The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
126
|
sequence length |
449
|
structure length |
440
|
Chain Sequence |
TLPQQFIKKYRLLLGEEASDFFSALEQGSVKKGFRWNPLKPAGLDMVQTYHSEELQPAPYSNEGFLGTVNGKSFLHQAGYEYSQEPSAMIVGTAAAAKPGEKVLDLCAAPGGKSTQLAAQMKGKGLLVTNEIFPKRAKILSENIERWGVSNAIVTNHAPAELVPHFSGFFDRIVVDAPCSGEGMFRKDPNAIKEWTEESPLYCQKRQQEILSSAIKMLKNKGQLIYSTCTFAPEENEEIISWLVENYPVTIEEIPLTQSVSSGRSEWGSVAGLEKTIRIWPHKDQGEGHFVAKLTFHGQNQMHKVQMTKEQEKLWTEFSNDFHYEATGRLLVFNDHLWEVPELAPSLDGLKVVRTGLHLGDFKKNRFEPSYALALATKKIENIPCLPITQKEWQSYTAGETFQRDGNQGWVLLVLDKIPVGFGKQVKGTVKNFFPKGLRF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of an RNA methyltransferase
rcsb |
molecule tags |
Transferase
|
source organism |
Enterococcus faecium
|
molecule keywords |
NOL1/NOP2/sun family protein
|
total genus |
126
|
structure length |
440
|
sequence length |
449
|
ec nomenclature | |
pdb deposition date | 2010-03-12 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01189 | Methyltr_RsmB-F | 16S rRNA methyltransferase RsmB/F |
A | PF13636 | Methyltranf_PUA | RNA-binding PUA-like domain of methyltransferase RsmF |
A | PF17125 | Methyltr_RsmF_N | N-terminal domain of 16S rRNA methyltransferase RsmF |
A | PF17126 | RsmF_methylt_CI | RsmF rRNA methyltransferase first C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 | Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Vaccinia Virus protein VP39 |