3D79A

Crystal structure of hypothetical protein ph0734.1 from hyperthermophilic archaea pyrococcus horikoshii ot3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
167
structure length
167
Chain Sequence
IKHPLSKKDVKEIIAQLSQMFGEEIARKMLNKKDEVKVAEFDKTTEIILVNDKPMFIRRKDLIFPLVIALYNLSDEEDLRKWPRRVVVDEGAVPHILNGADVMAPGIVDADEGIKEGDFVFVVEEKYGRPLAIGIALMSGKVMKEKNRGKAVKVIHHARDKIWEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0734
publication title Crystal structure of hypothetical protein PH0734.1 from hyperthermophilic archaea Pyrococcus horikoshii OT3.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Unknown function
total genus 45
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF17832 Pre-PUA Pre-PUA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 3d79A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 3d79A01
2AS0A 2J5VA 3D79A 2P38A 2J5TA 1R3FA 1T5YA 1Q7HA 1IT7A 1J2BA 1WXXA 1WXWA 1IQ8A 3LDFA 1ZL3A 1K8WA 1ZE1A 2AB4A 3VSEA 4DMGA 2B78A 1ZE2A 2CX1A 1SQWA 4Q1TA 1IT8A 2Q07A 1SGVA 1R3EA 2CX0A 3C0KA 1ZS7A 3UAIA 2CWWA
chains in the Genus database with same CATH superfamily
3EBYA 5IEOA 4N6UA 1LOXA 1JBTA 1B21A 4RBNA 2UX0A 1QAFA 4XBTA 1UCJA 1WTHA 1FGRA 4HM3B 3AGNA 4CJNA 3D9RA 3CPW2 3SOAA 4BL2A 3URPA 1O7NB 2W03A 1WXWA 1FA3A 2FRXA 3H3HA 3G713 3LWVA 5I97A 3K0ZA 5D83A 1RGGA 1BRKA 4HZ9B 3WOFB 2GBWB 1VQP3 3FSDA 1PFPA 3M65A 3DGYA 2IUJA 2APOA 1AR0A 2WOFA 1EQKA 3HK4A 3VGNA 2M7OA 6STDA 1YIJ3 1DMQA 1D6UA 2D42A 4HBRA 3NBRA 7STDA 2OTL3 1RGEA 1MWUA 1ROAA 1ZS7A 1GOVA 1I2GA 3FLJA 4J5KA 5BXQA 3ZG0A 2L4VA 2CFWA 3BU4A 3CNMA 1W6CA 1W2ZA 1OCVA 3GZYB 1Q7Y4 1NNVA 1I0VA 5LC7A 3FG1A 2K3DA 1AY7A 3FH1A 4HM4B 3OWYA 2IUKA 1NB5I 4KFEA 4HM1B 1K9M4 1M1K4 1RNTA 4N6V0 4CPKA 3BIRA 1B2XA 6RNTA 2B24B 1RCKA 4XB5A 1BNSA 1BSDA 4Q1TA 2H0HA 3EBTA 3NV0A 4MMYB 1VQ83 3HZPA 2WGOA 4N3VA 4BU4A 2RSXA 3F14A 1OUNA 3F8XA 3JVCA 3LTDA 3VF1A 1BGSA 3SLUA 1V74A 2CWUA 1JB2A 2IA7A 4FR9A 3EC9A 2W04A 2HOHA 1VQ53 1S5AA 4WYKB 1GMQA 1IDPA 5BIRA 2CIUA 1Z1SA 1YNVX 4HJLB 2BU4A 1MWSA 1V58A 2B1XB 2XH9A 3KSED 3AMOA 3V92A 3MPHA 3PCRA 4LZIA 1RGFA 3V98A 5IERA 3G4S3 1LQMB 3DMCA 4Q53A 2F5WA 3F40A 3N54B 1BVIA 1RSNA 2F4YA 2WOHA 2XR8B 3PGBA 2B78A 3Q1CA 3ECFA 1T2IA 3AHSA 3S67A 3STDA 4HM0B 3B8LA 1GMRA 1I2FA 2HMMB 3K5TA 4GSPA 5IG4A 2O3OA 1BU4A 5AIGA 1EEJA 1LOWA 3D3LA 1O7HB 1NWWA 3GWRA 1F8NA 1JKGA 4BTYA 3M6VA 1MOLA 2HMLB 2XSOB 3A5EA 3EN8A 1JB5A 1BUJA 2LQVA 5EEOA 1VQN3 5CXOA 1Q9EA 3CU3A 3SEDA 1IVXA 2F98A 1RLSA 1UW1A 2F5MA 4IIAA 1C54A 4K1UA 3FGYA 3KIIA 2MF7A 1ZGXA 1BRIA 2W6JH 1WMNA 3S28A 3DGOA 1JBSA 1QMAA 4HAAA 4FMCA 2MC8A 2IYJA 5BU4A 2RFKA 1NB3I 2W0QA 3S5CA 4QWTA 1TJDA 1TU5A 1N8R4 3HI7A 3NHXA 1IQXA 3BNCA 5TGNA 4AKYA 3LWPA 4I4KA 5EVHA 1BSEA 2C10A 2BMOB 5ELJA 3I563 1VQM3 1STFI 1U5OA 3NM2A 3CCL3 4GHOA 5AIFA 5LC6A 1VQ43 1CYUA 2BMRB 3PZWA 1VZZA 4GL6A 2BNGA 1DE3A 2GEXA 3NBJA 2J5VA 4MEIA 3WA2X 1HYFA 2W9QA 2P38A 3OV4A 1FGMA 4WWUC 3HJYA 2OWPA 3MG3A 1D6ZA 1JN5A 1RN4A 1UCLA 1OF5B 3GRDA 2Y73A 1QVF2 1YJW3 1ZL3A 1EG9B 1A2KA 4EW5A 4OK0A 3EE1A 3VSEA 2F56A 3UL5A 4XBXA 3N8BA 3X40A 5HGRA 1M904 2HMJB 2CHCA 2KXGA 5IENA 1N9JA 2ANEA 1SJWA 1VQQA 1BRHA 1X1UA 3E99A 3EJVA 1BIRA 3H51A 3M6XA 3MHEA 3GZBA 4LSOA 2GBXB 1G02A 5CLKA 2P09A 1IV9A 1YVBI 5CF1A 3HOHA 2I9WA 2E2VA 2WO0A 5D81A 1YI23 5M18A 4OVMA 1A67A 1L5GB 3UNLA 1RN1A 2AS0A 3BNDA 3PS8A 4GB5A 1BNEA 3K9MC 3LZAA 3X42A 1UCKA 1RHLA 1WMPA 1W6YA 1OHPA 5BVBA 3X3YA 1FUWA 1RMSA 2BMQB 3LOYA 1TUHA 2H0GA 5AIIA 2AUSA 1N9EA 2L1SA 1SARA 5FW5A 5M1AA 1IQ8A 3DGNA 3HX8A 4JRFA 5DREA 3F9SA 2E2UA 1FW7A 1HU9A 1RGHA 1I0XA 5HOHA 5A0OB 9RNTA 1GY7A 1IVWA 1IT8A 1B2SA 4WP5A 3MSOA 2IY2A 2V1LA 1UGHI 2XF3A 1IVVA 1R4YA 3WDGB 4MMZB 4HM5B 3V99A 5AEUB 1TRPA 1BSAA 2AAEA 5AYRB 3S27A 4R9KA 3RNTA 1R3FA 3BLZA 1EA2A 1Q7HA 4HM2B 5KP4A 3PCSA 1WMOA 1YJ93 3PYJA 2J8XB 2Z7AA 3JUQA 2C4BA 3LDFA 1RKYA 4FCMA 5D82A 3CC73 5AI1A 2HMOB 1BOXA 3SYUA 4WYKA 2ZHXB 3CME3 1IQYA 2CX1A 1SQWA 3KFQC 1BRGA 2PNCA 4N6NB 1QJGA 3Q3FA 3LWQA 1IK3A 2Q07A 1SGVA 1OHSA 2RNTA 4CCVA 1GD3A 1W7CA 2CFKA 2XRXB 1KC84 3CD63 2XFTA 1JJ22 3IJEB 3SXXA 2CWVA 2Z76A 4NREA 4XDWA 3IPTA 1JV2B 4J9AA 2HMNB 3RGRA 1YVSA 1B2MA 1RRHA 1MWTA 1DMNA 7GSPA 5STDA 3LYGA 3WA3A 5KP1A 5AEWB 4XBYA 3DM8A 2KF6A 4XM4A 3X3XA 1VQ63 1RN7A 2BO9B 1G0TA 1WXXA 1K8A4 4IT7A 1GS3A 2H0IA 3FF2A 2HVYA 2K0MA 2OQEA 2CFGA 1BANA 1BNGA 1I3FA 1OACA 3X3ZA 3J7Yd 4EBGA 4LYLB 1NO3A 3X41A 4H61A 4PEJA 3NX0A 4R9LA 2QA43 1RRLA 2R4IA 2KAAA 2RBIA 1JB4A 1LQGC 1X1WA 3LWOA 1OH0A 3JUPA 4J5GA 1OGXA 1IYYA 1A2VA 1ULIB 2FNQA 2QGUA 3G0KA 1XNEA 3ER7A 1T5YA 1U8CB 4N6MA 1JZDA 2KF5A 3JUMA 1FGTA 1ZBOA 1IU7A 5IW9A 1TP6A 1VQ93 3ALAA 3EQQB 1K734 1W2B2 1TTOA 3LT9A 1SIIA 2JDIH 4FMAA 2E5OA 1W5ZA 3N9HA 1ULJB 2XGLA 4BTWA 3KZTA 2Z77A 3VSYA 3CCR3 3FZWA 1FGQA 1MWRA 2D1WA 4N6OB 3LJCA 1M9GA 1E97A 1BNJA 1YJN3 3HIGA 3LTAA 4FMBA 4HM6B 5M19A 1PYLA 1US1A 4TZ4C 1X1YA 1OF5A 2GU1A 1B2UA 3OX9A 3DY5A 3CCJ3 4KVHA 2W56A 3EB8A 3ZV0C 1W02A 3G8ZA 2CK3H 4WHAA 2K54A 4KT3B 1W01A 1WK2A 3MKIA 3QK9A 2PZVA 3LH4A 3SOYA 4O02B 1TRQA 1W6GA 2F86B 3EHCA 5IF6A 3O8YA 2XGNA 1C7HA 4K61A 1CQSA 5G1LA 3L0RA 3K7CA 5IG0A 1MGRA 5G1KA 3UJMA 2W9PA 2KKUA 4L8PA 4KZ1A 4XDVA 3EF8A 4AKZA 1ZE1A 1GD4A 1FGOA 2CFLA 2W56B 4RNYA 3JUOA 2XSHB 1UGIA 1I2EA 2UGIA 3FG3A 1QAKA 3NUVA 4MMXB 1Q40B 4O2HA 3OXAA 1T3BA 1UI8A 2YFJB 4R4KA 1RGKA 8CHOA 3TDGA 1QALA 1W00A 4HZBB 1ZX2A 1GSPA 2CFDA 1RTUA 1B27A 3OWSA 2AADA 1A2PA 1Q824 3OW22 5EQLA 4BL3A 3MG2A 1TIJA 5CF2A 2ZDJA 3NQYA 1LRAA 3FG4A 2R41A 1NDOB 3BB9A 2STDA 3JUNA 3KCHA 2OOVA 1LXEA 2BT3A 1CYVA 3KSPA 1B2ZA 3WR2A 4KFFA 5KP3A 1S723 4G1MB 2P05A 2WGQA 1LOYA 3KKGA 3EX9A 2CG1A 1KWIA 3NBBA 2CWTA 4AEQA 5IEPA 1I70A 2OTJ3 3CCQ3 3CCS3 5JBSA 2E2TA 1B3SA 4CDLA 3IMAB 3DUKA 1ISKA 1S04A 4CI2B 4U13A 3I553 1JZOA 1KQS2 2DP9A 1Y4KA 1LNIA 2GSPA 3A76A 1DYUA 8RNTA 1EUIC 3WMDA 1LVNA 4O3VA 2QEX3 2KF4A 1YIT3 7RNTA 1UUGB 5JPUA 2ML5A 1N5PA 1OPYA 3SVAA 4R1KA 3HAXA 1YHQ3 3LTBA 2CW9A 4HOHA 2HMKB 3MYTA 5DRVA 1LOVA 2YFIB 3AGOA 3B4PA 4RNTA 6GSPA 4X2OA 4CI3B 4IPBA 2P0MA 2J5TA 4FMDA 3WHOA 5GSPA 4H3UA 3HIIA 2IMJA 1D6YA 3DXOA 2O9UX 4DKIA 1FYSA 3MQKA 1O7MB 4HVNA 1X1XA 3CCE3 3K63A 1JRQA 1Q814 2JQ5A 4DMGA 1ZE2A 2C11A 3DH2A 2OQEC 1B20A 1BNIA 4O8SA 1NJI4 1BUQA 1HZ1A 1BSBA 4CI1B 1RGLA 2OCTA 3G6E3 3Q2PA 4HYZA 1TE7A 3LT8A 4HM7B 2YFLB 3RGAA 3UAIA 3GSPA 3OWUA 4N6TA 1JNQA 3IUWA 1WQLB 4STDA 2FGTA 2KF3A 5AYSC 4WFOA 1TFKA 3AHWA 1IT7A 4JF8A 1IV7A 3CC43 3F7SA 1AVKA 4K90B 2QIYA 3ROBA 2A15A 3G16A 3WOEB 3CCV3 1VQO3 2CH9A 2ZL8A 3NM7A 2RCDA 3QRDA 3GZRA 2AB4A 2XEPA 1VQK3 3M6UA 1M1XB 3CXC2 3CCM3 1RGAA 1UUWB 2KCDA 3PXMA 1YGEA 1VQ73 1QVG2 1DVDA 3NQZA 3M8CA 4HKVB 1PU4A 1UUVB 1FUTA 3U1WA 1BSCA 1ASKA 1TFOA 2CX0A 3C0KA 3DZLA 1E3RA 3T0UA 1FUSA 3CC23 2P0XA 4FCJA 2ML6A 2UUGC 1GOYA 1KSIA 1BAOA 1GY6A 3I0YA 5FGOA 1BRNL 1A90A 2EY4A 3T8UA 3U97A 1GMPA 3NV0B 3ZFZA 1K41A 2Z6BA 3LMLA 3U28A 4KFDA 1NU3A 5CK6A 4X2HA 2FXTA 4BIRA 4FCZA 2BHMA 1K8WA 1OGZA 1N5HA 3D5IA 4J8TA 5G2GA 5IG5A 5IG3A 2CKFB 1Q42A 3B4OA 1MGWA 1W4NA 1IVUA 1DVCA 3T8NA 4EC6A 1BRSA 1UCIA 3UB1A 1RCLA 1T2HA 1RJOA 4I5QA 1CH0A 3DGMA 1UI7A 2BIRA 2KRTA 3AMOB 5ELUA 1OHOA 4BTXA 2INXA 2CWWA 1E3VA 1UDII 4TX4A 1PY3A 1WNHA 1Q40A 1DETA 3GZXB 2F99A 3KN4A 2SBLA 3LWRA 3EN1B 3M6WA 4NHFA 1V57A 4OUQA 5RNTA 3D4AA 4NPBA 3ZG5A 1J2BA 2OOVC 2GEYA 2ZA4A 4L8OA 1KD14 3MWZA 5AIHA 1BNFA 1MNLA 3LTCA 1I3IA 3DGLA 1GYBA 3NXJA 4RNZA 1JKGB 2CG0A 1BNRA 2YX9A 4N6LA 2W2CA 1AVLA 4LGQA 4K1VA 1RNBA 3F7XA 3RDEA 1Q864 4L7KA 1O7PB 1G96A 1ZO2A 1RDSA 2RFRA 3F8HA 4ZM8A 3CCU3 1DMMA 4LMIA 1FZUA 1N8QA 3HJWA 1SPUA 2GU3A 3BNBA 3LXUX 1JBRA 3B7CA 1EKMA 1O7GB 3D79A 4HM8B 1VQL3 3D5GA 4RZMA 1CEWI 2CC3A 1O7WB 3FF0A 1UOYA 3FCSB 5JPPA 1SIHA 3M4XA 1YGWA 3FKAA 3CMA3 3CNXA 4ORLA 1RGCA 1GOUA 1GY5A 4ILFA 1AV4A 3Q90A 3SX1A 3BNEA 2Z0TA 4R80A 2RGQA 2Y74A 1AQZA 2LYXA 3MG1A 3WODG 3CPOA 1R3EA 1K28A 1STDA 3GAXA 1JN5B 1I8VA 3S29A 3KE7A 4EYCA 4EXRA 2GXFA 1ROVA 2XFSA 4MJDA 1BRJA 1R4CA 2SARA 1HKXA 1LNHA 4LEHA 3UL6A 4EV5A 4EV2A
chains in the Genus database with same CATH topology
2AS0A 2J5VA 3D79A 2P38A 2J5TA 1R3FA 1T5YA 1Q7HA 1IT7A 1J2BA 1WXXA 1WXWA 1IQ8A 3LDFA 1ZL3A 1K8WA 1ZE1A 2AB4A 3VSEA 4DMGA 2B78A 1ZE2A 2CX1A 1SQWA 4Q1TA 1IT8A 2Q07A 1SGVA 1R3EA 2CX0A 3C0KA 1ZS7A 3UAIA 2CWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AS0 A;  2J5V A;  3D79 A;  2P38 A;  2J5T A;  1R3F A;  1T5Y A;  1Q7H A;  1IT7 A;  1J2B A;  1WXX A;  1WXW A;  1IQ8 A;  3LDF A;  1ZL3 A;  1K8W A;  1ZE1 A;  2AB4 A;  3VSE A;  4DMG A;  2B78 A;  1ZE2 A;  2CX1 A;  1SQW A;  4Q1T A;  1IT8 A;  2Q07 A;  1SGV A;  1R3E A;  2CX0 A;  3C0K A;  1ZS7 A;  3UAI A;  2CWW A; 
#chains in the Genus database with same CATH topology
 3EBY A;  5IEO A;  4N6U A;  1LOX A;  1JBT A;  1B21 A;  4RBN A;  2UX0 A;  1QAF A;  4XBT A;  1UCJ A;  1WTH A;  1FGR A;  4HM3 B;  3AGN A;  4CJN A;  3D9R A;  3CPW 2;  3SOA A;  4BL2 A;  3URP A;  1O7N B;  2W03 A;  1WXW A;  1FA3 A;  2FRX A;  3H3H A;  3G71 3;  3LWV A;  5I97 A;  3K0Z A;  5D83 A;  1RGG A;  1BRK A;  4HZ9 B;  3WOF B;  2GBW B;  1VQP 3;  3FSD A;  1PFP A;  3M65 A;  3DGY A;  2IUJ A;  2APO A;  1AR0 A;  2WOF A;  1EQK A;  3HK4 A;  3VGN A;  2M7O A;  6STD A;  1YIJ 3;  1DMQ A;  1D6U A;  2D42 A;  4HBR A;  3NBR A;  7STD A;  2OTL 3;  1RGE A;  1MWU A;  1ROA A;  1ZS7 A;  1GOV A;  1I2G A;  3FLJ A;  4J5K A;  5BXQ A;  3ZG0 A;  2L4V A;  2CFW A;  3BU4 A;  3CNM A;  1W6C A;  1W2Z A;  1OCV A;  3GZY B;  1Q7Y 4;  1NNV A;  1I0V A;  5LC7 A;  3FG1 A;  2K3D A;  1AY7 A;  3FH1 A;  4HM4 B;  3OWY A;  2IUK A;  1NB5 I;  4KFE A;  4HM1 B;  1K9M 4;  1M1K 4;  1RNT A;  4N6V 0;  4CPK A;  3BIR A;  1B2X A;  6RNT A;  2B24 B;  1RCK A;  4XB5 A;  1BNS A;  1BSD A;  4Q1T A;  2H0H A;  3EBT A;  3NV0 A;  4MMY B;  1VQ8 3;  3HZP A;  2WGO A;  4N3V A;  4BU4 A;  2RSX A;  3F14 A;  1OUN A;  3F8X A;  3JVC A;  3LTD A;  3VF1 A;  1BGS A;  3SLU A;  1V74 A;  2CWU A;  1JB2 A;  2IA7 A;  4FR9 A;  3EC9 A;  2W04 A;  2HOH A;  1VQ5 3;  1S5A A;  4WYK B;  1GMQ A;  1IDP A;  5BIR A;  2CIU A;  1Z1S A;  1YNV X;  4HJL B;  2BU4 A;  1MWS A;  1V58 A;  2B1X B;  2XH9 A;  3KSE D;  3AMO A;  3V92 A;  3MPH A;  3PCR A;  4LZI A;  1RGF A;  3V98 A;  5IER A;  3G4S 3;  1LQM B;  3DMC A;  4Q53 A;  2F5W A;  3F40 A;  3N54 B;  1BVI A;  1RSN A;  2F4Y A;  2WOH A;  2XR8 B;  3PGB A;  2B78 A;  3Q1C A;  3ECF A;  1T2I A;  3AHS A;  3S67 A;  3STD A;  4HM0 B;  3B8L A;  1GMR A;  1I2F A;  2HMM B;  3K5T A;  4GSP A;  5IG4 A;  2O3O A;  1BU4 A;  5AIG A;  1EEJ A;  1LOW A;  3D3L A;  1O7H B;  1NWW A;  3GWR A;  1F8N A;  1JKG A;  4BTY A;  3M6V A;  1MOL A;  2HML B;  2XSO B;  3A5E A;  3EN8 A;  1JB5 A;  1BUJ A;  2LQV A;  5EEO A;  1VQN 3;  5CXO A;  1Q9E A;  3CU3 A;  3SED A;  1IVX A;  2F98 A;  1RLS A;  1UW1 A;  2F5M A;  4IIA A;  1C54 A;  4K1U A;  3FGY A;  3KII A;  2MF7 A;  1ZGX A;  1BRI A;  2W6J H;  1WMN A;  3S28 A;  3DGO A;  1JBS A;  1QMA A;  4HAA A;  4FMC A;  2MC8 A;  2IYJ A;  5BU4 A;  2RFK A;  1NB3 I;  2W0Q A;  3S5C A;  4QWT A;  1TJD A;  1TU5 A;  1N8R 4;  3HI7 A;  3NHX A;  1IQX A;  3BNC A;  5TGN A;  4AKY A;  3LWP A;  4I4K A;  5EVH A;  1BSE A;  2C10 A;  2BMO B;  5ELJ A;  3I56 3;  1VQM 3;  1STF I;  1U5O A;  3NM2 A;  3CCL 3;  4GHO A;  5AIF A;  5LC6 A;  1VQ4 3;  1CYU A;  2BMR B;  3PZW A;  1VZZ A;  4GL6 A;  2BNG A;  1DE3 A;  2GEX A;  3NBJ A;  2J5V A;  4MEI A;  3WA2 X;  1HYF A;  2W9Q A;  2P38 A;  3OV4 A;  1FGM A;  4WWU C;  3HJY A;  2OWP A;  3MG3 A;  1D6Z A;  1JN5 A;  1RN4 A;  1UCL A;  1OF5 B;  3GRD A;  2Y73 A;  1QVF 2;  1YJW 3;  1ZL3 A;  1EG9 B;  1A2K A;  4EW5 A;  4OK0 A;  3EE1 A;  3VSE A;  2F56 A;  3UL5 A;  4XBX A;  3N8B A;  3X40 A;  5HGR A;  1M90 4;  2HMJ B;  2CHC A;  2KXG A;  5IEN A;  1N9J A;  2ANE A;  1SJW A;  1VQQ A;  1BRH A;  1X1U A;  3E99 A;  3EJV A;  1BIR A;  3H51 A;  3M6X A;  3MHE A;  3GZB A;  4LSO A;  2GBX B;  1G02 A;  5CLK A;  2P09 A;  1IV9 A;  1YVB I;  5CF1 A;  3HOH A;  2I9W A;  2E2V A;  2WO0 A;  5D81 A;  1YI2 3;  5M18 A;  4OVM A;  1A67 A;  1L5G B;  3UNL A;  1RN1 A;  2AS0 A;  3BND A;  3PS8 A;  4GB5 A;  1BNE A;  3K9M C;  3LZA A;  3X42 A;  1UCK A;  1RHL A;  1WMP A;  1W6Y A;  1OHP A;  5BVB A;  3X3Y A;  1FUW A;  1RMS A;  2BMQ B;  3LOY A;  1TUH A;  2H0G A;  5AII A;  2AUS A;  1N9E A;  2L1S A;  1SAR A;  5FW5 A;  5M1A A;  1IQ8 A;  3DGN A;  3HX8 A;  4JRF A;  5DRE A;  3F9S A;  2E2U A;  1FW7 A;  1HU9 A;  1RGH A;  1I0X A;  5HOH A;  5A0O B;  9RNT A;  1GY7 A;  1IVW A;  1IT8 A;  1B2S A;  4WP5 A;  3MSO A;  2IY2 A;  2V1L A;  1UGH I;  2XF3 A;  1IVV A;  1R4Y A;  3WDG B;  4MMZ B;  4HM5 B;  3V99 A;  5AEU B;  1TRP A;  1BSA A;  2AAE A;  5AYR B;  3S27 A;  4R9K A;  3RNT A;  1R3F A;  3BLZ A;  1EA2 A;  1Q7H A;  4HM2 B;  5KP4 A;  3PCS A;  1WMO A;  1YJ9 3;  3PYJ A;  2J8X B;  2Z7A A;  3JUQ A;  2C4B A;  3LDF A;  1RKY A;  4FCM A;  5D82 A;  3CC7 3;  5AI1 A;  2HMO B;  1BOX A;  3SYU A;  4WYK A;  2ZHX B;  3CME 3;  1IQY A;  2CX1 A;  1SQW A;  3KFQ C;  1BRG A;  2PNC A;  4N6N B;  1QJG A;  3Q3F A;  3LWQ A;  1IK3 A;  2Q07 A;  1SGV A;  1OHS A;  2RNT A;  4CCV A;  1GD3 A;  1W7C A;  2CFK A;  2XRX B;  1KC8 4;  3CD6 3;  2XFT A;  1JJ2 2;  3IJE B;  3SXX A;  2CWV A;  2Z76 A;  4NRE A;  4XDW A;  3IPT A;  1JV2 B;  4J9A A;  2HMN B;  3RGR A;  1YVS A;  1B2M A;  1RRH A;  1MWT A;  1DMN A;  7GSP A;  5STD A;  3LYG A;  3WA3 A;  5KP1 A;  5AEW B;  4XBY A;  3DM8 A;  2KF6 A;  4XM4 A;  3X3X A;  1VQ6 3;  1RN7 A;  2BO9 B;  1G0T A;  1WXX A;  1K8A 4;  4IT7 A;  1GS3 A;  2H0I A;  3FF2 A;  2HVY A;  2K0M A;  2OQE A;  2CFG A;  1BAN A;  1BNG A;  1I3F A;  1OAC A;  3X3Z A;  3J7Y d;  4EBG A;  4LYL B;  1NO3 A;  3X41 A;  4H61 A;  4PEJ A;  3NX0 A;  4R9L A;  2QA4 3;  1RRL A;  2R4I A;  2KAA A;  2RBI A;  1JB4 A;  1LQG C;  1X1W A;  3LWO A;  1OH0 A;  3JUP A;  4J5G A;  1OGX A;  1IYY A;  1A2V A;  1ULI B;  2FNQ A;  2QGU A;  3G0K A;  1XNE A;  3ER7 A;  1T5Y A;  1U8C B;  4N6M A;  1JZD A;  2KF5 A;  3JUM A;  1FGT A;  1ZBO A;  1IU7 A;  5IW9 A;  1TP6 A;  1VQ9 3;  3ALA A;  3EQQ B;  1K73 4;  1W2B 2;  1TTO A;  3LT9 A;  1SII A;  2JDI H;  4FMA A;  2E5O A;  1W5Z A;  3N9H A;  1ULJ B;  2XGL A;  4BTW A;  3KZT A;  2Z77 A;  3VSY A;  3CCR 3;  3FZW A;  1FGQ A;  1MWR A;  2D1W A;  4N6O B;  3LJC A;  1M9G A;  1E97 A;  1BNJ A;  1YJN 3;  3HIG A;  3LTA A;  4FMB A;  4HM6 B;  5M19 A;  1PYL A;  1US1 A;  4TZ4 C;  1X1Y A;  1OF5 A;  2GU1 A;  1B2U A;  3OX9 A;  3DY5 A;  3CCJ 3;  4KVH A;  2W56 A;  3EB8 A;  3ZV0 C;  1W02 A;  3G8Z A;  2CK3 H;  4WHA A;  2K54 A;  4KT3 B;  1W01 A;  1WK2 A;  3MKI A;  3QK9 A;  2PZV A;  3LH4 A;  3SOY A;  4O02 B;  1TRQ A;  1W6G A;  2F86 B;  3EHC A;  5IF6 A;  3O8Y A;  2XGN A;  1C7H A;  4K61 A;  1CQS A;  5G1L A;  3L0R A;  3K7C A;  5IG0 A;  1MGR A;  5G1K A;  3UJM A;  2W9P A;  2KKU A;  4L8P A;  4KZ1 A;  4XDV A;  3EF8 A;  4AKZ A;  1ZE1 A;  1GD4 A;  1FGO A;  2CFL A;  2W56 B;  4RNY A;  3JUO A;  2XSH B;  1UGI A;  1I2E A;  2UGI A;  3FG3 A;  1QAK A;  3NUV A;  4MMX B;  1Q40 B;  4O2H A;  3OXA A;  1T3B A;  1UI8 A;  2YFJ B;  4R4K A;  1RGK A;  8CHO A;  3TDG A;  1QAL A;  1W00 A;  4HZB B;  1ZX2 A;  1GSP A;  2CFD A;  1RTU A;  1B27 A;  3OWS A;  2AAD A;  1A2P A;  1Q82 4;  3OW2 2;  5EQL A;  4BL3 A;  3MG2 A;  1TIJ A;  5CF2 A;  2ZDJ A;  3NQY A;  1LRA A;  3FG4 A;  2R41 A;  1NDO B;  3BB9 A;  2STD A;  3JUN A;  3KCH A;  2OOV A;  1LXE A;  2BT3 A;  1CYV A;  3KSP A;  1B2Z A;  3WR2 A;  4KFF A;  5KP3 A;  1S72 3;  4G1M B;  2P05 A;  2WGQ A;  1LOY A;  3KKG A;  3EX9 A;  2CG1 A;  1KWI A;  3NBB A;  2CWT A;  4AEQ A;  5IEP A;  1I70 A;  2OTJ 3;  3CCQ 3;  3CCS 3;  5JBS A;  2E2T A;  1B3S A;  4CDL A;  3IMA B;  3DUK A;  1ISK A;  1S04 A;  4CI2 B;  4U13 A;  3I55 3;  1JZO A;  1KQS 2;  2DP9 A;  1Y4K A;  1LNI A;  2GSP A;  3A76 A;  1DYU A;  8RNT A;  1EUI C;  3WMD A;  1LVN A;  4O3V A;  2QEX 3;  2KF4 A;  1YIT 3;  7RNT A;  1UUG B;  5JPU A;  2ML5 A;  1N5P A;  1OPY A;  3SVA A;  4R1K A;  3HAX A;  1YHQ 3;  3LTB A;  2CW9 A;  4HOH A;  2HMK B;  3MYT A;  5DRV A;  1LOV A;  2YFI B;  3AGO A;  3B4P A;  4RNT A;  6GSP A;  4X2O A;  4CI3 B;  4IPB A;  2P0M A;  2J5T A;  4FMD A;  3WHO A;  5GSP A;  4H3U A;  3HII A;  2IMJ A;  1D6Y A;  3DXO A;  2O9U X;  4DKI A;  1FYS A;  3MQK A;  1O7M B;  4HVN A;  1X1X A;  3CCE 3;  3K63 A;  1JRQ A;  1Q81 4;  2JQ5 A;  4DMG A;  1ZE2 A;  2C11 A;  3DH2 A;  2OQE C;  1B20 A;  1BNI A;  4O8S A;  1NJI 4;  1BUQ A;  1HZ1 A;  1BSB A;  4CI1 B;  1RGL A;  2OCT A;  3G6E 3;  3Q2P A;  4HYZ A;  1TE7 A;  3LT8 A;  4HM7 B;  2YFL B;  3RGA A;  3UAI A;  3GSP A;  3OWU A;  4N6T A;  1JNQ A;  3IUW A;  1WQL B;  4STD A;  2FGT A;  2KF3 A;  5AYS C;  4WFO A;  1TFK A;  3AHW A;  1IT7 A;  4JF8 A;  1IV7 A;  3CC4 3;  3F7S A;  1AVK A;  4K90 B;  2QIY A;  3ROB A;  2A15 A;  3G16 A;  3WOE B;  3CCV 3;  1VQO 3;  2CH9 A;  2ZL8 A;  3NM7 A;  2RCD A;  3QRD A;  3GZR A;  2AB4 A;  2XEP A;  1VQK 3;  3M6U A;  1M1X B;  3CXC 2;  3CCM 3;  1RGA A;  1UUW B;  2KCD A;  3PXM A;  1YGE A;  1VQ7 3;  1QVG 2;  1DVD A;  3NQZ A;  3M8C A;  4HKV B;  1PU4 A;  1UUV B;  1FUT A;  3U1W A;  1BSC A;  1ASK A;  1TFO A;  2CX0 A;  3C0K A;  3DZL A;  1E3R A;  3T0U A;  1FUS A;  3CC2 3;  2P0X A;  4FCJ A;  2ML6 A;  2UUG C;  1GOY A;  1KSI A;  1BAO A;  1GY6 A;  3I0Y A;  5FGO A;  1BRN L;  1A90 A;  2EY4 A;  3T8U A;  3U97 A;  1GMP A;  3NV0 B;  3ZFZ A;  1K41 A;  2Z6B A;  3LML A;  3U28 A;  4KFD A;  1NU3 A;  5CK6 A;  4X2H A;  2FXT A;  4BIR A;  4FCZ A;  2BHM A;  1K8W A;  1OGZ A;  1N5H A;  3D5I A;  4J8T A;  5G2G A;  5IG5 A;  5IG3 A;  2CKF B;  1Q42 A;  3B4O A;  1MGW A;  1W4N A;  1IVU A;  1DVC A;  3T8N A;  4EC6 A;  1BRS A;  1UCI A;  3UB1 A;  1RCL A;  1T2H A;  1RJO A;  4I5Q A;  1CH0 A;  3DGM A;  1UI7 A;  2BIR A;  2KRT A;  3AMO B;  5ELU A;  1OHO A;  4BTX A;  2INX A;  2CWW A;  1E3V A;  1UDI I;  4TX4 A;  1PY3 A;  1WNH A;  1Q40 A;  1DET A;  3GZX B;  2F99 A;  3KN4 A;  2SBL A;  3LWR A;  3EN1 B;  3M6W A;  4NHF A;  1V57 A;  4OUQ A;  5RNT A;  3D4A A;  4NPB A;  3ZG5 A;  1J2B A;  2OOV C;  2GEY A;  2ZA4 A;  4L8O A;  1KD1 4;  3MWZ A;  5AIH A;  1BNF A;  1MNL A;  3LTC A;  1I3I A;  3DGL A;  1GYB A;  3NXJ A;  4RNZ A;  1JKG B;  2CG0 A;  1BNR A;  2YX9 A;  4N6L A;  2W2C A;  1AVL A;  4LGQ A;  4K1V A;  1RNB A;  3F7X A;  3RDE A;  1Q86 4;  4L7K A;  1O7P B;  1G96 A;  1ZO2 A;  1RDS A;  2RFR A;  3F8H A;  4ZM8 A;  3CCU 3;  1DMM A;  4LMI A;  1FZU A;  1N8Q A;  3HJW A;  1SPU A;  2GU3 A;  3BNB A;  3LXU X;  1JBR A;  3B7C A;  1EKM A;  1O7G B;  3D79 A;  4HM8 B;  1VQL 3;  3D5G A;  4RZM A;  1CEW I;  2CC3 A;  1O7W B;  3FF0 A;  1UOY A;  3FCS B;  5JPP A;  1SIH A;  3M4X A;  1YGW A;  3FKA A;  3CMA 3;  3CNX A;  4ORL A;  1RGC A;  1GOU A;  1GY5 A;  4ILF A;  1AV4 A;  3Q90 A;  3SX1 A;  3BNE A;  2Z0T A;  4R80 A;  2RGQ A;  2Y74 A;  1AQZ A;  2LYX A;  3MG1 A;  3WOD G;  3CPO A;  1R3E A;  1K28 A;  1STD A;  3GAX A;  1JN5 B;  1I8V A;  3S29 A;  3KE7 A;  4EYC A;  4EXR A;  2GXF A;  1ROV A;  2XFS A;  4MJD A;  1BRJ A;  1R4C A;  2SAR A;  1HKX A;  1LNH A;  4LEH A;  3UL6 A;  4EV5 A;  4EV2 A; 
#chains in the Genus database with same CATH homology
 2AS0 A;  2J5V A;  3D79 A;  2P38 A;  2J5T A;  1R3F A;  1T5Y A;  1Q7H A;  1IT7 A;  1J2B A;  1WXX A;  1WXW A;  1IQ8 A;  3LDF A;  1ZL3 A;  1K8W A;  1ZE1 A;  2AB4 A;  3VSE A;  4DMG A;  2B78 A;  1ZE2 A;  2CX1 A;  1SQW A;  4Q1T A;  1IT8 A;  2Q07 A;  1SGV A;  1R3E A;  2CX0 A;  3C0K A;  1ZS7 A;  3UAI A;  2CWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...