67 A;  1UGH I;  3G8Z A;  1M90 4;  2IY2 A;  5GSP A;  3DGL A;  4RZM A;  3N8B A;  1RTU A;  3KII A;  2FNQ A;  3GAX A;  1NB3 I;  2XR8 B;  2E5O A;  5IEN A;  2WOH A;  1W01 A;  1BNF A;  3CCE 3;  1W6C A;  3LWR A;  2CKF B;  1E3V A;  3F7X A;  5AEW B;  4FR9 A;  4HZB B;  1R4Y A;  3S67 A;  1RGK A;  4HM5 B;  1R3E A;  1BNE A;  5M18 A;  4K1V A;  1I70 A;  1OF5 B;  4O02 B;  2CFK A;  4J8T A;  1NJI 4;  2ZL8 A;  3HIG A;  2K0M A;  5HOH A;  3J7Y d;  5CF2 A;  1X1W A;  3URP A;  3ALA A;  1MWS A;  1XNE A;  1FUT A;  1G02 A;  3OWU A;  4ZM8 A;  3LJC A;  2CFD A;  1E3R A;  3RGA A;  1GD4 A;  1GOY A;  2HVY A;  4LEH A;  3SED A;  5DRV A;  2AB4 A;  2P0X A;  1W00 A;  5I97 A;  1JKG A;  3HK4 A;  3FGY A;  4O2H A;  3X42 A;  3X41 A;  1EA2 A;  3GZX B;  1TU5 A;  3WA2 X;  4GHO A;  3CD6 3;  5M19 A;  1JB4 A;  3SVA A;  1HKX A;  3MG3 A;  1N9J A;  1A2V A;  1G96 A;  2QIY A;  3Q1C A;  2YFJ B;  3SLU A;  1RGG A;  3UNL A;  3V99 A;  3WOE B;  3AGO A;  3DZL A;  1PU4 A;  2CW9 A;  3LTD A;  2J5V A;  1WQL B;  2BMQ B;  2R41 A;  1KD1 4;  4XDV A;  3WA3 A;  5G1K A;  4I4K A;  1WXX A;  3JUO A;  3SOA A;  3D9R A;  2CWW A;  4FMA A;  1Q40 A;  2YX9 A;  5G2G A;  3V92 A;  4H3U A;  1JBS A;  9RNT A;  1NWW A;  2P09 A;  1YJW 3;  3AGN A;  4WYK A;  1FW7 A;  2PNC A;  1LXE A;  4KVH A;  1MGW A;  1RCL A;  1LOY A;  4EV5 A;  3F9S A;  1RJO A;  2OQE A;  1UI8 A;  1TTO A;  2P05 A;  4RNT A;  1ROV A;  3QK9 A;  1C54 A;  1B21 A;  1A90 A;  2Z7A A;  4GB5 A;  4GSP A;  1V57 A;  3VF1 A;  3CCJ 3;  1PFP A;  1B2X A;  4CI3 B;  1E97 A;  2STD A;  1OUN A;  3D3L A;  4HBR A;  4XBY A;  3M6W A;  4FCJ A;  4EYC A;  1Q81 4;  1ROA A;  3DY5 A;  3K0Z A;  3BB9 A; 
#chains in the Genus database with same CATH homology
 2J5V A;  3VSE A;  1ZL3 A;  1WXW A;  1WXX A;  3UAI A;  1SQW A;  2CWW A;  3C0K A;  1IT8 A;  2CX1 A;  1IT7 A;  1ZS7 A;  1ZE1 A;  3D79 A;  2P38 A;  2CX0 A;  2AS0 A;  4Q1T A;  2Q07 A;  2AB4 A;  2B78 A;  1J2B A;  1K8W A;  1Q7H A;  1SGV A;  1IQ8 A;  3LDF A;  4DMG A;  1ZE2 A;  2J5T A;  1R3E A;  1R3F A;  1T5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...