3M4XA

Structure of a ribosomal methyltransferase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
449
structure length
440
Chain Sequence
TLPQQFIKKYRLLLGEEASDFFSALEQGSVKKGFRWNPLKPAGLDMVQTYHSEELQPAPYSNEGFLGTVNGKSFLHQAGYEYSQEPSAMIVGTAAAAKPGEKVLDLCAAPGGKSTQLAAQMKGKGLLVTNEIFPKRAKILSENIERWGVSNAIVTNHAPAELVPHFSGFFDRIVVDAPCSGEGMFRKDPNAIKEWTEESPLYCQKRQQEILSSAIKMLKNKGQLIYSTCTFAPEENEEIISWLVENYPVTIEEIPLTQSVSSGRSEWGSVAGLEKTIRIWPHKDQGEGHFVAKLTFHGQNQMHKVQMTKEQEKLWTEFSNDFHYEATGRLLVFNDHLWEVPELAPSLDGLKVVRTGLHLGDFKKNRFEPSYALALATKKIENIPCLPITQKEWQSYTAGETFQRDGNQGWVLLVLDKIPVGFGKQVKGTVKNFFPKGLRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NOL1/NOP2/sun family protein
publication title Structure of an RNA methyltransferase
rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 126
structure length 440
sequence length 449
ec nomenclature
pdb deposition date 2010-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F
A PF13636 Methyltranf_PUA RNA-binding PUA-like domain of methyltransferase RsmF
A PF17125 Methyltr_RsmF_N N-terminal domain of 16S rRNA methyltransferase RsmF
A PF17126 RsmF_methylt_CI RsmF rRNA methyltransferase first C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.60 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3m4xA03
3.30.70.3130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m4xA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3m4xA02
1N2XA 3TPZA 2GB4A 3GWZA 5E1DA 3NWEA 4BLUA 1KHHA 5FQNA 5LQUA 4AZTA 4CKBA 2BM8A 1X1BA 3LHDA 2ONYA 1D2GA 2ORED 3BKXA 8MHTA 3UJDA 2OYRA 3R3HA 3VC1A 3LPMA 5GM2A 4C06A 3MAGA 2AVNA 5LQAA 3ELWA 2P3QA 5KYGA 3X0DA 2OKCA 3DH0A 5DT2A 5KQSA 2XYVA 5E1BA 5E1OA 4C03A 3MERA 4PGGA 4KRGA 3PX2A 1NV9A 3M6WA 1RI3A 3U81A 2PXAA 5CVVA 3GU3A 4L7VA 3RW9A 4ER5A 2IBTA 3B3GA 1V39A 2FRXA 2P1DA 5E9WA 2G1PA 2JG3A 4PYLA 1VL5A 3UZUA 3G8BA 4U7TB 3BWBA 4AUKA 5EKXA 4M7RA 3IEIA 3L8DA 5DTMA 3AY0A 3KQPA 1QANA 2PWYA 5HZMA 4WXHA 3EGEA 2ZULA 3Q87B 3P9NA 4YUXA 5HEKA 2HWKA 3LECA 4CKCA 2QRVB 1AQIA 1WZNA 4QDJA 3FTEA 4PINA 2GLUA 1RJDA 2O06A 1R00A 2WA1A 4Z2YA 3SSOA 5KQRA 2HTEA 1ORHA 3KQMA 1X1CA 1JQEA 5E2AA 1X19A 3DXZA 2XYRA 3MB5A 4GOMD 5E9JA 3SM3A 5LQNA 5LQRA 5LQKA 2G72A 1BHJA 1PJZA 1HNNA 1X1AA 3GRZA 3LCUA 1VPTA 5HILA 4QQNA 5GIOE 4RTSA 4DM3A 3UA4A 4A6DA 3FPEA 4LECA 3HVJA 4FT4A 4GOND 5P8WA 2NXCA 2P3LA 4K6MA 1RJGA 5DSTA 2XBMA 3QV2A 4PGHA 3FPFA 3R24A 4XUCA 1ZQ9A 2B25A 5GOZA 2ERCA 5GWXA 3FUTA 4PCLA 2PX8A 4B17A 3ANXA 5EHGA 2Z6QA 3QOWA 3ERCA 1H1DA 1SKMA 1G55A 1R8YA 2YR0A 4DKJA 2UYOA 1NBIA 4XUEA 3FTFA 3ELUA 1NW6A 5F2KA 3SXJA 1G38A 2AOTB 4X60A 3B3JA 2LD4A 2CWWA 3OE5A 4E2ZA 4EQZA 5T64A 1NW8A 4IV8A 5FHRA 3UJ6A 3OU6A 5DWQA 5ICFA 5FADA 5T6BA 2VDUE 1R74A 3GRVA 4HTFB 4RTQA 5K0EA 1JQDA 3DLIA 3UBTA 2OY0A 1VIDA 5HIMA 5LR6A 3UWPA 1XDSA 4YUVA 1ZHFA 1AQJA 1BOOA 5DX0A 3I58A 3GGDA 5DTRA 3KKZA 5DPMA 2FHPA 4C05A 3FPHA 3V97A 1M6EX 3GJYA 3PLAE 1Q0SA 5B1SA 4POOA 4P7GA 3PT9A 5EOVA 1X1DA 2ZIEA 2JH9A 2PX5A 3CC8A 4XUDA 4DCMA 1XCJA 3B5IA 1G8AA 3S68A 3VSEA 5CM2Z 4ATNA 4E32A 4BY9E 1R6AA 5EMLA 2I62A 4YV2A 5FWAA 5C0OE 5K8VA 3LDUA 2NP6A 5K0FA 3FPJA 4Y30A 5E1MA 4DF3A 3JWGA 1QAOA 1ZKDA 4RTJA 4OA8A 5CUQA 4LG1A 2AN3A 3EPPA 1JG1A 4ER0A 1D2CA 2IBSA 3G8AA 3KQWA 3AXTA 3OU2A 1N7JA 3HVHA 5DX8A 3NVMB 3FUVA 4CTJA 5EZQA 3LKDA 2AOUA 5FWDA 3I64A 1KIAA 2JH8A 2ZIGA 4HG2A 2ESRA 2G70A 2VDVE 3EVCA 4V0QA 4PYJA 3NJRA 2Y1WA 4JXJA 3LBFA 3PVCA 4LWOA 2O0LA 5EVJA 4P58A 3NMUF 3ER9A 3BGDA 3KQQA 5C9ZA 5CCXA 4E2WA 3CGGA 2OPBA 3MTIA 2WA2A 3REOA 4PYKA 2NP7A 2ZVJA 3LCCA 3FUUA 1KP9A 4YMGA 1WS6A 3HCCA 2AOVA 4E31A 5K09A 3MCZA 3PTAA 4RTRA 1DUSA 5K0BA 5CCBA 2IIPA 1VP3A 3A27A 3JWJA 3JWIA 3P97A 4AZVA 2OB2A 1YB2A 4GBED 3HVIA 3DXYA 3ELYA 5G02A 5HIIA 2YQZA 5IH3A 2O57A 5K01A 2BR4A 1RJEA 3HNRA 2IH5A 4GC9A 2PXCA 4OQEA 3G89A 5F2NA 2B9EA 1G6Q1 4HRAA 4MWZA 4QVKA 3M6VA 4QVGA 1KPGA 5DM0A 3VC2A 2KW5A 4MQ4A 2EJUA 3HA5A 3KPWA 1SUIA 2I9KA 2AOTA 3HP7A 3R6TA 4R6WA 2UYHA 4ER6A 3TM5A 1JG2A 3O4FA 5K03A 3B89A 4HC4A 1UWVA 3FTDA 2BR5A 3GRYA 3MCTA 3T7TA 4E33A 1VE3A 4GOLD 4HTFA 1IXKA 1SQGA 3OCJA 4RSRA 1YUBA 3TFWA 1I1NA 3UJ9A 5CVUA 3NDJA 3GO4A 4RVGA 3M6UA 2PLWA 4OBWA 1OR8A 1SUSA 3PFHA 4MTLA 3AWIA 2VP3A 3EVFA 4YUYA 4E2XA 1EAMA 2PGXA 3KHKA 4EKGA 1B42A 5DXAA 1FBNA 2CMHA 5LSAA 2GH1A 1UIRA 3MGGA 4DCGA 1AF7A 1WG8A 3KPJA 4NECA 5C1IA 3P8ZA 3UJCA 4R05A 4X63A 1XTPA 2EG5A 3PFGA 3PS9A 2GA9A 3NTVA 3M70A 4GUAA 4ZTBA 3TR6A 1AV6A 3GRRA 4E30A 1M0EA 1VBFA 5D1HA 4G56A 4GOOD 2P40A 5GIPE 4OA5A 4FP9A 3DMFA 5EGSA 5IKMA 1YZHA 2YVLA 3LDGA 4DQ0A 3OZRA 5FHQA 4KW7A 2QM3A 5CD1A 5EIFA 4PIPA 4U7PB 2JHAA 1WY7A 2FK7A 4EMSA 5K0LA 1JG3A 2PT9A 3G5TA 2XVMA 3OZTA 4PYOA 1L9KA 2WK1A 4BLWA 4RTMA 3DLCA 4RTLA 2EFJA 4IKPA 2UYCA 1QYRA 2HR1A 3M33A 1YZ3A 2GAFA 3V8VA 3IYLW 3BXOA 2EX4A 4MIKA 2NNWB 1JTEA 2IGTA 3OFKA 3G5LA 3BWYA 4C04A 3P2IA 3T7SA 2Q41A 2UYQA 4RWZA 3TRKA 2XYQA 5E8RA 3OU7A 2VZ9A 3T0IA 1O9GA 2O07A 3NWBA 5FULA 2ZTHA 1EJ6A 1I9GA 5DRTA 4ISCA 5DRYA 2Z6AA 1SVUA 2JHPA 3FRIA 5EMMA 3P9KA 5K0JA 1QAMA 4M37A 3A7EA 3RODA 1NE2A 2G8NA 3DUWA 3HEMA 4ER3A 3KU1A 3IHTA 1UFKA 2H11A 4X61A 5CVDA 4C4AA 3P2EA 2CL5A 3SX0A 5GM1A 3I5UA 3R0QA 3VYWA 1DCTA 2ZCJA 2A14A 5DSXA 1VQ1A 5ICEA 1QAQA 1TW3A 4LWPA 4PONA 1KYWA 1PRYA 5H02A 3DMGA 4HGYA 2Z6UA 5ICGA 2VS1A 2O05A 1NT2A 1NW5A 3C3PA 4RV9A 4RTOA 2HMYB 1FP1D 3CJRA 5FUBA 3HVKA 2IH4A 1VP9A 1Y8CA 4P7FA 2IDKA 2PBFA 5CVJA 1MHTA 1JG4A 2DPMA 2I7CA 3KR1A 2FCAA 4YUWA 5HIKA 3HA3A 5GP1A 1WXWA 2FK8A 3IV6A 4UOEA 4RTNA 4CWAA 5MHTA 1L3IA 4R8RA 2ZBQA 3OE4A 3MHTA 2P41A 2YXEA 3HA7A 5KVAA 3DR5A 4RVHA 2P7HA 3HCEA 1IM8A 4GF5A 2YXDA 3E7PA 4PCAA 1I4WA 1L3BA 4KWCA 5DXJA 5BW5A 3EVBA 3THRA 1O9HA 3HTXA 1L1EA 3KQOA 2B2CA 2ADMA 3P2KA 3EGIA 3FTCA 4YUZA 2BH2A 3FZGA 1ORIA 3CCFA 4RX1A 1F38A 3DOUA 2NXJA 4EVIA 4F86A 2R6ZA 3TKYA 1EQAA 5EHIA 3SGLA 1XDUA 4DZRA 2QRVA 1N7IA 4C07A 2ONZA 1KXZA 2FYTA 1NKVA 2JHCA 4IWNA 1XDZA 2JJQA 2P8JA 3GIWA 4KVZA 1RI2A 3DULA 2CMGA 3QOXA 2ZZKA 1RI4A 4MHTA 3G2QA 3ER8A 5CVEA 1EG2A 3CJQA 4FT2A 1RI1A 3BWMA 3K6RA 2NYUA 2ZZNA 2HNKA 2Y1XA 3GXOA 5HOQA 3KPVA 5EG5A 3C3YA 4YV1A 3MTEA 2IDJA 4F85A 2H1RA 3O31A 4QTTB 3UJAA 4V0RA 2ZBPA 9MHTA 4DMGA 3CBGA 3BGIA 3AXSA 4QPPA 2R3SA 4CKEA 5EC8A 5EMJA 1FJXA 3WSTA 4KDRA 5E8JA 1P39A 5M5BA 4X41A 4C08A 3RIEA 3LKZA 3FYCA 3A4TA 1RJFA 4GQBA 1XVAA 1FP2A 4QPNA 2ZZMA 5D1NA 3HCDA 1JTFA 4HH4A 3CJTA 1HMYA 3LSTA 4E70A 5KS2A 3BT7A 2C7QA 1JR4A 2K4MA 4AZWA 5JUWA 2BZGA 3H2BA 3KR9A 2B78A 4FSDA 2ZW9A 2H00A 3FUWA 5F2OA 1JSZA 2QE6A 5DM4A 3NW9A 2BR3A 2ZLBA 5DM1A 3P71T 2VDWA 1MJFA 3HCAA 2OZVA 2PWPA 4QQKA 2I6GA 3E23A 2IH2A 2IP2A 5LQCA 2IFTA 2C7PA 5K05A 5JR3A 2BM9A 3HCFA 3UJBA 1VLMA 3SR4A 2AOWA 2ZSUA 1BKYA 2ZFUA 3JWHA 2PV0A 2YUIA 5EKUA 3ELDA 4RYLA 2B3TA 5EMKA 4FSXA 2NXNA 4YMHA 2G71A 3CKKA 3MQ2A 3B7PA 2OBFA 5CIYA 1ZGAA 3G88A 4PWYA 4E2YA 3C0KA 1XJ5A 2QYOA 3EVDA 3HCBA 4KIFA 1DL5A 3I53A 4EK9A 3EEYA 1INLA 1R8XA 3M4XA 2YTZA 1KPIA 3TOSA 5K0GA 3NVKI 1G60A 2AOXA 4PYQA 4RTKA 5ERGB 3KPUA 3AJDA 3KPYA 5DM2A 2N47A 5FCDA 3G7UA 4OQDA 5FA5A 1L3CA 3LBYA 4HSGA 4GEKA 1SQFA 3FYDA 4FZVA 3FPGA 2PKWA 4RVDA 3P9CA 2AOUB 3TKAA 3BUSA 2HV9A 4BP3A 3GCZA 3LGAA 2V74B 3SMQA 2YXLA 3EEOA 2PX2A 2IPXA 3EVAA 4X1OA 2YX1A 4YV0A 3UJ7A 2PT6A 5E2BA 3LCVB 2PXXA 5EPEA 3SSMA 2UZ4A 1NW7A 5EEHA 1IY9A 2NXEA 3BZBA 5DX1A 3O7WA 3UFBA 3GDHA 3ORHA 7MHTA 1RI5A 3BGVA 4RTPA 1F3LA 2C7RA 2ZWAA 1NV8A 5HFJA 3E8SA 3DP7A 2P35A 1KPHA 1EJ0A 3UA3A 4PYNA 4GC5A 4Y2HA 3CVOA 3A25A 1T43A 5BW4A 3FRHA 5ICCA 5K0NA 3F4KA 3SSNA 2PY6A 1P1CA 3A7DA 4PIMA 5FTWA 1JQ3A 2AR0A 2OB1A 5T67A 3SVZA 3KR0A 2GPYA 3LL7A 2AVDA 5EEGA 1D2HA 1TW2A 4PYIA 3KQYA 5LQJA 3R9XB 1QZZA 3KQVA 3K0BA 1G8SA 4KDCA 1P1BA 4O29A 1NBHA 1ZGJA 4QTUB 4CTKA 2AN5A 3A26A 1JSXA 4R6XA 1SG9A 3E05A 1TPYA 1U2ZA 5EIWA 4ER7A 2QY6A 1XCLA 4BP1A 3G2OA 2V7EA 3G2PA 3LDFA 3D2LA 3TQSA 3HM2A 3THSA 4DA4A 2ZWVA 3GRUA 10MHA 2PX4A 3C6KA 3DMHA 4HGZA 3EVEA 4AZSA 3Q7EA 4KIGA 4QDKA 4A6EA 4R8SA 2EJTA 4WVLA 4XCXA 1BC5A 2XVAA 2PVCA 3I9FA 4FGZA 1EIZA 3DTNA 2AZTA 3PX3A 4P7KA 4PYMA 3ID6C 3OFJA 3TM4A 2FPOA 1KYZA 2F8LA 3BWCA 2DULA 3EGVA 3LX6A 5FA8A 2P3OA 1P91A 1KR5A 2ZBRA 3P9IA 4AX8A 3M6XA 5BP7A 4RVFA 3KQTA 4OBXA 1FPQA 1ZG3A 5GINE 3GNLA 4F84A 2PSSA 3EVZA 4EKIA 1R18A 2ZIFA 5EQJB 3KR2A 5U4XA 1YFJA 3NDIA 5DLYA 3KQSA 2E5WA 5BXYA 3EVGA 1M6YA 3OZSA 1YF3A 5EZSA 5K0CA 3T7RA 4IV0A 2OO3A 3DXXA 2OXTA 1YFLA 1Q0TA 1Z3CA 4PNEA 2AN4A 2CKDA 1O54A 3ME5A 4CXMA 3BKWA 3PB3A 4FS8A 4H0NA 5FQOA 1NW3A 3TLJA 3FUXA 4M36A 3B3FA 2C7OA 2P7IA 5DTQA 3EMDA 4M38A 4P7JA 2PJDA 1WXXA 5HIJA 3TMAA 2AS0A 1XXLA 4FR0A 3EMBA 3OPNA 3C6MA 3UJ8A 2GS9A 4BLVA 3G2MA 5E9QA 4OX9Y
chains in the Genus database with same CATH superfamily
2GZOA 3E9CA 5I9MA 2HL6A 4AUMA 1Z5ZA 3IIEA 1N92A 4I99A 4C03A 3U44A 3ILLA 5HYVA 4ZVLA 4ZZ1A 1XVVA 4B08A 2F63A 5CEEA 2XCUA 2JI7A 3TZEA 1ULRA 3BMNB 1W1WA 1OS5A 4PPYA 4ZTZB 2UUAF 1XMOJ 4TVOA 3ZBUA 1ADGA 2O5VA 3I96A 4RTSA 1O0SA 3ADPA 3KAPA 5KFHA 3QV2A 1M2EA 2BQ3A 3ROPA 1WMDA 1NSPA 3UAIA 4YT2A 5TQ2B 5D0GA 4YI5A 5FBRB 5IOLA 4DG5A 4PQUB 1VFJA 5AXAA 3ZY3A 2SNIE 2V6BA 3KLMX 4XPEA 4IQ8A 5K3AA 1DXQA 1ZU5A 1PEDA 2WRZA 3IR5B 3IT0A 1FVFA 1X9WA 2ZR8A 3KLFA 1L4EA 2MR6A 2JGNA 4XX1A 1HBMA 3WJAA 2Y1JA 1XMSA 2VZEA 1YB5A 2BMFA 2RMKA 2LV8A 4TTIA 3I9V9 2DBBA 1J2RA 1S3GA 1S1TA 2UXCJ 1LVUA 4B8YA 2R8IA 5KG7A 1VXRA 1I2ZA 1YHNA 3DFMA 1E5XA 1Z74A 2YY7A 2IIVA 4B3RJ 3WGHA 3LO8A 2QKYA 1IOLA 2CXTA 1WMAA 4KFCA 4KXFB 5I47A 2XVXA 4MPDA 4QGHA 2WHYA 1G5QA 3W05A 1UZLA 2W22A 5HCNA 4IKAA 3FEYB 1T0UA 4A8FA 2BFCB 4ZA1A 4TXHA 2MYNA 2MYUA 4ECEA 1LW7A 3FNQA 4GKJJ 4BEJA 4RNOA 3H20A 3DLGB 2Q41A 2ZBIA 2O2ZA 1R0ZA 1P0QA 1QX3A 4Y28C 1K66A 1U1DA 3C43A 2NVUA 3H5IA 1JHRA 3BAZA 4JI0F 2O0HA 3F6YA 2HQDA 1B3BA 1NY5A 1JB1A 4LTMA 1FP1D 3VC7A 4PWDB 1Y3JA 5BW8A 4ZZ3A 1P2BA 2MYTA 5GP1A 2CHUA 2XS5A 4ELTA 4AIIA 2CEAA 3HLTA 2YQ0A 3CKYA 5HK9A 3ZKWA 4W1QA 1XZ8A 3PJEA 2VPQA 4WIQA 2R6ZA 4GI5A 3UXEA 2C2KB 3A9VA 2XUJA 1IK6A 2E3JA 2K2PA 1B73A 1XF9A 4KQHA 9ATCA 2AWZA 5AFSA 5JDCC 4P2XA 1NDUA 2P62A 4OYMA 2CFOA 3BGIA 2EKLA 3GHHA 4X92A 3EPHA 1PJCA 5M04A 4AQ7A 1OI4A 4EI2A 4KQEA 1TLFA 2JGIA 2ZD1A 2Q1XA 2ZIZA 1L5SA 2ZLBA 4KE6A 2PGIA 1PJQA 1VMAA 4FGWA 1Z8NA 1LSOA 2HJGA 5IV4A 1PVDA 1QE3A 3BCHA 2FEKA 3ZOZA 4JJZA 3F78A 4P5DA 4P74A 1DT5A 2JB9A 1S0OA 4BIIA 2VHTA 4CV1A 2VNSA 1YQHA 2JNJA 3QQCD 4ZO6A 4B34A 1H1LB 1L8LA 4Q16A 1WF0A 5AESA 2WONB 3AT1A 1G4HA 3EIHA 4M8KA 4X66J 2GN4A 3SYKA 4MV3A 5AJYA 2WFZA 1FY2A 3GMGA 5KFTA 2ZJQQ 5G0SA 1ZGJA 5IN4A 3K1JA 1NXTA 2AZDA 2DR5A 5GVQA 3LPYA 1NJFA 4RHTA 1JEAA 4HEQA 2HIYA 3O1LA 1Q84A 2WNSA 1KE1A 3BG5A 1HFEL 3G1UA 2PLNA 2CKDA 4CXMA 1XXHE 1E2HA 1YNSA 2LDXA 3T35A 5K0SA 3BTVA 1MKYA 1I94J 4E0BA 4ZTUB 2FLVA 2A5LA 3LUKA 3OY7A 1P3JA 3PW4A 4CKBA 4EL0A 1X3LA 2G4VA 4B3JA 4HJRA 3NAHA 2R7NA 2R8GA 4L28A 2ORWA 4DR4F 3Q5DA 4IDCA 3MYYA 4KFTA 3MEEA 5ALTA 5FB3A 1NN0A 4LCEA 1E6KA 1Y8RB 3B3GA 4HVAA 2X1MA 3OSZA 5A3SA 3UZUA 4H2DA 1JXMA 2IPLA 3AY0A 1O95D 3GQBB 1UL1X 1XIQA 1U98A 2YV1A 3HSJA 1SWVA 3UM9A 1F5AA 3RZAA 2DQZA 2P9GA 1OFHA 2N4DA 3REQB 3EXHA 3OLXA 2P2SA 4MFBB 2BMBA 1J23A 2EWHA 2NU8B 2N42A 3NEJA 3R7WA 4G8BA 2OLJA 1RQ2A 3TZBA 2WB1D 3BEGB 1GRNA 4IV8A 1KP3A 2VHYA 2X0FA 1ZU4A 3NDPA 4ZPCA 2BAGA 3EEQA 2C2MB 2NACA 1IJKA 2OLEA 4BWJA 2W4DA 3GLVA 1WC0A 2EFPA 3HHLD 4R31A 1JKJA 5HCUA 2H1SA 4JXZA 1WDMA 3TTXA 1BKSB 4M4SA 1WJ9A 2BE9A 3KCNA 1G8AA 1CUJA 4UEQA 2VBFA 3KSDO 1A4IA 3H2KA 4PLHA 2Y1KA 1J22A 2QR5A 3G2NA 2VJNA 1MW7A 4YN3A 2H1YA 1WTFA 4CF6A 1A0OB 2YCBA 1AIPA 4K4XA 5DMXA 1N2BA 1IU9A 4R7GA 9RUBA 1C0TB 3C6QA 4AO7A 4CTMA 2Q3LA 4PHHA 2YVKA 3R3YA 4IYJA 4IOCQ 1GL7A 1BMQB 4QEZA 1SQWA 4KUGA 1K9SA 2WJ6A 3V3KA 5J2NA 4KSBA 2LQ9A 2RQCA 3NKYA 2YH2A 5FFMA 5JLJA 3LM8A 1OFTA 1ZNWA 1T2DA 4NLOA 3T1TA 3GG0A 4IEEA 5C1IA 2QZ9A 1ECCA 3H42B 5GOTA 3LY7A 3IXLA 1ECPA 3PNSA 1ESCA 3KTOA 1JLFB 3L40A 2G9NA 3SCJE 4O8ZA 4MDEA 4JI8J 3F90A 1QUEA 1QHHA 2GPWA 2E4YA 4V1CI 3E22A 2H08A 5HVFA 4LF8B 1U4NA 2O5RA 2FPKA 4QU7A 3AB4B 1OQAA 4JS0A 4PQGA 3PC3A 4D80A 5FR2A 4XX0A 5JC1A 3MPUB 1Z2PX 4RDCA 2EEYA 4D4HA 4FKMA 4DSOA 3S8YA 2Z43A 2DGDA 1QPZA 2ZKIA 1GXSA 4IQMA 3IV7A 5HF6A 1XBTA 1XXHB 3CT4A 1FX1A 3P5TL 3WXBA 3KQOA 5J43A 5KSZA 2VTKA 4BBYA 3IMQJ 4TXMA 3QU5A 2AMYA 1C1CA 4G0WA 4G5QA 3C2PA 2C9DA 2HIMA 1KTVA 1T26A 3D02A 5KT3A 1LDEA 2CNWA 3P9SA 3IUSA 2B99A 3MMCB 1NU4A 4TGLA 1ZI6A 1TIPA 5IVDA 1IIBA 5LP6F 2YV4A 3FMOB 2O2IA 2VYVA 4JOCA 1JDZA 4EIWA 3QKIA 4HQ0A 5BUSA 1DJMA 1ENOA 5DYGA 2R60A 2DIVA 5B3JC 2WM3A 5DGXA 3URKA 1JQ5A 2MIIA 4CLWA 4ELUA 1DG1G 3OIUA 4IL5A 4X1IA 5AUNB 1GMVA 4J0FA 5IC5A 2I7TA 4X7BA 3TN7A 3N2GB 4LBYA 1QUPA 2WVHA 2WAOA 3W8NA 1C50A 1B99A 1FKOB 3TOSA 1S77D 3SFVA 1ZCBA 3CRMA 1KK1A 2P9TA 1TFUA 2O8CA 3EQ2A 3BGRA 4IMIB 3QRWA 1RQNA 3TXYA 1Q82T 3ND9A 3Q8LA 2IC5A 4FYYA 3AJ1A 5SUHA 4H54A 4TSFD 1BFDA 1S79A 3DOLA 3TZKA 1NAIA 4MKHA 3T12A 1JN0A 4YLYA 2ZC3A 4R40A 1AKQA 1YS4A 3COJA 4DCNA 2GMHA 5LFAA 1XJCA 3WWOA 4GAEA 3WHLA 3L1UA 2YXPX 1QR2A 1EZ1A 4LOJA 1RZUA 4V1Ak 5CURA 1L7RA 5ADUS 3A1EA 2H4WA 3FBWA 3PQ5A 4BLOA 1YKWA 1BYUA 4IMRA 3NYQA 3GNLA 3CD0A 3O44A 4JV5J 4ACAA 3FMVA 4ZI7A 1JQGA 4RDHA 2Z4RA 5KWIA 4K4YA 4LFCJ 1TIKA 3W34A 5CIQA 3NY0A 1SFRA 2A0WA 2AGPA 3A8EA 4FE7A 1CY0A 3EMBA 2NSYA 3FWZA 2OEPA 4YP3A 5HAOA 3DVAA 4WEQA 4PZUA 2ILVA 4JJIA 2ONYA 3LBNA 4KSEB 4ANFA 1IKYB 3NHBA 2OQRA 2P3QA 1XVLA 3ZH9B 1U6JA 5FTKA 1A7UA 1N8SA 1FRNA 1KO8A 3MM6B 1XJWA 2C2NA 3ZLVA 4EARA 5IM0A 4Y6QA 1Q12A 1C7RA 3HT0A 1P0MA 2B4PA 5FL3A 1E0KA 4D3FA 3GA0A 3LOQA 2H1HA 4JLVA 2D69A 3AQIA 1E9VA 4PRKA 1BIFA 3IUBA 2ZSKA 1WMEA 4XDCA 1GA6A 5EHGA 4DBZA 4Q9DA 3VM6A 3OZIA 1K3TA 1A69A 4GI3A 3A11A 2A0KA 5ICFA 4Q3DA 3X1LB 5DTIA 4NOHA 1XDGA 2VPWA 2CZ9A 3QLTA 4MMOA 5B37A 3IXMA 4XB6B 4B6RA 4FHDA 4EY4A 1R5JA 3RT9A 1AVTA 3LXRA 4MVJI 5HQ8A 2X15A 2XIJA 5JVHQ 2D41A 2PIIA 3U7QA 3PGVA 1ZC4A 2CPFA 4DPYA 4EY3A 1SMKA 3GJ8A 3SYLA 2GWHA 4K40A 3KAQA 1E2UA 2IYUA 2HCTA 3B1JA 1J2EA 3EX7B 5CXXA 3QE0A 3NVMB 1NHGA 3J7YI 2O54A 4YUDA 3MMAA 1QP7A 3LUBA 1NI3A 5BVGB 2R7QA 1KFKB 3UR0A 3H8WA 3EA4A 1RSCA 4MVCA 3QKRB 4FFWA 1AT1B 2BEUB 3IR7B 1NK7A 2H48A 5LSRA 3TVKA 5CK5A 1JJHA 3BXZA 2UP1A 3K1AB 5ENVA 2I9KA 4ID5A 1G16A 4XSGA 2W70A 5LBTA 1IXKA 1SQGA 2H3HA 3H0PA 1XV5A 4R1MA 5IANA 1EA7A 3FMBA 2PXHA 1RSZA 1Z6XA 4GSLA 4QPTA 1LS1A 4HT5A 4X63A 2GA9A 2ANCA 1AV6A 4ZYUA 1K4MA 1TZ2A 1UPAA 4E46A 4KW7A 1HH4A 4YRIA 4PX9A 1X7VA 3N9IA 4NK4A 4PTLA 2GFHA 2ZI3A 4MCHA 4JX9A 3LRTA 2HQGA 4KC0A 2HHQA 3IERA 1E6UA 5HMXA 2DC1A 1HBJA 1RJWA 3SJAA 3R3XA 4Z7NB 3SS7X 5A2QA 4DJAA 1CIJA 2BANA 4EUKA 1MOQA 1VI7A 2JLSA 4DX8H 1A95A 4BKRA 1LQ9A 2GGPB 1NZ8A 2VDJA 1O6XA 1AUVA 5K8UA 3J81k 1LQTA 1SZDA 5JW6A 2XNKA 4KXVA 1XYYA 4O02B 3W6UA 4CLOA 4LSZB 4BLSA 1SK9A 4OJKA 4AYBD 4C4TA 3PYXA 3GHYA 1GILA 2BGIA 3ADDA 1U1EA 1EJBA 3NPMA 5H7XA 2JLWA 4DA7A 4LRCA 1YRYE 3IP8A 3K70C 1ZCZA 1NAQA 4XKJA 3A37A 2V54A 13PKA 5H80A 1FP7A 3K9FC 1VRTA 2V7TA 1Z75A 3L82B 1VGVA 1RAGB 4W7IA 2Z09A 3POTB 4D0GA 2WR8A 4II3A 2HUPA 3NO4A 1XZAA 5K3OA 3HHNB 3M3HA 4QGGA 4WCDA 4AD6A 1AS2A 1J49A 1E2JA 3E23A 2AEJA 1RRFA 5BNWA 1BKYA 1E4YA 4LE0A 4BMSA 2Y0EA 3HBAA 4YAWA 4MI3A 3GV7B 1TU3A 4CEIB 1YFKA 4FOSA 4EK9A 4LRDA 3Q0EA 4IEFB 3CUWA 3W65A 3AEUB 4KTQA 3L1JA 3A6EA 3ZVRA 2JVRA 3RAGA 1XQVA 3C6ZA 3SQWA 5IW8A 1GPKA 3A6ZA 1G1MA 3O3LA 2W93A 1XWWA 2HPZA 4XJVA 1K97A 4PIMA 2WD8A 4J7UA 5FOXA 2GQQA 5J1EB 4K6FA 1TZJA 4ZICA 3D8HA 4WXMA 3T7AA 2UZ0A 4WCFA 2QIOA 1RTKA 3UJNA 3MECB 4UNNA 2ZR7A 3NTRA 1JHMA 1TYAE 1Q22A 3AXKA 3I9FA 4YP7A 4YT8A 3M4ZA 4TZTA 1Y7IA 3D9QX 3SI7A 5HF5A 1GY8A 1A8IA 1XNQJ 1V1MA 2C2OB 3GJRB 2F9DA 1HLDA 1Z8FA 3DRSB 4V1CB 3FMWA 3TMAA 2WSIA 1S0NA 4RF3A 1K6JA 3BIXA 2XYGA 3EQ9A 3M34A 8ABPA 1PGZA 2RAQA 2NUPA 4E5DA 2YPZA 2W4QA 4IUDS 1HDZA 1LRKA 4ZEMA 3R2DJ 4MKRA 2G88A 1FFYA 2D3TA 1RT2A 1J2VA 2P1DA 3HAXA 2Q9CA 3CFYA 4U7TB 4XLZA 1ADJA 1QGOA 3DPSA 5ALDA 3VF0B 2FFBA 5C3UA 4OHXA 3CD5A 1NW4A 4MDYA 1NNUA 4MVJE 1X19A 3KJIA 4C0QC 2XCQA 1I80A 2BISA 4Z7JA 4MV0A 3UHOA 1CUGA 3V6KA 2H92A 4BZXA 4Q3OA 3TZZA 1HT0A 3UYLA 3EDQA 2C29D 2QD3A 5EHNA 4DKJA 3NAIA 4Z4QA 3ZZNA 3PI7A 1ISRA 4UBMA 1QIEA 3IE0A 3OU6A 4X62F 5KNCD 2ZSIA 3RVDA 3DAFA 3G71S 2YHSA 1E7SA 3G2HA 4XVRA 3K5IA 3LWLA 1ZHFA 1V2GA 3L0OA 1I14A 3GFSA 2EBHX 3PWZA 3VU8A 4B35A 2O66A 2QUIA 5KSYA 3EIWA 3WQSB 1QQBA 2Z1DA 3TAMB 3IOYA 2Z83A 4L22A 5EVJA 3I87A 1HPLA 4PEVA 4KKOB 3A0RB 1YDFA 3QUAA 5HKOA 1G59A 4UE6A 4CL3A 4QJ4A 4IGAA 4QQRA 5EIAA 3DXYA 4RIEA 1IBKB 3GLFA 2OSRA 3EUWA 1GTZA 2FYXA 4C7OB 2F4NA 2XMTA 1ZVJA 4BATA 4GOLD 4MUGA 3VU9A 3L04A 4CLKA 2V6IA 3M6UA 1PS8A 4JI2F 4O0NA 4D44A 3US5A 3KJVA 2VYCA 3ZZMA 2D4HA 3DBLB 3OZAA 5KINB 3NETA 1U31A 2IF2A 1O96B 5HA5A 2QZZA 4EYEA 1Q11A 2EQAA 1JFFB 1GR1A 2IF0A 3DTYA 4U7PB 3WNBA 4QBGB 4KIAA 3PXGA 1SWWA 1AKYA 5C46F 3ZBTA 4I2PA 4Z1MD 2JIQA 5ULLA 5AM0A 1HFWA 4D9CA 2EZUA 1RRMA 2WF5A 2IXDA 1Y8AA 4UZBA 5E4TA 4BMDA 3BIWA 2WUFA 4N56A 2Q4DA 3STUA 3R41A 5H02A 5IHPA 3U37A 3ILHA 1YDLA 4M1MA 4ESVA 3GCWP 1S2LA 2EFNA 3MGKA 1YLXA 4YRRA 2WG1A 2YW9A 5AVSA 1E1DA 3VR5A 3VV2A 4JQSA 1L2TA 2DD8S 2B20A 4FR2A 2JHCA 2Y0DA 2V34A 5HVGA 1DLOB 4J1SA 3TDKA 3LQVA 1MN7A 1BWSA 4UBKA 3IAS9 2A5FA 3KWJA 3JY6A 3TI9A 4QZVA 4M0UA 2A33A 1VC0A 4BMZA 4ILMA 3GYXB 2WPNA 4TYMA 3JQAB 2OMEA 2GK3A 2VRCA 1HY3A 4QSHA 2A88A 3FRZA 4AKSA 3H8VA 2Z4PA 3SSSA 4N47A 1MXHA 1P6XA 4G1FA 4ZT2A 1ODCA 1J7JA 4CE6A 1J1UA 4Q0BA 4DSZA 2OYCA 2BC9A 2HV8A 2P6SA 5DKFA 1PO6A 2YQ4A 4RVDA 4OZ5A 4A0QA 2OESA 4ZVNA 3IL2A 4EZBA 3I0NA 5CG2A 2I5JA 1DARA 3OJWA 2IELA 3EQ7A 1M8JA 1HYSA 1TO2E 1QFYA 4X45A 2HQRA 4WMLA 2IZ0A 1HC7A 2PY6A 3ZGNA 2AR0A 3TSAA 2ZE2B 3LL7A 3DHVA 2QL9B 3GNSA 4N7TA 5M2UA 1Y9AA 1YZNA 4IF6A 2ZTUA 2GPSA 1XCLA 1DAHA 4R68A 1RMQA 2VTVA 3E7DA 7YASA 3HXOA 4BMCA 4AZ0A 4FYXB 3SKVA 2WOMB 4EHFA 2WTAA 1R3NA 3HO6A 3RS5A 3Q1LA 4EGLA 4R83A 4YGXB 4J9LA 3B20A 5F9HA 4KV7A 3O90A 2GCNA 2QFJA 2CK3D 3FKBA 1E92A 3D5MA 4PUOA 4N5LA 3R3UA 4DLRA 5A7GA 2BMDA 1N5MA 2HXGA 2J32A 1QP8A 5IX8A 1J20A 4U39A 3ZV4A 1ONSA 1Q0ZA 3CO0P 2OCGA 3OVSA 1CUIA 1JAZA 3C6YA 2Q6KA 1QP4A 1GQQA 4R8UB 5FLYA 4ZVTA 4Y1FA 2UUOA 1XZCA 3OLWA 4YHHB 4DX7A 3DE3X 2VL7A 2B8JA 3DA8A 3I72A 3VR5H 3G6WA 4OLFA 3QEJA 1Q79A 1LK5A 4Z2XA 3QHQA 3M4JA 1U6KA 1SUQB 3W4KA 5E9JA 2FXIA 5LQRA 1Z4JA 5LQKA 5LM7E 1WCXA 1PQ4A 1E1NA 2FRDC 4WGFA 4FHFA 5IYZF 4F21A 3I5BA 1T1EA 2E9RX 2FEWB 1YJWS 3Q2KA 5A7FA 4RESA 1US8B 1YVFA 1XC7A 2BFAA 4E2ZA 2EG2A 5KZMB 1TIBA 1TM2A 5FADA 1UPMB 3O2QB 1BO6A 4MQFA 3TCNA 3WQPA 2ABWA 1MNEA 1CJCA 4P92A 2FGCA 1XKTA 2ZJAA 3HI6A 4B6PA 4OQJA 1CF2O 3GT0A 2P0YA 2V8GA 4GNRA 3GC6A 4LPSA 4B3TJ 1ETUA 2EKZA 1QGED 3EFHA 2GMWA 4Q02A 3PCRB 4PLYA 4MT1A 4XVQA 5JVDA 2PUHA 3FBFA 4CR6A 4WXEA 2C2GA 3H9CA 4R71A 2DNOA 2HY7A 2CVZA 5HQ3B 1XQIA 4L73A 1JIKA 4EF5A 5E38A 3TJMA 4YFVA 4D9GA 3LMKA 1VQ9S 2ALZA 3FJOA 1Z39A 1KPGA 4FDTA 3O94A 4RA9B 1JLAA 1ONNA 2FF5A 5K03A 3FNNA 4C87A 1RQXA 2J0XA 3G8SA 3DDUA 3ZWVA 3PPYA 1TX4B 1VBYA 1D6JA 1TR0A 4MQ5A 2CC2A 5CXQA 3V4RA 4L3OA 2XGJA 2E5IA 1F2TB 2VOOA 1H74A 3O3CA 3E81A 4CIDA 2GERA 4FPIA 2K8GA 5D2CA 3D6NB 3WLNA 1EFAA 2JJ1A 1S12A 1S9GA 4TQAA 3WICA 4G5YA 4YRBA 2Q29A 5I4MA 4Y2IA 1P8GA 3LQ2A 2HXYA 1D3WA 1SXJE 2ZM6F 2NAPA 2XB9A 4CBVA 2ZCJA 1BQXA 2CCGA 3TJZA 4NMWA 3VVTA 3B4MA 3TLMA 4YMVA 3QI7A 1UBTS 1C7EA 1MXFA 4NYMR 5F41A 3OAAA 4L27A 4LGVA 5G4KB 3O4GA 1TELA 1I7SB 2OO5C 3WRYA 5LIPA 4DL7A 2R68A 1IKWB 3KKEA 5TJHA 4LF4J 4OU5A 4LYAA 3W5CA 4A7PA 1OIAA 4F2HA 3DL0A 3I31A 1LSJA 4U9HS 1XMPA 3N0XA 3RANA 2OV1A 1XEAA 3KZKA 4YCDA 3UENA 3UVJA 3QF4B 2WWHA 3EF3A 5K4HA 3GLUA 4OG2A 2E18A 5DDRC 4I7FB 2JGDB 1ZRSA 4MS4A 4OX9J 4HUQA 3LAMA 4ZO8A 2V6JA 3TG2A 1Y1RA 2Z30B 2PV0A 1HNXF 5A2GA 2BACA 2VV5A 4UM8B 1LBSA 4UHHA 3AB7A 1JBKA 3GL9A 2QYOA 5KU1A 4LYYA 3R1HA 4BO5A 4ESEA 4ZCIA 2QT9A 5FA5A 2V8PA 3MRSA 4X65J 5DULA 1P6TA 4BVLA 2H9IA 4O0LA 3HY4A 4M9XA 3L8MA 3KUDA 3AOEC 4E4RA 4Q1AA 1PSZA 3I55S 3QEMB 5KQPA 2ZUBA 4J0JA 1EJ0A 2HAFA 3RYCA 1S7CA 4HNTA 1JQ3A 5BYBA 4AE5A 3M8PB 1QZXA 4QRIA 3OM1A 2J6CA 1JLLB 4C89A 4WZMA 3G96A 3ZV5A 4ARBA 3GD7A 2XW6A 2XMJA 2XSZD 1Z36A 3PX6A 3W2WB 2QBYA 1MO3A 2F9MA 3EZ9A 4DV0F 4F84A 4DV7J 3KYCA 4RCVA 5DVZA 1NVGA 3PTZA 2JBHA 1GGFA 5KCMA 1AHNA 4RELA 3PQ4A 1UWLA 3NQ41 3HB4X 2MZ1A 1FDOA 2AJDA 4JI6B 3RH0A 4QREA 4JVOA 4R1QA 3GJ3A 3IS3A 1TL7B 2VUHB 3H2HA 2OBBA 3D1QA 4C6AA 3T5BA 1ZPWX 2ZJ0A 4EG0A 3U4HA 1SKWA 4GRIA 4JL5A 3B85A 4EYOA 1AN9A 3UAYA 4DLYA 4I67A 3ZWDA 3D6AA 3M32B 3HXMA 1B16A 1RR6A 2C07A 2VYNA 2J41A 4ZOEA 4OHPA 1YZYA 2IDZA 1VQ8S 2DETA 5JYDA 4YDQA 3ZE0B 4I2NA 3AR2A 4CO2A 2FOXA 3RLIA 1SXJB 4BCAA 1POXA 1UBLS 3ICOA 5AI5A 5LXYA 4GOND 8RUCA 3OBIA 2VQFJ 4CKEB 4EDFA 2NZXA 2MDTA 2XNDA 1QRUA 5JTTA 3OIVA 3AP1A 3S7ZA 4KWHA 1Y4ZA 4A6PA 2Z58B 5DDQC 4MUXA 4OJHA 2ATVA 4KAIA 2GYYA 2YZGA 2O8NA 3SE7A 1C3OA 4QJIA 4LTNA 3BIJA 2KXNB 4GWKA 2ZIEA 1PW7A 3Q23A 1KR2A 5RUBA 1RW4A 1NH8A 1N6PA 2FHJA 2Q8NA 2ZBEA 3Q6MA 3H59A 2OCIA 3E0XA 3CZ9A 5FUVA 4TWAA 4WTOB 3OA2A 3AXMA 2ARKA 4F60A 3NP5A 3V4LA 3HZEA 3WOVA 3S2GA 4MLCA 3QBVA 1MJGM 5LBIA 4WKRA 4TMWA 4PR3A 5K01A 5K99A 4LUCA 1EG7A 2CXEA 5GAEI 2PSJA 4HRAA 5CT5A 3QGGA 4XWWA 4WXYB 3KEQA 3Q83A 5KWEA 3CH7A 3HXQA 1WP9A 2QQ5A 4GMHA 3N70A 4WKNA 5KQGA 4HH0A 1Y5LA 3TZQA 4GLFA 3HB0A 3A12A 3EK2A 1OIVA 1UIRA 2IP4A 3RHFA 3QLUA 4R5PB 3NTVA 3M70A 3G8YA 1P72A 4D4KA 1WEKA 1SIWA 2DH9A 1O5IA 2NO1A 4XSVA 3I42A 3U27A 3W2HA 4B3GA 3QBCA 5IC4A 2J8SA 3RR2A 2Z8ZA 5GONB 4Z7OB 4QYXA 1F2HA 1GEGA 5KG5A 4POAA 2XNHA 4H4KA 4HYQA 1NR7A 3M1LA 5AXNA 3BQNB 1VQMS 2OI2A 1NQWA 2BMWA 2W4PA 4NJMA 3LK7A 3KBBA 1QG0A 2AZ3A 2J8AA 4DBVO 5FUBA 2GFFA 5DBEX 5JECA 4WFNQ 1JLEB 4G0MA 2CZCA 5GADl 3C87A 1Z0DA 2YL2A 4DR7J 5D6OA 3T54A 2QRNA 2J5KA 1H0HA 3HKBB 8LDHA 3T5HA 3KQUA 1NRKA 3NTOA 1DIGA 1SVIA 2Z4TA 1T3LA 1T3GA 1V96A 4D8UA 3CJQA 2ZTSA 2VJUA 3VR2A 5H3LA 1BU8A 5M5BA 4HY3A 4UJ5A 1HYEA 3KHHA 1PCXA 2GESA 4Q5VA 5J9FA 1V4VA 3TFOA 5KOHB 4DLXA 1ZHOA 4KB7A 5HE9A 1SBHA 1T4CB 2OZVA 2RK6A 4BO0A 2AKEA 2GBLA 3MK31 3H1FA 2YUIA 1BY9A 1RWXB 4QATA 4KSCA 5HVHA 6Q21A 4OCZA 1DL5A 2DU8A 2HPUA 5CIWA 3SSRA 3GA5A 2BEJA 3AM3A 4EI8A 4PSUA 2YBDA 2CXQA 3LBYA 3CX6A 3D1OA 3NTLA 2SKEA 3RD5A 4MUNA 3S01A 4G86A 1FRLA 1N34B 2ZS9A 4DL0C 5JZSA 1WQ4A 3WGNA 3AFGA 3DP7A 3KL2A 2OGSA 2PGNA 3I6IA 3MM8B 2FWMX 1NVXQ 1CB7A 4OJYA 4NQZA 3P0RA 1YZUA 2QZ8A 1XMJA 2KFZA 1DKQA 3I32A 1QQ6A 3D2LA 5FUMA 2DQKA 2DJWA 4B3CA 2YJ4A 2ZKUA 5ITSA 4D9KA 1N5YB 5AR1A 3EW9A 5H9WA 5KFIA 5B3KA 2RQKA 2INGX 3DHYA 1HYGA 1MSWD 1M6YA 2PZLA 2AN4A 2EFGA 2WW8A 4QODA 2MMYA 2BPOA 2PKEA 4MJKA 3RYIA 2GS9A 3EN0A 2QA4G 2HRZA 3ONVA 4PZDA 1ZUIA 5EWJB 4IILA 4KE7A 1YH3A 3QVOA 4RV5A 3D28A 3OZWA 4I50A 1B0PA 1XVIA 2GAJA 3KZCA 2VOPA 4JV0A 4IDAA 4ZPTR 1A96A 4G36A 4HDNA 1H7XA 3OPMA 1ZD4A 3QOFA 1N2IA 1A7JA 2OFWA 4R1UA 1CVLA 4LF7B 2PZGA 2GW8A 1Q95G 2GVDC 3WWCA 5F8IA 2GLUA 3QU4A 2PT0A 2D3ZA 2OG1A 1LNQA 3WLIA 3VZCA 2EX1A 3PJXA 5AKHA 2J7WA 2W1BA 2W01A 3A1WA 3PFOA 2J0SA 2LKZA 4BNTA 3C39A 4DREA 2DHGA 1NRWA 3K8WA 2GXUA 1T0PA 3RJZA 3QP9A 5B1YA 1CQJA 1R5NA 2O2DA 4EFAC 1N5VA 3H1AA 1BRTA 1TB4A 2XB4A 4K3UA 5TEVA 2WOOA 4ECWA 2YUTA 2WBLC 4YBZA 4GZMA 2YFKA 5G0VA 1CEXA 1VG9B 3SE0A 5CVTA 1O4VA 5GGYA 4C2BA 4C21A 1SIUA 1E77A 1T1RA 5LQMA 4CIAA 1AQUA 4DIUA 4A0HA 2HBRA 4Q03A 4ETWA 3FC9A 3VAJA 1YZFA 2HIQA 1GO2A 1UJNA 2QLMA 2I6UA 4Y2RA 1LNZA 2UXBB 3PHGA 3OSNA 4DUGA 3EPLA 3PRHA 3THWA 4Y9DA 1ECLA 3MJDA 3ZI0A 1RXVA 2XZTB 2CCKA 2WHQA 1E9DA 5A6WA 1R0RE 5IDVA 2IBMA 2Q79A 3M8YA 1JSRA 1AS0A 1HNZJ 5JY1A 1DEXA 1XEFA 3M3DA 2DLNA 2JHGA 3C8MA 5JAQA 1M8PA 2P68A 3FVTA 1W35A 1NVWQ 3MS2A 5JVDF 1E9BA 1GRCA 5JY6A 3N5CA 1NZAA 621PA 1TZKA 4EI7A 3CC2S 2JHEA 5JTUA 1XROA 5C7YA 5ER9A 1PL6A 3SBXA 5EMMA 3KEOA 1WTCA 2H11A 4DTIA 3P2EA 3HPRA 3DLEB 4WFJA 1RPTA 3ODGA 4XQGA 5FWXA 1RFGE 2R62A 4QBKA 1C2TA 3K09C 4C6TA 3N6MA 4FYHA 3D0IE 1SQ6A 5FV4A 4CW7A 2XCLA 4K4TA 4S1WA 2X5NA 4AO8A 5IJXA 3M7VA 2AC7A 3LU1A 2YV3A 4F86A 2FW9A 4FMCF 2KFYA 4COOA 1VDZA 1II9A 3MBKA 4WZAA 1KMNA 2JLZA 4DA0A 3VKGA 1PJ3A 1SQSA 2KH9A 1DEOA 2Y1XA 1O3YA 1YMUA 4QPPA 4I4LA 4JP2A 4DV4J 3FYCA 2OAEA 4IRUB 3T9FA 3STHA 2CXOA 4Q3EA 3P49B 2BZGA 3IE1A 6REQA 3J80U 3I52A 5K3EA 5LLTA 1SH7A 3ZWAA 2RSQA 4IUCS 1RT5B 2C7PA 3JQCA 4QW9A 1KU6A 2Z2LA 1O2DA 4ZPAA 2X1HA 3J81U 3CUTA 1IL0A 4NXMB 2VR1A 3M4XA 4XASA 3QLHA 3W5SA 4GEKA 2RS2A 3L41A 4NXNF 4LZZA 3ZC3A 5SICE 3QUBA 5GMEA 3WNCA 4NBRA 4BGDA 1X1EA 5FOWA 1E59A 3RHTA 2QL5A 3A1YG 3UYKA 3KJGA 3ORHA 1O7JA 2D0OB 4WWHA 4IJ5A 3TZ6A 1P31A 3WWYA 2FF7A 2I87A 3OOJA 3FRHA 1NYQA 4BC9A 5E7QA 4P98A 3GR0A 5JCZA 1EARA 1HDOA 4CI3B 4MWGA 3RYHB 5F4BA 4L51A 5JMWA 1DI0A 4OFBA 4KH0B 4K8OA 1OLXB 1CS0A 2ZH7A 2JAPA 3ZGVA 2JJYA 4F4CA 3HM2A 3A6KA 1S59A 2G80A 3GX1A 3IKJA 2XVAA 4WCFC 1V35A 4FGZA 2X3GA 2PZJA 3ESXA 3PNMA 3ONDA 2ONKA 3MUOA 3P26A 3PC8C 2Q7OE 1BXKA 1NOJA 2RIPA 3ABZA 5EJ6A 3LQYA 4DCUA 3L9ZA 2LQ8A 1U4OA 2J6TA 1GIAA 4YLGA 1ND5A 4C2UA 3EC7A 1O6ZA 4ZDIA 1C3LA 1SC1B 3IBCA 4BLUA 3L3BA 2ACWA 2ZT8A 3NYIA 5E0OA 2HSWA 3MGJA 4G5GA 3HLKA 3LVQE 2XR1A 3SEQA 3WYEA 4L8GA 5KDLA 5J2TB 5ARDA 4CZ2A 5KJCA 1UWAA 2A6MA 1MA0A 1JV2B 4EHBA 5M3BA 1CSEE 3P9NA 4TROA 4HPJB 2IE0A 3DGPB 3C2QA 2E21A 5LMZA 2XO7A 2Q2QA 2B43A 1CJKB 5HNKA 4Q4HB 3MAAA 4KPGA 5IT9Y 5D77A 3C24A 3OQ2A 2BFBB 1W9MA 3WLQA 5C8VA 4XAQA 2W8ZA 1RWNB 3DRXA 4JK3A 3VV3A 3BRCA 3MW8A 1WO8A 1UBEA 1PV1A 1EETA 5E33A 3TRDA 4RLSA 3NBYC 3G1TA 4M53A 1HL7A 1LQ2A 3ON5A 2VUUA 3MTBA 2L08A 2Q0SA 2RBGA 1BXGB 3K0AA 1F7VA 2C3UA 5DWDA 1I1QB 3T61A 5JHHB 4DHEA 1MAAA 3L8FA 2RGWA 2QMZA 3WVNA 5FLXA 4UTZA 2I2WA 4CZCA 5A4AA 2FQYA 2EP8A 4YRCA 4AY6A 3ET5A 4ENTA 3HN6A 1U6IA 3ECSA 3OXLA 1U99A 2RGAA 4RBNA 2AYZA 2OD7A 4FBGA 1DADA 5D8DA 3NEAA 1Q1NA 4YO8A 2GHRA 2N9UA 3JVDA 2ZRJA 3NXKA 4LDRA 1WULS 2IU6A 1MROB 4D4MA 3B1FA 4C8LA 2QI9F 1DV1A 2QJWA 2QLJA 1F60B 3GO4A 4MAKA 1KI6B 3GZNB 5KMGB 1W9HA 5KFXA 2ZUUA 1PAUA 4HWRA 2WKSA 3PNVA 4NECA 4DCJA 4DQDA 5K3DA 1SD1A 1ENPA 1NSYA 2P40A 2WHXA 3BJZA 1YZHA 1FJGJ 3BH6B 2Z56B 4LF9J 2RHOA 2GCIA 5HROA 3T9EA 2RSLA 3PR4A 1LW0B 3UO8B 3FKSA 3N4WA 3OT5A 2IYOA 4ID9A 2WHPB 2IIHA 4IINA 3H7IA 3ZU3A 3DM9B 1NCLA 1FFDA 1RYNA 1HQCA 4ANCA 1FUEA 3SEFA 2BHRA 2KG1A 4WOBA 3QG5A 4Q9HA 5ALFA 2Q2VA 3K20A 4US1R 1T03A 3SAJA 5BQ3A 3EPKA 2LW7A 1RA7A 3I61A 1M5OC 4ZKEA 1WB9A 1L3BA 4Q15A 3W5ZA 4C7KA 5FIUA 2F55A 4WBFA 4OMCA 4JYAF 4IUYA 1EHWA 4A8KA 3GPDG 4V0SA 4C8MA 5AKEA 2FHOB 5D5QA 3OVMA 2D2VA 5HOQA 3TTSA 3N8HA 3SKXA 3T1YB 2YNMC 4NJOA 1V6SA 3GLGE 3E3MA 3ZIAD 1L4YA 4KQ9A 2IM3A 4USVA 3D2CA 4BWGA 1KF0A 3OUUA 3KR9A 1V7PC 1J06A 2GJ2A 1YB6A 4GPZA 5DM4A 1B4DA 3TFQA 5BNTA 4M6WB 1B76A 2YQ5A 2UVPB 1Q1QA 1RMYA 4ZQFA 2DIUA 2ZSHA 3P20A 2GTHA 2JVIA 1Q1EA 4KGZA 1WWKA 4J5OA 3GIIA 4ITRC 2C58A 1WC3A 1K0TA 1K73T 4FKZA 4FJ1A 2IHNA 3FHLA 3ZWWA 3VJRA 5ETPA 3R7DA 1U9YA 1XZBA 1DRUA 5TGDA 2JJ2D 3JATA 2PMFA 1KARA 3FNHA 2APJA 3L7OA 2GJ8A 4S24A 5T67A 4NHEA 2Q1SA 1JLSA 4RPKA 3RV3A 1AKNA 4JP8A 1USWA 5J2PA 1RJ9B 2H1VA 5BXQC 4OYHA 4QYZK 4WERA 1QIHA 2DR7A 3WIUA 4FZ5A 4D2IA 4C0OC 2H29A 2O14A 3K0JA 2DB1A 3MA0A 3EJ6A 5IWAB 3EFOA 4DFDA 3ENNA 2UAGA 4ZGWA 1WSWA 3UC5A 2F8LA 3R97A 2HCRA 4E5MA 1DPGA 3OQMA 1K8YB 3ZZRA 1UDXA 2HA5A 4UXJA 1HR0B 1L5QA 3JYHA 4H7DA 4BX8A 3WIOA 4REQB 1WCIA 4AXXA 1RBMA 1NATA 4FCCA 1Z8HA 4NJEB 2UV8A 2Q3CA 2VDOB 1GTSA 4J0HA 3BBPA 1RTTA 2G36A 3WFZA 5H4GA 1WACA 4KRGA 1H4SA 4RU1A 3MLBA 3U9LA 1Q7CA 3DMNA 3DFIA 1PJ6A 3O84A 2WJZB 2IBOA 3PHIA 1GG5A 3Q10A 2P9HA 4PWZA 5DNDA 1X1QA 3MWEB 1UXKA 3ZQ6A 1CULC 3M81A 3AH8A 1X70A 1CJTC 2NREA 2NTYC 1VPTA 5DG7A 1PSDA 3PL1A 5DSTA 3K30A 1GNLA 3QTLA 5ILQA 1SKMA 5AHWA 5EE1A 1T13A 5G3ZA 4LF5F 2CD7A 4MGZR 1SCKA 4CQMA 1PO7A 4I50F 2FG6C 3QEAZ 4GZLA 5DLEA 2ZRAA 2CXUA 5CABA 3FSXA 2DVMA 4AP6A 2QL7B 2GPAA 1FDDA 1JJAA 2RGUA 5AJVB 2AIRA 1Y11A 3HBFA 4INPA 1G7TA 3GLGB 3LS2A 2J6IA 4Y30A 3AUYA 2IXAA 3NXZA 2WWTA 3UK6A 4OHYA 4EHJA 3TQIA 2VICA 2W5UA 2GNPA 1CHNA 2DXFA 3S1AA 1N32B 4NA2A 2OXEA 2YASA 4LDZA 821PA 4KK4A 1LF5A 1Q17A 1NDLA 4KLAA 3SCLE 1RM4A 5KYWB 1YZLA 1F0PA 3TIGA 2DT9A 2MR5A 5AK5A 2JFFA 4U8YA 3KKPA 4WACA 2KFNA 5AKIA 1FNBA 1Z0FA 4KGXA 3CCTA 1J9ZA 1X4FA 1D2EA 2YRWA 4G8JA 3BB5A 1JEOA 1EAMA 1BXRB 1H22A 2HQFA 2I3BA 2C1ZA 5MN4A 1JHQA 2CYBA 1UJ2A 5KFWA 3AODA 4MVJP 2G0JA 2I8LA 1E9AA 3PZPA 2I3DA 2O67A 3O8QB 1C1BB 2Y76A 1RT6A 1D9DA 5K6AC 5JJKA 2YYAA 3L06A 1ELOA 4UBIA 1CQZA 1Z4PX 2IY9A 1ZK1A 1T4GA 2WU4A 1RI7A 3C4VA 1RPAA 2L17A 2RAPA 3O21A 1Z82A 3PGXA 1QH1B 2Q0HA 5TF4A 4J9QA 3MEQA 2W43A 2PPLA 4B45A 1E8NA 2PUAA 3T6BA 3RVNA 4D46A 4Y3UA 2VNHA 3JQAD 2H7XA 1TK0A 2AQHA 1CUEA 3CNEA 1FVOA 5AW1A 4MVJD 4V19J 2WVJA 5GZ6A 1XJQA 4RW7B 1B2LA 1RE1A 4L9SA 5EG5A 3LP6A 1F51E 3H2SA 5E0KB 2V96A 4JROA 4MYHA 4GR4A 4QPNA 3A4LA 3A1NA 5IYZA 3MJRA 1R6BX 3GFQA 1JU4A 2YIJA 3JSAA 4BFWA 4R69A 1XHEA 5KTRA 1YRUA 4Y1GA 1QOPB 4ZP1A 3DMDA 4FFRA 3RSOA 2A9QA 2PWPA 1B6GA 1S0MA 3O2NA 5E6RA 1M0WA 4RYLA 1W6UA 2NNLD 2HG4A 2OBFA 3AFHA 5CIYA 1WE2A 3X2FA 2IOFA 2BTQB 2Y8EA 2OQIA 2JIDA 2FMIA 2FP3A 3I9V6 2NPFA 5I3QA 4DHWA 4EG1A 4ENWA 4JJ6A 3B6KA 1Q8KA 3F9IA 2C2ZB 1BGVA 5AW4A 4RD4A 3AEQA 5U9CA 4Z9BA 1WEZA 3R7BA 1VQ5S 1Q7BA 4QPCA 1F0KA 1USUA 4YR9A 4W4TA 4E14A 1DQNA 4OFWA 2Q3JA 3IEKA 5JMPA 1EFPA 7ABPA 4B87A 4F5YA 1RABB 1K8WA 3E01A 3AO0B 5CNMA 1ZJ6A 4WUVA 2P4QA 1DPFA 2A30A 4KACA 3DRPA 1T0JB 1R0BG 4OF4A 5A4FS 3THSA 4B0PA 1H5UA 4MV8A 3TQQA 4EHAA 1CJVC 5F35A 1E8DA 4E88A 3RVKA 4HQOA 1XCGB 1MOZA 4MRVA 4X8MA 2OCAA 4UQOA 5E3HA 3DCNA 5IJ0B 4TSRA 2ZIFA 3RG8A 4ZVVA 1IBCB 2NOAA 3CDAA 2I3GA 4H1VA 4NBWA 3FTNA 1GGJA 1A2QA 1CK4A 2XLBA 1GWNA 1V1RB 3S2SA 5SZHB 1YJNS 1YE8A 1Z25A 5AW5A 1EXVA 4G9BA 4PLFA 2ZC4A 4BMOB 3GU0A 1RB0A 2GBPA 4YP1A 1R0WA 4OQNA 5DDIP 4BKPA 5DT2A 1SHLA 1LJLA 1B43A 1ZI8A 1D0EA 4A23A 3O38A 5BV1A 3OTGA 1SVDA 2LLZA 2BKPA 2A7QA 2AV6A 1RBLA 4EF4A 4FKBA 1IZZA 4R2WA 3NHLA 3GRZA 2YJ5A 4FNGA 2G5GX 1LK7A 5A9RA 2L0XA 4HGNA 2ZYTX 3WK8A 1TQ4A 3M1AA 3TX8A 3IT3A 4NOJA 3LHSA 2D74A 3N7AA 5LNK6 1KK3A 2CWDA 4WE1A 1FDIA 4I1YA 1QIJA 6PFKA 1FVSA 4JH0A 1DQRA 4MDHA 1DB3A 4DS4A 4GVXA 4I46A 1A5ZA 3G2KA 1M7HA 3W9YA 1P9LA 2C2WA 1YWXA 5HRAA 3IESA 5EOVA 1XU7A 3HM9A 1PL7A 3Q3VA 1TL3A 2VH7A 1GFWB 4GVPA 4PR6A 1P60A 1AA6A 3HXTA 4FF1A 4B9MA 4F45A 1M6VA 1DKRA 3NVDA 4GS5A 3S29A 2JH8A 1HWIA 2DQSA 3DVSX 4JXJA 2ZOMA 4EYGA 4IO1A 2YRXA 4H7KA 4UU0A 2YN0A 1XFDA 1A9ZA 1KMHB 2FSUA 2B2NA 1Z2AA 1RJEA 4GO1A 4G9EA 3DOOA 2RKWA 4MQ4A 1FFAA 5ALKA 2GK6A 3D43A 2QZ4A 2OPHA 3MUFA 4BWVA 4KG7A 4YMUA 1KWMA 2ZE6A 5DNUA 4X93A 2UUCF 1GITA 3E5RA 4E2XA 3CZ4A 1C8VB 2PGOA 2J5QA 1IHUA 2I6WA 5DEIA 1F5CA 3MMBB 4OQZA 1VMBA 4DZTA 3IUNA 4WP8A 4UHJA 1DTEA 3PV0A 3RUIA 3KHSA 1Q3KA 4HVCA 4L3WA 4C4WA 1UFRA 1PI3A 1QYRA 2KJWA 1NSQA 2WPDA 2JSXA 2AMLA 1JFVA 3BE4A 3G0OA 3MPOA 3L77A 3OU7A 2GRJA 4WFAQ 3Q3CA 1I3KA 3QU9A 3H1PA 3EVOA 5DDPC 3TVTA 4GZ5A 5BW6B 1NKSA 1S8NA 3MM7B 5H3HA 3RC8A 1TW3A 1RWQA 3PQEA 3WQRA 4EG7A 1VHFA 1MAUA 3T1HJ 4N7BA 2MHEA 1G7SA 3SSAA 4ZODA 2P41A 4U2BA 3YASA 3KZOA 2V63A 5DW3A 2XY4A 3DVLA 4DLGA 2QIFA 1UC5B 3LRPA 4RACA 3F3SA 3JB9k 3DWIA 2HHPA 2ODQA 3N74A 4USJC 1FFBA 1GUYA 4E5KA 1RHUA 4CLUA 1MN9A 4KN6A 1FX2A 3E58A 4I9UA 2I22A 2PEYA 5NLLA 1NNEA 5CLJA 4NATA 5J3JA 2BUBA 4ZHQF 2XMWA 1Y33E 2IMWP 4D82A 1J8QA 4ZPVR 1PYSB 3AESA 4LFBJ 1LF0A 3H3XA 3QMVA 3MHYA 2D3O1 1SKUA 2ZSEA 3RC2A 4BN0A 3BN7A 2DTJA 3M89A 3UO0A 1S6QB 2F4VF 1H98A 3IBFB 2C9OA 5MFZA 1EWRA 2MMCA 3L46A 3PX7A 2ZJ2A 3AETA 4N0EA 1KDVA 4FWTA 4WKPA 3RUBL 2DHXA 3N8IA 2D5IA 1V48A 2HGZA 2IIQA 4OPMA 1MQ9A 2BD0A 3CWCA 2BSAA 4XJSA 3P9ZA 5DXFA 2DBZA 5IFKA 1ZK0A 1H72C 3C8ZA 1CBKA 4MVJG 3NNCA 4IICA 1ECBA 1NVFA 1NOKA 3GJZA 2QMUB 4F50A 3IDOA 2GAAA 1EHYA 2R96A 4RW6A 5DBGA 5KNBH 4DLLA 1ND6A 3TW8B 4G1EB 3CJ2A 2FQQA 3RBAA 4ZU3A 3V1LA 4UXHA 5JRDS 3V81B 2DQYA 1OZHA 3OLZA 3HKDB 2VH5R 5GINE 5JASA 3LWMA 2GIQA 2XWSA 5CDHA 4RLEA 1CIPA 1TM7E 3FIJA 5CYOA 4IP0A 2UZ1B 1ENYA 1EE9A 2GZDA 1P1IA 1TYBE 2CDNA 3OIYA 4RQBA 4H1HA 2OUGA 1SXJD 5E1DA 5H82A 6FD1A 1KDTA 4JUIA 1UQRA 3CU5A 1NIPA 1OY8A 2FN9A 2A9RA 4NX9A 2D8MA 1U5BA 1TJ4A 1FB5A 4ER5A 4RWXA 4E03A 2O2CA 5J2MA 1C9DB 3MR7A 3B3QA 2OH2A 5HZMA 3TNDA 4YUXA 3DYAA 2B94A 1Z5OA 5JEEA 1AOXA 2FZGB 2HJRA 4DSEA 4AC9A 1Z4NA 3S4YA 3OJFA 1NXIA 2ASJA 5E2AA 5IAOA 5JO9A 3UWMA 3QBEA 5U1PA 4QYIB 2BKUA 5HANA 2Z8YM 1T5SA 1CR6A 3G9TA 1E3WB 4L50A 2CJFA 3ELUA 1ISPA 3D8UA 4NV1A 2XVZA 3EYAA 4HTFB 4UZEA 1GNPA 1DZIA 1MHPA 4M83A 4W5TA 4HACB 3K17A 3PXCX 5LP6C 3F5FA 4O2LA 1YQXA 3ICWA 2DNRA 1MENA 2JIPA 3KLOA 4W5JA 4DFMA 2FMTA 3MCMA 1NK0A 3ZE2B 2V3VA 3HN2A 1GYQA 2LMIA 4YRJA 1Z4LA 2WYWA 1DXOA 1O94A 4JGGA 3OFFA 2E2WA 4MLDA 3A1UA 4CR7A 5I7WA 3IAM9 1KRXA 3VHXB 1SPBS 1UDAA 4O3FA 4QUEA 3L84A 1WS6A 4QKQA 2G0IA 3HVTA 4KQWA 2IOQA 3JWJA 5BQ5A 1U94A 3KWFA 2YZ7A 4JL6A 4KFSA 3TI0A 2W42A 3VC2A 1N2OA 1F06A 2UXDB 1DAGA 4U9UA 1VLHA 3ZO7A 3BGOP 1R27B 1BA2A 6CHYA 1TFRA 2GI4A 2ZREA 2DEJA 2XITA 4ED1A 2LVWA 3OP1A 2PR2A 3T3DA 3T9CA 1AF7A 1H2RS 1X4EA 1N1DA 3LP1A 2WU8A 4G41A 2RH5A 3DPUA 3LT0A 3UT6A 1SCJA 1Y98A 2HMUA 4WD3A 4CI2B 1RHRB 2MKJA 5FYDA 3T1AA 2VG6B 3A8IA 1MO5A 1QRSA 1EUYA 2AR7A 3V7UA 2XC9A 3BRQA 2RHRA 1B26A 4CO1A 4BKOA 4ZVHA 3F2VA 2RMLA 1E1LA 4PLTA 4JEHA 1ZBTA 4JOQA 4QBFA 1Y3CE 3THVA 3FDJA 1HA1A 2W6NA 2OCBA 3ESAA 2OYSA 2NMVA 2A84A 7REQA 4E0DA 1L3IA 4YRDA 1J70A 3RC7A 4UULA 2R4QA 2VG7B 5L7WA 2VZLA 2ZT7A 3E9DA 3KTDA 3BSCA 1JU3A 2O3SA 2W6PA 2D1TA 4B79A 2ETVA 5GJVC 5A5GA 1LB1B 1OI7A 1U8ZA 3VAMA 3LTNC 3K1TA 4OSPA 4OQFA 3ZR4B 1X60A 5ABPA 3AVYA 1KEWA 1RXUA 1RJFA 4KHPJ 3OFND 4DUPA 2V6FA 3ZU5A 1BNCA 1FCJA 1J7KA 2NM0A 4CQJA 1MABA 4PO9A 4MW4A 3S6JA 1E2LA 3BR8A 1WXFA 4I14A 4TYYA 1CR2A 2N3LA 1GL3A 1VLMA 2FSGA 4AL4A 5BR8J 4KTVE 1F4VA 4FUTA 1NMEA 3ANSA 1LPBB 4RW8B 3L9WA 4DX6A 2QS9A 2FKNA 2OZPA 3J7Z5 2RH4A 4JITA 4X3PA 4M49A 4ZVKA 2VNJA 5AT1A 3R5TA 3I0SA 2GEJA 3FMIA 4MVXA 5T4HA 3DOEA 2ZTVA 3FSGA 4KSYA 2G25A 2ZRQA 1OX4B 4CNYA 2MSLA 1HM5A 1EM8A 4K6KA 3G9ZA 3KR0A 3OTWA 2R3VA 5EEGA 2FX5A 3AHHA 1XD2B 2FUEA 1X2EA 1F4LA 4G0YA 3OHAA 1SG9A 5F78A 1VPDA 2QTHA 2E85A 4V38A 1NGSA 1EX7A 1J5EB 1YHYA 4DA4A 3HR7A 2ZJ4A 3PUVA 2B3DA 4OZJA 2XULA 2FWPA 5FWYB 1DTTA 2OBLA 4URUR 4R9RA 3I6MA 1VJCA 3FMGA 4ND8B 5F9MA 5ETTA 2E5WA 3SQNA 4DB4A 5EZSA 1WEYA 1M8GA 4CHGA 1RWPB 4JP5A 5IJ9A 2GM4A 3RRZA 3OR1A 3RGGA 1SU8A 1HBNA 5G40A 2C2XA 2GYUA 3PXGa 5KYUA 1NN5A 1QTQA 1Y1QA 2ZXEA 1REVB 4B3IA 4QU6A 3KHLA 4QHSA 2DBQA 2HFSA 3CMAS 3KTAB 2W0SA 1YBUA 1FFWB 1G5FA 4P73A 4F04B 3BMQA 4DR2F 4I4CA 1P1RA 5L4NA 1KGSA 3M65A 2OKCA 3MWDA 2VHEA 2PBZA 2ZSDA 5CW1A 2NSJA 4PSCA 5SV2A 4WU2A 4B9AA 1YIOA 4CEJB 2J5AA 4KV8B 5HEKA 4W5QA 2HRUA 3QSYB 3RT7A 2DRBA 4Y2GA 3M6MD 3M8QA 1C9MA 1D9ZA 3DP9A 3LQFA 4EHLA 2L2QA 4Q2MA 3CNOA 2ZQ5A 3CLUD 4Z5XA 4R0NA 3JYPA 4FVTA 3P8BB 2ZRIA 3SK0A 4MPPA 3FIUA 2DLCX 4LY6A 2FCRA 1UBCA 4LZOA 1CR1A 3WLJA 2Y6UA 2D06A 1U3CA 1U2RA 2XWXA 3CNQP 4MRPA 4CFYA 4FJ0A 4AG5A 4E32A 3PC4A 3K0FB 4IGKA 2MYFA 1ZKDA 1AKVA 3N28A 3VKUA 2BEKA 3W78A 3O2JA 2FZEA 2XD4A 1XNRF 2ZIGA 4M21A 4RJLA 4ILEA 3IDQA 1ACJA 1H66A 2F43A 5C9ZA 2Z5FA 3FHOA 2OPBA 3REOA 3RI3A 3F4BA 5J4LA 1TL1A 3ELYA 1PR3A 3D8TA 3G9UA 4D4IA 3G89A 1FERA 4DG1A 3AU8A 3ER6A 2FJDB 3X2SA 3W04A 2HHHF 1CP2A 3GJSA 3Q8SB 1TJ3A 1E5QA 3AKEA 1R0KA 1AV7A 5BT8A 4CLSA 3VWSA 4N76A 2X4GA 2IV2X 2NTNA 1DFGA 2BJ8A 1KJZA 2OHIA 4Q12A 3CX4A 3RNLA 5LJ3Y 2C94A 1B1AA 3FYUA 4GXNA 1YS2X 1SJ1A 1XTJA 4EB8A 4IKPA 5L1LA 3LQRA 2FWRA 5AXLA 5LOQA 2P9CA 4JJ4A 3GCXP 4BE4A 1KEPA 5EKDA 5B53A 2A6PA 4BRSA 1FW6A 4URVR 1V7CA 1UOQA 4LZLA 2J3LA 4PAWA 1SBCA 4BO8A 1NUPA 1U47A 3EGCA 2HRYA 4USKA 5AHXA 2LTAA 1UC4B 2P9ZA 3MD0A 3IP3A 2QDKA 1JH9A 4XDZA 1C7FA 5GPBA 3HYCA 4P34A 3J7YU 4J1NA 4Y7CA 5J2UA 5EE3A 1CHDA 3FPBA 5F23A 4YJFA 1OX6A 4QUIA 5G2OA 3FNGA 2CQGA 3DDWA 2ZYRA 2I03A 2FKAA 4DCPA 2R65A 2WVBA 3JASB 3LP0B 3M1VA 2JLUA 3MUVP 3P32A 1HD1A 1A5BB 3RHSA 1W48A 4AZWA 1YQGA 5E2QA 3A1DA 1E4EB 4ZVRA 1QIGA 2GGSA 3QVSA 5K6TA 2BJDA 3GUVA 2ZSUA 3OJEA 4EW1A 5KAKA 3AYXB 3RARA 2HU5A 2ZRLA 1EK1A 3HDQA 4EVQA 1VCTA 3WC2A 5I9BA 1FFHA 5EJAA 1J99A 5DRKA 3KB1A 4R2MA 4V3BA 1T36A 2ROGA 4KGVA 4ZVQA 5C7OO 3L7YA 4QOIA 3JALA 2MZJA 1GQRA 1KPHA 4ES1A 4JOUA 4X85A 1L6IA 1ZD8A 1OBOA 3V4VB 4M9ZA 2A1IA 1AM4D 3E9MA 3EXHC 3UGKA 3K0BA 4OD0A 3RYFB 4A9AA 3TTUA 3T95A 3MQKA 4B4KA 2BEVA 4ER7A 3T5TA 4DR3F 4HDAA 3AZQA 1VSQA 1IHDA 1Z0AA 3KUUA 3T34A 4IFYA 1VLQA 2MY7A 4RA6A 4LF6F 2J9FA 2QYTA 2BQUA 3DCIA 1SUPA 4S2UA 1RTIB 3H7HB 1ZCJA 3SIPA 1RWUA 4GKKJ 1A2BA 3PWSA 3WGJA 1YJ8A 2Q2NA 2QTNA 2X3YA 1ZD1A 4IJQA 4CM8A 4LYFA 3WNQA 1R9NA 4JAVC 4KMMA 3TVDA 5DTQA 3LWNA 1K7XB 4TV9B 4RCYA 3SOZA 4CG3A 4EAQA 3ABQB 4WA7A 3JTOA 5JXSA 1WD5A 3LA6A 1BTOA 3IVMA 4H08A 3HQ4O 4XDGA 2R66A 4EMDA 3I6ZA 1K0VA 3Q72A 1K5HA 1NO8A 3QXCA 2B56A 3PV8A 4NF2A 3PF9A 5E9WA 3IXQA 1S89A 3K5PA 2N1BA 1LWEA 4Y2YA 1YHZA 3LECA 3BF4A 3IAS6 4U5XA 5IZHA 4JLJA 4OYPA 2CFIA 3N0TA 4ZHSA 4BKQA 2QD4A 3D0KA 3TAXA 3PLNA 1F8GA 3MHPA 4RHEA 1N2CE 1UXGA 1IZ8A 2DGXA 2G5CA 2GSDA 2HDNB 3EXYA 4BQPA 4IJ6A 1Z35A 3I5CA 3ISNC 1VQ4S 1THMA 3B5JA 2Z57B 2UUAJ 1SUBA 3ZZ1A 3P0FA 5L39A 4F4ZA 2XA9A 4C05A 2AF4C 4KO0B 1RHKB 3OD5A 1TV6B 3C8UA 3JTPA 1PLKA 2ATCB 4JI4F 1PLJA 2G9RA 2EJBA 3T19A 1IHXA 3KQWA 4BFTA 3DBRB 4U67Q 3GIMA 2DUJA 5LC1A 1DBPA 2WVGA 5LKRA 4P58A 2YCLA 1QDUB 2HA2A 4OUDA 2KLHA 3KELA 2D6FA 3CCZA 1KQOA 2XUDA 3GV5B 2VYFA 1Y6FA 5AK0A 4ZZ0A 3UXYA 2HZVA 2PV7A 1RT9A 3ZY5A 4AL7A 3CBQA 1N5KA 1OVMA 3E82A 2GWRA 1VLVA 3KD2A 2NVBA 4C4RA 2ANEA 1KYIA 3SCIE 3KYLA 3ZD9A 3VZIA 2PGAA 5JI3E 2B4AA 3UGTA 4QJ3A 1A3CA 5FJ4A 3W8EA 1H2VZ 1U8TA 3LBAA 1S2MA 1VISA 4K0KF 1YOBA 1YZTA 1SC9A 4ZVPA 4D9EA 2UVRA 2OTCA 4ECYA 1OMOA 1OBCA 5AW3A 5HL7Q 4LFAF 4NESA 2JHAA 3LT1A 4X54A 4P4SB 5JIBA 3PEHA 4QDTA 2AF3C 2QRJA 3MT7A 1MZPA 1UZUA 2DAPA 1KMQA 4C6SA 5IBQA 4NU8X 2RD5C 2FVRA 4FGSA 3V55A 2DNZA 3H4BA 5K14A 4TMZA 3X3HA 4ER3A 4ICLB 2OBYA 4XQCA 2FIUA 1YVEI 5BN5A 2VSOA 3ZXWA 3O95A 4DUYF 4UUAA 2QUAA 5CD9A 3DYBA 3V8RA 1C4AA 2W6OA 5KJ6A 2O1XA 1NQUA 1VIVA 3EGXB 3OE4A 3QBTA 2CXHA 4ZVOB 4LSNA 4RKQA 5JT1A 1K4YA 2I33A 1XOIA 1SJ4P 5ETVA 1FFGB 1S1UA 4JI0J 4Z0NA 2JFXA 3QVVA 4TTAA 3NCHA 4NL5A 1FPMA 2NXUA 4NVRA 2B82A 4Y8VA 2ZBPA 1P19A 5EMJA 5E3PA 1UPCA 1U0HA 3GYBA 4AQYB 1WHTB 4MK4A 1ORDA 2P2GA 2DFLA 5HS6A 3HMKA 5FUYA 3I1JA 3KFXA 1A6LA 1OI3A 2LU1A 3H4VA 5IVIA 1IUOA 2O0JA 4BLQA 1WZIA 1FRKA 3GAZA 4HN9A 3CTPA 1N2CB 1B23P 2C5EA 4YQYA 4BOYA 3A1SA 4DUZJ 5B0GA 1ZGAA 2FQWA 4DQQA 5K8OA 1WTAA 2YTZA 2I34A 3GEDA 5FUQA 3ZGYA 4BVFA 5DI9A 2W2XA 2RHSB 1VQKS 4JKIA 1AHHA 3S28A 3PYEA 3IOEA 721PA 1JQLB 1SOVA 3D54D 4FFMA 3JSMB 4MV6A 1ZO8A 5AOVA 5DHUA 4R7ZA 1QB7A 5JZOA 1KBOA 5T4FA 4RK0A 3VX4A 1PFQA 2P35A 1YR1A 4PZYA 1G9XA 3UT5A 3WJ2A 3NGMA 3LCRA 1BCRB 3O4JA 1Q14A 3P4UA 3WADA 4HNUA 1M8FA 1D2HA 5G4LA 4BP9A 3CVVA 3EGDB 2A6OA 1J8YF 4LV6A 4HUTA 3DYVA 3GFZA 4YGYA 1QHSA 5B6IA 1QHIA 4HAVA 3UMYA 2PX4A 2TYSB 2WSEC 2D9PA 4MHOA 3V8EA 3CSUA 4IG9A 3ZZTA 2GZ2A 1OJ4A 3CRNA 1Z68A 3OTBA 5L6LB 4CMCA 1RAHB 1YFJA 4DOZA 2OFOA 3EEBA 5DN9A 2HURA 5KFFA 3RIYA 2QX9A 3SR3A 2VCEA 2C99A 2B4OA 5HIJA 3MT0A 1CZKA 1TGYA 2QMHA 1D8ZA 4QSMA 2WT9A 2DQ4A 2XV1A 5BYRA 3KBOA 4BNJA 3R3JA 1T8RA 3VC1A 1IBLJ 1RCXB 1OPIA 3FZEA 3ANNA 2H6EA 3D6VA 4QJVA 2P9JA 2OV4A 2XKKA 1BDJA 2FVXA 5EFOA 2IIBA 5DYIA 3KHTA 4J75A 2A2CA 5K1ZA 2G1PA 4I36A 2PL9A 2PRIA 1M33A 2UVVA 3IQGX 1OAOA 1F9EA 3GV8B 1Z47A 3F6BX 5G1PA 4OLAA 1U8EA 2ERXA 4OTZA 2YPYA 5JPIA 4ZCPA 4AKIA 1ODLA 3ISZA 2UU9F 5CCLA 4WRRA 2QLNA 3BSNA 2WD7A 4LKRA 1X1RA 2IJRA 2KXHA 4XUCA 1WUIS 2PX6A 3K9QO 3PI6A 2OPRB 2A0UA 1QNLA 2OCYC 4DV5F 3VVUA 3DO8A 4F5WA 3NBPB 1G20E 4DR6F 2AMCB 2DNLA 3A9SA 1AKWA 2O01C 4G4SP 5KT2A 5FBWB 4DF8A 1G21A 3DHNA 1SUCA 4DR5F 4M95A 2PUJA 1MAWA 2IFXA 3G5MA 1IIRA 4D4GA 5IJWA 1K6XA 1E62A 3L6BA 1S01A 1SPXA 2R2TA 4X84A 2BJ1A 5EWLA 1JR3E 4TU8A 3OVBA 3EVCA 3LJCA 3KLHB 5FAKA 1NFQA 4AW9A 2WKQA 3VNSA 3HCCA 3EXFA 3MCZA 1IBMJ 3P0JA 2W0MA 3GDGA 2VHZA 5CCBA 2W7AA 3AEKB 4HKTA 2DERA 1Z37A 3D3WB 4O4HA 2BMEA 4IJUA 5LNK1 4AUEA 2GDJA 3L4KA 4YIKA 2MQQA 3TUPA 3S0JA 2NZ2A 1GP2A 4CVNA 1RQRA 1V25A 2NU9B 3HUDA 4B40A 4C8YA 2OMLA 4I4TB 5DASA 4ZN6A 2R44A 5C1DA 4TYWA 2XY5A 1CUVA 2XCOA 3HY3A 3RK4A 2X2PA 3PC7A 5HFNA 1QWOA 3IPLA 1QF6A 3OICA 1W75A 2XB8A 5MN5A 2B1IA 3AR7A 2W8KA 4QQ8A 4TWZA 3CTMA 4UVIA 4PFJA 3KUHA 5IAAA 2F3PA 4EYKA 5AJ3J 1SUWA 4HYEA 3BPSA 2XX3A 1MX1A 3BA1A 4MUEA 5FA6A 3S1LA 1MDBA 3B38A 1Q16A 1E3MA 1GNRA 3MPWA 3KVYA 1YBVA 1G3UA 2J45A 1KC1A 4C11A 1VQ1A 1C0LA 2Y3YA 4H0FA 1WI6A 2B4VA 3GE9A 1YDGA 3LC1O 3KFLA 1YOVA 2ZH9A 2ROQA 1ZHHA 3T3FA 2L19A 3MMPA 3AHPA 2PBFA 2DPMA 3IV6A 2WW4A 2GDZA 3D6FA 4HVZA 3ZU2A 4EUHA 2Q5JA 4OYBA 1T11A 5EP4A 3IBWA 2HA0A 3LD9A 1A82A 2R7VA 1DCKA 3T5CA 4QT0A 4U7HA 3PJFA 1ACLA 1AHPA 1IHYA 1CZRA 1DFIA 4ZJYA 2MOKA 3T5LA 1ZA1B 3HHEA 4GDMA 3I62A 4IZIA 1OHHA 1PYGA 1QQAA 1FQWA 3W2VB 1J0EA 4H3SA 4MUAA 4OP3A 1I3OA 2ZB8A 4WVFA 1NN1A 3MLAA 1YU9A 2QQFA 3HJAA 4N8NA 2AJ0A 1I1HA 3KZNA 1VGQA 2MQPA 1K2VN 4ZGGA 2CN1A 5J2UF 1BCSA 2D5CA 3N2KA 5HMWA 4GL4A 3CV3A 4GRSA 4XAKA 1G20B 3TXXA 4DSIA 1ZN8A 2C04A 3SJZA 3ZD6A 1XZMA 1FVQA 1Q3HA 2DPXA 1O0CA 1ZR2A 1IRIA 3K8ZA 3LUFA 1EFCA 4HGRA 4O3RA 2CQ0A 3RJTA 1CF4A 2OHHA 3LWRA 5HWSA 1K7CA 3OHPA 4RJTA 3FCHA 2N3OA 2EKPA 4OB8A 3UAWA 5A3RA 3OP4A 4NSNA 4E5SA 3L0SA 4RDIA 1PP4A 2C83A 3AUUA 4OXIA 4X64B 2NUAA 3ZHQA 4OYZA 2CXRA 3C5HA 5C25B 4YWJA 5KWJA 2PFFB 1L7XA 3DWEX 2AH5A 5FTNA 3PC2A 1I6KA 2LBPA 2PGDA 5I8WA 5LXTA 3BSSA 4F9GA 1P61B 4JZYA 2CLFB 4IH7A 1PZGA 1NVTA 2C1XA 1FOEB 4DC0A 2B6AB 2VWHA 3JQGA 2QT7A 4QBHA 1N1GA 1A8HA 4DQVA 1Y5IA 2QLTA 2OSBA 3HV2A 1QC5B 2FUKA 1MAHA 2IX9A 2HA6A 4YROA 5HZGA 1DURA 2VXBA 4JLKA 4NLXA 1YG0A 3KFWX 5KDOA 5IDXA 3TAPA 4OQLA 3EOAI 2IBTA 3IODA 2F3TA 5GMKa 3K7EA 1O5JA 5IDYA 1BKDR 3KYIB 4DC1A 4L72B 4TX1A 2IKQA 2OCDA 2JEZA 3AF1A 2QPTA 1XUOA 3BM5A 3EIFA 4XYGA 3M3PA 1TVRB 4K6MA 2R6FA 3AERB 3HJFA 4OQYA 5M29A 4B5KA 3T9NA 3V7YA 3C16A 4DIDA 3I5YA 1RP5A 1UVNA 1BEEA 1JLGA 1D8TA 1VE6A 2VASA 3DOKB 3T15A 1XMIA 5TS2A 1RP7A 4XVUA 3K6KA 3EDOA 1VIDA 1SV5A 3WL5A 1P1FA 1PBAA 4ZHQA 2HNYA 2ZRPA 5HO4A 1OWMA 2PO5A 5D3MB 1Z26A 1UBJS 4HNAA 4J07A 3I0RA 1I5OB 1N33F 2PX3A 4UEOA 3FZYA 3CMMA 5JEDA 1RLDA 4ZP8A 4Q00A 4R4JA 2ZJ8A 4FVMA 1T9BA 1VCMA 3DPIA 1IULA 1Y5NA 3GJTB 4LOHA