3M4XA

Structure of a ribosomal methyltransferase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
449
structure length
440
Chain Sequence
TLPQQFIKKYRLLLGEEASDFFSALEQGSVKKGFRWNPLKPAGLDMVQTYHSEELQPAPYSNEGFLGTVNGKSFLHQAGYEYSQEPSAMIVGTAAAAKPGEKVLDLCAAPGGKSTQLAAQMKGKGLLVTNEIFPKRAKILSENIERWGVSNAIVTNHAPAELVPHFSGFFDRIVVDAPCSGEGMFRKDPNAIKEWTEESPLYCQKRQQEILSSAIKMLKNKGQLIYSTCTFAPEENEEIISWLVENYPVTIEEIPLTQSVSSGRSEWGSVAGLEKTIRIWPHKDQGEGHFVAKLTFHGQNQMHKVQMTKEQEKLWTEFSNDFHYEATGRLLVFNDHLWEVPELAPSLDGLKVVRTGLHLGDFKKNRFEPSYALALATKKIENIPCLPITQKEWQSYTAGETFQRDGNQGWVLLVLDKIPVGFGKQVKGTVKNFFPKGLRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an RNA methyltransferase
rcsb
source organism Enterococcus faecium
molecule tags Transferase
molecule keywords NOL1/NOP2/sun family protein
total genus 126
structure length 440
sequence length 449
ec nomenclature
pdb deposition date 2010-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F
A PF13636 Methyltranf_PUA RNA-binding PUA-like domain of methyltransferase RsmF
A PF17125 Methyltr_RsmF_N N-terminal domain of 16S rRNA methyltransferase RsmF
A PF17126 RsmF_methylt_CI RsmF rRNA methyltransferase first C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.60 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3m4xA03
3.30.70.3130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m4xA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3m4xA02
5DPMA 3UWPA 4RTLA 2G71A 1EIZA 5F2NA 1R6AA 4ER7A 2ZTHA 2JJQA 2UYHA 4E30A 3KPJA 1QANA 1TW2A 1XDSA 1Y8CA 5HEKA 4C07A 2Z6AA 4QQNA 3BGDA 2C7PA 1QZZA 3A27A 4PGHA 3D2LA 3AWIA 4B17A 4OBWA 5LQAA 4RX1A 8MHTA 5CVVA 3IHTA 3EVBA 3LKDA 4XUEA 2I62A 3TR6A 3UA3A 1T43A 5BW5A 3NVKI 2JH8A 5CVDA 3HCCA 3IYLW 3HCDA 4E2XA 5EMMA 1JSZA 3PT9A 2OYRA 5K0JA 2PBFA 3DUWA 4C06A 3EPPA 3TQSA 3AJDA 3V8VA 3SVZA 4FT2A 2AN3A 5KS2A 4FZVA 4DQ0A 1M6YA 4QTTB 5CUQA 3X0DA 4CXMA 3R3HA 4QVGA 1ORIA 3MCTA 3S68A 2ORED 3G2QA 4YV0A 5K05A 3G2OA 3TFWA 1QAOA 3TPZA 5GINE 2AN4A 2ZZMA 3AY0A 3WSTA 5DT2A 4OQEA 5DRTA 1D2GA 3FPHA 5E8JA 1KYWA 3OZTA 5CIYA 2Z6UA 2NXEA 2LD4A 3NVMB 2IH2A 1FBNA 3RIEA 3BT7A 3GNLA 1JQEA 4LWPA 5K09A 2H1RA 5T64A 1NBHA 3EMDA 3G8AA 4PINA 1UFKA 3UBTA 4K6MA 4GOLD 4R8RA 5EZQA 4OA5A 3ELYA 3ELUA 4EMSA 2CWWA 4KRGA 1ZQ9A 5K0BA 2PX8A 4PCAA 5HZMA 4GUAA 5GM1A 5T67A 1JSXA 2XVAA 3HA3A 2P35A 3KR0A 5GOZA 2ONZA 4CKCA 4HTFA 3DR5A 3FYDA 3SMQA 1TW3A 3JWIA 1L3IA 1N2XA 2B2CA 4PWYA 4MWZA 4RYLA 4ZTBA 3PTAA 1VP9A 3SSMA 3TM4A 3EEOA 4ER0A 4RTSA 2P8JA 2OZVA 1NW6A 1I4WA 2JHCA 2FRXA 4F86A 1L3BA 5E1OA 1N7JA 2B9EA 3OFKA 2O57A 3P71T 4RVFA 5GM2A 2AOWA 1SUIA 2I6GA 3TLJA 5BXYA 2ZZKA 3G88A 3THSA 2IH5A 1O54A 2OKCA 3MCZA 4RVGA 4G56A 2PJDA 3VC2A 5DLYA 5E9JA 4IV8A 9MHTA 2OBFA 1P39A 1AQIA 2HMYB 3LECA 3OE4A 3BXOA 3TM5A 4P7KA 2AOTB 3KQVA 5EMKA 2NXNA 4M7RA 5LQRA 3FPJA 3MGGA 2OPBA 3B5IA 1EAMA 4RTQA 2BR3A 4HC4A 2V7EA 1INLA 2UYOA 2AOTA 4PIPA 4EKIA 3P2IA 4DA4A 3I5UA 3KPVA 1UWVA 2XYQA 1NW3A 3B89A 3FTFA 4DCGA 3KPWA 3PFGA 4YV2A 5HIKA 1RJFA 4ER5A 3ERCA 5K8VA 5CVUA 2GA9A 2P3QA 4WVLA 2UZ4A 4E33A 2WA2A 5EEHA 3UJDA 3R9XB 2A14A 3LBFA 5IKMA 5EQJB 1ZGAA 5DM1A 3FTEA 1MJFA 3DP7A 3M4XA 2VP3A 2QE6A 5U4XA 4E32A 2AOUB 1G38A 3P9IA 3G5LA 2PWPA 3LX6A 5CVJA 1I1NA 4X63A 4DZRA 3KR2A 1AV6A 3TMAA 2EJUA 4QVKA 3H2BA 2EFJA 4EVIA 3KQPA 4FSXA 3M6XA 4E31A 3R24A 3I64A 3GIWA 2B3TA 1KHHA 4LWOA 5EZSA 5FQNA 1O9GA 3O31A 1KPGA 5FWDA 4ATNA 1RI5A 2NXCA 2OY0A 3G8BA 3UZUA 2GAFA 3NW9A 1RI4A 2IBSA 3OU6A 2I7CA 5K03A 2JHAA 3OU2A 3P9KA 4OQDA 2YQZA 4C04A 3HCFA 3C3PA 3LDFA 1JTEA 4HSGA 1BOOA 2ESRA 3HCBA 5DX8A 4YUYA 5LQUA 2JH9A 2ZVJA 3HVHA 2P1DA 3B7PA 4PYLA 5DTMA 5E9QA 5FULA 2GH1A 4PYIA 2P7IA 5GIOE 3AXSA 1YZHA 2NNWB 3FPGA 3LPMA 3P9CA 2F8LA 3GRVA 4MHTA 1QAMA 3M6UA 3NWBA 2P3OA 3MTIA 1H1DA 1X1DA 2EG5A 4C03A 2AZTA 3FUWA 4KIFA 1BHJA 3DOUA 1JTFA 4FS8A 3OZRA 1KP9A 3KQYA 3P2KA 4M37A 4BLVA 2IBTA 3AXTA 3DLCA 5FCDA 4CKBA 1NW8A 3HEMA 2YXEA 3DH0A 3TKYA 5EIWA 3HCAA 1SQGA 2OB1A 3OE5A 2BM9A 1RJDA 2BR4A 4PYOA 3GO4A 1EJ0A 5G02A 5KQRA 3CGGA 4CTKA 4PGGA 5JR3A 1X19A 1KPHA 4MTLA 5CVEA 5DTQA 3ANXA 1RI1A 4YMGA 4R8SA 3VYWA 3MHTA 4IV0A 5CCBA 1X1CA 2PY6A 2YVLA 2YR0A 3BUSA 3CCFA 3EVGA 3LCCA 2NXJA 4X41A 3MB5A 2H00A 3ME5A 5DWQA 1KXZA 1YFJA 4RVHA 4HG2A 2PX4A 2GB4A 2ZIGA 1XCLA 2CKDA 2QRVA 5E2BA 2YXDA 2OXTA 1R74A 7MHTA 2NP7A 4O29A 4QTUB 1XTPA 3MTEA 1JG3A 3MERA 3SM3A 3QOWA 3GRYA 5EKXA 2G72A 1JQ3A 1R8XA 2HR1A 1AQJA 3DLIA 1P1BA 3UJCA 1VP3A 4OBXA 3P9NA 5E1MA 5HOQA 1BC5A 3KQTA 1Q0SA 2DULA 1B42A 4GF5A 3P97A 2Y1XA 4QDJA 5EOVA 5T6BA 1DCTA 2O0LA 3HTXA 3T0IA 3UJAA 5E2AA 5E1BA 4PYQA 1YZ3A 3THRA 3PB3A 2E5WA 2FCAA 4DCMA 4RTKA 3CJRA 3DMHA 3I53A 3FRIA 1F3LA 2R3SA 3OPNA 5E1DA 2FPOA 1SQFA 2IFTA 3LSTA 4FT4A 5DM2A 1VQ1A 2R6ZA 3KPUA 4HH4A 2G1PA 2ZIFA 3EVFA 3CC8A 2QYOA 3EMBA 2HNKA 3LKZA 1XDZA 3G2PA 3NJRA 3PX2A 2AVNA 2P41A 4QPNA 2V74B 1YFLA 4YMHA 1V39A 3REOA 3CJQA 3BKXA 1YB2A 3FYCA 5EHIA 2O05A 4GQBA 4C4AA 2P3LA 5DM0A 4F84A 1DUSA 4PYNA 2PXAA 3RW9A 1F38A 2GPYA 2ADMA 2QY6A 2FK7A 3B3JA 4V0QA 5H02A 4DF3A 4YUZA 2ZZNA 5EGSA 3LDGA 1KPIA 3KHKA 3NWEA 4U7TB 1R00A 3E8SA 1VPTA 3GGDA 2OO3A 4X1OA 4BP3A 2PT6A 2XVMA 2G8NA 3FPFA 4RSRA 4DM3A 4HGYA 2JG3A 3ELDA 1MHTA 3ELWA 4PNEA 3M70A 5CM2Z 2JHPA 3U81A 3UFBA 1FPQA 3HM2A 4JXJA 5FADA 3EGVA 3PX3A 4KW7A 1EQAA 1O9HA 1IXKA 1Z3CA 3HP7A 3GRZA 4NECA 3T7RA 3TKAA 2BM8A 1HNNA 1RI3A 2ONYA 3Q87B 3NDIA 5KYGA 3IV6A 3G5TA 4R05A 5K0EA 2PXCA 3PLAE 1DL5A 1HMYA 4Y30A 1QAQA 2IPXA 2YXLA 2GS9A 1L9KA 5ERGB 3T7SA 1NKVA 1WXXA 3DXXA 5P8WA 2IDJA 4PYJA 1XDUA 3FUUA 4Y2HA 1RJEA 3HA7A 5FHQA 5EIFA 4AZTA 3UJ9A 1SUSA 5EEGA 5HILA 1YUBA 4YUWA 4OX9Y 3ER8A 2CMHA 2VDWA 5F2KA 2FK8A 2HWKA 3DMFA 3BWBA 2P7HA 3GXOA 4L7VA 4DKJA 1ZHFA 1ZKDA 2CMGA 1M0EA 2XBMA 4OA8A 3A26A 2Q41A 4XUDA 4YUVA 2EX4A 2YUIA 3KPYA 4RTNA 3UJ7A 2OB2A 3GDHA 1R18A 4H0NA 3HVKA 4QDKA 4PONA 5HIJA 5K0NA 4GC9A 2ZCJA 1JG1A 3FTCA 5KVAA 3A7DA 1WXWA 2NYUA 2PVCA 3DXZA 2N47A 3EVDA 2GLUA 4IKPA 3BWYA 4A6DA 3HNRA 5EC8A 3C3YA 2PSSA 2ZULA 1G6Q1 1NW7A 2PX5A 3JWJA 3B3FA 3KU1A 4HRAA 5LR6A 5LQCA 1FP1D 2ZBPA 4X60A 1FP2A 3VC1A 3TOSA 4KIGA 3VSEA 5K01A 3I58A 3KQOA 5DXAA 3FUTA 3E23A 2Z6QA 3UA4A 3LGAA 3C6MA 4KWCA 2I9KA 3GRUA 4PCLA 5EMJA 4IWNA 5EVJA 5C0OE 2C7QA 5D1NA 5LQNA 2IIPA 4X61A 2ZFUA 4E70A 5LQJA 1RI2A 3GCZA 5EMLA 3TRKA 4ER3A 1G55A 1G8SA 3CKKA 4ER6A 4HGZA 3O7WA 4AX8A 1YF3A 3BGVA 2IDKA 4DMGA 1NT2A 3R6TA 5DX0A 4BP1A 2NP6A 2G70A 2Y1WA 1WG8A 3LCUA 3LBYA 4V0RA 5CCXA 4E2ZA 5EG5A 1SG9A 3BWCA 3G2MA 5EPEA 4QQKA 1RJGA 4HTFB 3EEYA 5B1SA 5JUWA 2HV9A 1VIDA 3FTDA 1M6EX 3DTNA 3SSOA 2PWYA 5ICEA 5FA5A 2PKWA 2AR0A 2BZGA 1UIRA 1XXLA 5DXJA 3SSNA 4RTOA 1IM8A 1D2HA 1XCJA 3A7EA 2YTZA 4LG1A 4EK9A 3SR4A 2WA1A 3NTVA 3OCJA 2WK1A 4MQ4A 5FQOA 4AZSA 3BWMA 2UYQA 4CTJA 1WZNA 3KQSA 4R6XA 5IH3A 3GJYA 1PJZA 1KIAA 5C9ZA 5K0LA 3KQQA 3UJ6A 3LDUA 4GC5A 4GOMD 2BH2A 3OFJA 1IY9A 4BLUA 4CWAA 4POOA 4UOEA 1KYZA 2AOUA 3HVIA 4XCXA 5FTWA 3M6VA 2FHPA 3EVCA 3CJTA 1XJ5A 3EVEA 3LL7A 5EHGA 5C1IA 4RTMA 3BKWA 10MHA 5HIIA 1VLMA 1JG4A 4F85A 3A4TA 3FUXA 4YUXA 3DXYA 1SKMA 2P40A 2PXXA 1NW5A 3LCVB 3M6WA 2XYVA 1NV9A 5FUBA 3NDJA 5CD1A 2AS0A 3EVAA 4XUCA 3E05A 4GOOD 5DTRA 1D2CA 1L3CA 5DSTA 4RVDA 5EKUA 3RODA 4M36A 5E9WA 2PX2A 3OZSA 3O4FA 5GP1A 3R0QA 2O07A 4R6WA 2IGTA 4C05A 3Q7EA 1JQDA 5BP7A 5ICGA 1P91A 1VE3A 4P58A 3C0KA 3HCEA 3IEIA 4ISCA 5BW4A 3ORHA 3K0BA 3MQ2A 1NBIA 3LHDA 2AN5A 4KVZA 4RWZA 5M5BA 2B78A 2O06A 4A6EA 4FSDA 3NMUF 1ORHA 4EKGA 2ZBQA 2ZWAA 4E2WA 1NV8A 2PGXA 3SXJA 5KQSA 4GBED 1VL5A 2ZBRA 2PV0A 1ZGJA 4QPPA 3EGIA 3ID6C 2ZIEA 3KQWA 3PFHA 1G8AA 2ZW9A 3HA5A 4CKEA 5GWXA 3CBGA 2EJTA 1EG2A 3GWZA 1EJ6A 5LQKA 3KQMA 1NE2A 1XVAA 2YX1A 4KDRA 3OU7A 5MHTA 4P7JA 2PT9A 1VBFA 2ZSUA 2VDVE 4P7GA 3A25A 3SX0A 3M33A 4FGZA 3HVJA 1X1BA 2VZ9A 1OR8A 4YV1A 3C6KA 2BR5A 3L8DA 5HFJA 3B3GA 4PIMA 3F4KA 4BY9E 5FWAA 1FJXA 3DMGA 1PRYA 3G7UA 4P7FA 3UJ8A 3BZBA 3ER9A 2IH4A 2H11A 3MAGA 3QV2A 3JWHA 3KR1A 3KKZA 2FYTA 5LSAA 4RTRA 4RTPA 4M38A 3FUVA 2VS1A 5HIMA 3GU3A 2ERCA 4BLWA 5D1HA 2AVDA 3GRRA 3V97A 3PS9A 1ZG3A 2HTEA 2KW5A 1P1CA 5DX1A 5K0FA 1U2ZA 3DULA 3EVZA 4MIKA 5DRYA 5E8RA 4AZWA 2K4MA 3K6RA 3FRHA 4E2YA 1QYRA 2CL5A 2C7RA 5F2OA 1WS6A 1KR5A 3I9FA 4GOND 1AF7A 4WXHA 3T7TA 4U7PB 2B25A 3JWGA 2AOVA 1I9GA 5FA8A 2ZWVA 3FZGA 4AUKA 2DPMA 1R8YA 3PVCA 2PLWA 3P8ZA 5FHRA 5ICCA 2UYCA 4RV9A 1SVUA 3EGEA 3KR9A 4Z2YA 4RTJA 4AZVA 1WY7A 4C08A 2QRVB 5K0CA 3SGLA 4LECA 2VDUE 4FR0A 2IP2A 2QM3A 2XYRA 3CVOA 4GEKA 3QOXA 1X1AA 1JG2A 1Q0TA 3G89A 5DM4A 2ZLBA 1N7IA 3E7PA 2AOXA 3BGIA 4PYKA 1TPYA 5DSXA 3P2EA 4PYMA 1L1EA 5GIPE 5ICFA 1JR4A 4FP9A 3FPEA 1G60A 3UJBA 2C7OA 5K0GA 4KDCA 4EQZA 1BKYA
chains in the Genus database with same CATH superfamily
4OJQA 4R84A 5MFPA 3GPAA 4L4XA 3KPJA 1R8PA 3COSA 3GTYX 1EFPA 4RX1A 4A92A 2MZ1A 1OJLA 3U80A 4LRQA 3JZIA 3FEXB 2OJ3A 3HYNA 3G8DA 2J3LA 3ETMA 2HFOA 1YULA 3UUFA 2R7WA 4FUTA 3RYFB 3AIIA 3VZRA 2W6NA 3ZWQA 1LXJA 1RT6A 3RUEA 3AJ1A 1ZMTA 2VA9A 3AX6A 4WI1A 3HFSA 1GTG1 2X76A 1MX3A 1EX8A 5AIAA 2AT1B 1CJUB 1K73T 4A0FA 3ZYZA 1AGPA 2C2KA 3MMSA 1HQCA 4HPWA 2EKLA 4A91A 3N3AC 1DEXA 4LK3A 5K3SA 1R9JA 3HDYA 3OQJA 4BHTA 2BQRA 4NI5A 3TVKA 1RLCL 3MGGA 4FGJA 2AWOA 3QH4A 1HGXA 3DO8A 3WLQA 4BB5A 2JGLA 1NW3A 1YB1A 3KCNA 3PIIA 2CXPA 4DPTA 3VKVA 4R25A 2TMDA 5EEHA 1E2LA 4K9NA 1X7YB 5ALQA 5BUQA 4GGOA 4FX5A 2AOUB 2OC4A 5EKTA 1M2WA 1S7GA 1MABB 1XTBA 2V4JA 2FJBB 4R9NA 3ENKA 4LQ4A 2F3QA 1NMXA 4MKIA 1H4SA 2ZVJA 4LJKA 4Q9DA 2P7IA 5KFVA 5KAPA 3K1YA 2OV8A 4QJVA 5AVYA 2G1UA 4NL5A 1MH9A 5KPDA 4IXMA 4C11A 4NNPA 3VVUA 2LEAA 2FMTA 2XTAA 1MMFB 2W42A 1G2IA 2WF6A 5IN5A 2D3OR 1GADO 5GJVC 3MHTA 2ZJ5A 3T3EA 3FBEA 1QDUB 2O67A 3K8VA 1MHPA 4CI2B 3QG1A 1YI0A 5C46F 2EQ5A 1SK8A 4UM9D 3CZ9A 2VNJA 2FF5A 1WM1A 1I2DA 4JLDA 2G36A 5T7LA 4F8YA 1YFLA 3V1TC 1EG7A 3C8HA 2RSLA 3U3JA 1RT2A 4X65B 4PZYA 4ECEA 4E3ZA 3E8SA 1MJNA 3RTDA 3W3AD 2PL3A 4X4UA 3WGUA 2JHPA 3V34A 1UK8A 1O08A 1FUYB 1M6WA 2ACKA 1R0LA 3P7MA 3AEKA 1D9XA 3VISA 5EP2A 4E11A 3F5FA 2ZFHA 5J2UA 3PDWA 2Q41A 4BKPA 3U13A 2NUTB 3LAWA 1G3UA 3DBHB 2NYUA 1FFSA 3T3IA 1Q1QA 2VF2A 3R5SA 2VJCA 4D4HA 4BJ5A 3LTNC 1T5YA 1IBMF 5F8NA 4YRJA 4WERA 4G4SO 1T35A 4RU2A 4KWCA 3AEYA 2NO9A 3MGBA 1HNIA 3TRKA 3CLSC 2A5YB 2E5GA 1AGRA 3EUWA 3Q7QA 4JBGA 3ZE6A 2ZUDA 1S02A 2W37A 2P1ZA 3A4VA 4OU4A 4G0QA 3M2VA 4R98A 1IOVA 3H5TA 5CXUA 4NBWA 1WWKA 3IKJA 1V6HA 4BZXA 1VLOA 4TMTA 1J9EA 3GUYA 4GD3Q 3IMGA 2GIFA 4G01B 2JHEA 4L4YA 3L0PA 1CQMA 1XI2A 1JWLA 2JJ2D 3UMYA 1XMSA 1B70B 2GN6A 1KQNA 1XQVA 2XYHB 1T8YA 5A9SB 3K15A 5EGYA 2JNWA 5BYQA 1VB3A 1U1IA 4UTPA 2WK4A 4F1WA 3GUCA 3QPIA 3P8BB 3PEHA 4PLWA 1XEWX 4NXMF 5A9TA 2P2ZA 2Q28A 1RXSA 2CJ9A 2MPUA 2DC1A 1BX3A 3MJEA 1XU7A 2DNQA 2PA8D 4FDAA 4GECA 2DR7A 2H63A 1AQUA 3LQRA 1ONOA 3HA5A 1HR0F 2H51B 4HNSA 2HVDA 3IAAA 2GPAA 4IOJA 2H48B 4C0HA 2F3TA 2YV4A 3WOVA 4J5OA 4V19X 2DKFA 4N03A 3SIXA 1WDWB 2WR8A 1NSYA 1Y3FE 2BOAA 5TQ2A 4G41A 2HTEA 1OWXA 4EYOA 4OX9J 3AH8A 2F43A 5FWXB 5CNMA 4GX2A 3HABA 3GH1A 4DCPB 5FO0A 1ZJ6A 5IT9U 5HJEA 4JUAA 5JSZA 1LV7A 1FFSB 3PE6A 1V1JA 4LF6B 3M1VB 4C7BA 1N0VC 1Z29A 3SJAA 5K8IA 1O8CA 5DSXA 1SCIA 4WUTA 1DZIA 5ALDA 4HQOA 1RWMB 1I94F 3ADCA 5IOLA 2CL7X 2OZLB 4EZBA 1KN6A 5HEKA 2M6KA 2DUUA 4WLOA 2V9ZA 4U96A 1W19A 2Q2VA 2HQSA 1SVSA 5D0EA 3GIRA 1CG6A 3DMYA 5BWMA 2GA8A 2OYRA 1JX6A 3W9UA 2LVWA 1I1OA 1FYVA 4L2IB 4XQCA 1YS7A 3I0RA 1JI3A 1O94C 2B21A 4UFPA 5CEFA 2KZMA 3QPAA 3GQBA 1S2OA 5FEUA 1BMDA 2FSGA 1MVLA 1QTNA 1KO4A 3ML1A 3W8RA 3LH5A 4TYBA 1EETA 1QQ5A 2F8SA 2B4PA 3C70A 4C6AA 1YT5A 3G9QA 2WRMA 4GMHA 1TW3A 3VAKA 4FNIA 4ARSA 3ZVMA 4I4TA 1WG4A 1WTCA 1C1BB 5ARDA 4MMXB 3BDEA 2W6ID 5KFYA 1CF9A 2HDNB 2WW8A 2K06A 3FPAA 2GLXA 5DGHA 4RW9B 3ZU5A 3QLHA 3CC7S 3WGJA 3M1VA 4ZAWA 1F6WA 3U17A 3LBFA 4N0PA 1D04A 4GWKA 1SXJE 4H31A 2VP3A 1H2ZA 3HDTA 2VL7A 4ZGBA 1IJKA 3TMAA 3ET6B 2F3SA 3PVZA 4ZV4A 1XMJA 7REQB 2VH5R 2VJQA 1FSZA 1L7BA 3CCTA 1PL7A 2IHVA 1E0DA 1KO8A 3AJAA 4TVKA 5TQJA 1U7WA 3GMIA 1ML4A 1JG6A 3A6DA 3NG8A 1YNOA 4J9UE 4H0CA 3P2KA 4TSRA 2IJNA 1RSZA 1GP2A 1G4HA 4O2AB 2EKNA 3C8YA 1Z12A 4LNHA 2DWQA 4IQMA 2R4FA 1O97C 4Y0NA 2HHQA 4FN4A 4RVHA 1YUNA 1HLWA 1AM4D 5LLDA 4EAAA 4M94A 4M9SA 2IHTA 2WJPA 1V3RA 2CYYA 4EHJA 3NDBB 2AYBA 4Y3UA 3THRA 1EXVA 3WP1B 2JL9A 3V4IA 2F67A 2HNKA 2W2XA 1AZWA 1R8BA 2JHGA 1AS3A 1NF3A 1WQ4A 1ZQ1A 5FFNA 1G5IA 3D6JA 5JMWA 2ZKTA 4C4OA 4X8OA 4WOCA 3QELB 1VL0A 3LHIA 1VGQA 1HPLA 3WISA 3DMNA 4JJ7A 3TW4A 2JLAA 1MJHA 3FKSD 1DBWA 4KW7A 4CEIA 1AUDA 1AGNA 3HP7A 4BX9A 1AUQA 3OPVA 3H1BA 4M60A 1T2NA 2MTLA 3ZXIA 4I4TB 1ESCA 1TUGA 3HA7A 2YXPX 2MR6A 2OPSA 5C3UA 5IVKA 3L4SO 4MS4A 1G3QA 5I45A 4OLJA 2XDWA 3IPXA 1D0EA 2WNSA 2YNIB 2VRWA 1S4EA 4F2SA 1ARZA 2Y1LB 4N6GA 4IX9A 2J32A 3OZBA 4KE6A 2WKSA 4EHAA 3W9IA 2IZZA 4LS3A 3OKCA 1XVTA 2O52A 5BSRA 1QS0B 5CT5A 1YC2A 3ZHUA 1WE2A 1GQQA 3HYSA 1CNMA 5JD5A 5KNBD 3QYPA 3PQFA 3SSNA 4UF4A 2JFXA 4MQ4A 4EB6B 1KJWA 2M0GB 4HFJA 1QG0A 3OF5A 3DGPB 3BEDA 1V9OA 4Z37A 1NI4B 3AY7A 3G2XA 1NUHA 1Q5PA 3WLAA 4S1WA 4ZQBA 4F85A 1M2EA 4BMSA 1H4VB 4DL5A 3RODA 4DTCA 3D0RA 2BJEA 4EMDA 3VVBA 4Q4JA 1MLDA 3GFGA 3C15A 1NDUA 1F2DA 4RWZA 1I2MA 2IHBA 1N5LA 2LV8A 1O0SA 1YDHA 4WZAB 2VDKB 2JCSA 2FN4A 3ZHQA 1WZCA 1OVGA 2KT5A 1MWQA 3VOTA 4S1TA 3DNPA 4UAVA 2HK8A 3CEDA 1ULSA 3JZDA 1LX6A 4C87A 4JI7J 3R7BB 3H9EO 1DEKA 5L7WA 2O3QA 3EWSA 5CCLA 3UAYA 1YX2A 4D9JA 4LF2A 3LGMA 1X9WA 1P75A 1T4CA 4XQGA 3OQ2A 4YB5A 1I3LA 3ST7A 1ZRHA 4DA8A 2IXTA 2C77A 3LYHA 1TPYA 2EVZA 1PYDA 1RXVA 2EFOA 3LP6A 3C45A 4IOKA 1W5EA 5EQFA 5JMTA 1DELA 1ORWA 1NZFA 3OAAD 1IQRA 4F6LA 2HG4A 5F78A 5A4FS 3RTBA 5ES3A 1H2FA 5DCWA 2WJ3A 5AW4A 3TOXA 1Q20A 3NM4A 4MA4A 4FR2A 2O7SA 1TR0A 2PBLA 1EVZA 1JLBA 3DZKA 4WBNB 1AA6A 4X1YA 5AI8A 5AICA 3QPBA 4PCAA 4DLPA 2ZVDA 4N82A 4O3SA 3M83A 1N5YB 2IPAB 1RT1B 5LSOA 1H05A 3AZQA 4LGYA 3TJ8A 3FCOA 2R8OA 3GHYA 3TSCA 2QNRA 1Z74A 3RE1A 5L9NA 3TVTA 4CFYA 2AEEA 3TRJA 2FFRA 3I55S 4IV8A 4LBIA 2VZ8A 5DTJA 1X7VA 5D6NA 4XK8C 2OMLA 3I28A 4WZAA 2E5IA 1UBLS 5HIKA 2W48A 4ID5A 2WU4A 4YYZA 1RAIA 3N58A 1R5BA 2GV1A 2XXAA 3TQRA 1OSNA 5DZ6A 3PRBA 4ND2A 2B56A 5LNK6 2C54A 8ADHA 1SJFA 2C5AA 1OAOA 2OVBA 4ITUA 3FXAA 3H42B 3R9LA 3ZDBA 3AEXA 4OHKA 4L8LA 4B9MA 2NACA 3O8DA 3ITEA 1HE2A 3ETGA 2B83A 4OV1A 1E2KA 5EIWA 3C74A 1RPTA 2GCOB 4C6TA 4FYKA 4W9NC 1Q50A 2Z4PA 4YUDA 1F8YA 1E94E 4KI0A 2XSZA 4LBYA 2OBNA 2B7CA 4EBCA 3KJIA 4PO9A 4YOEA 1VCMA 2EL7A 2HR1A 1V35A 2ABWA 5LJLA 4HHHA 2DWUA 1JK9B 4KBFA 3MM7A 2EDAA 5CD4H 1U1QA 4TMKA 1S76D 4QPNA 5TQ2B 1S0MA 5C7IO 4ZCPA 1JSRA 1CF4A 2BHSA 4TKZA 5H9EK 4YX9A 3WZMA 3JD4A 3A1FA 3DLPX 2I87A 4JJ8A 3PPWA 2P4SA 3VNVA 3OXFA 3CURA 4DLBA 5BQ3A 4J9MA 4L85A 3OTWA 1M72A 1S2DA 3GC6A 5IJAA 2GQ0A 4MQ6A 5HVHA 5HKBA 2VDQB 3ZWKA 1FTWA 1F4PA 1XNJA 1FLAA 3RARA 1Q0LA 3ESBA 4D9EA 4L7VA 1E9EA 1M0EA 4GEGA 4RPCA 4F3QA 4MZDA 3KMSA 4IQ8A 2UZ0A 2ANEA 4Q9LA 3G2NA 3LH2S 4I8XA 3TFOA 2AGVA 4BCBA 5ALXA 2TMGA 2YKOA 4Y98A 1T15A 4D92A 4BNGA 3M8RA 4P2SA 4Q4DA 1FE0A 2AW3A 2LIVA 5C51B 2PZGA 1TJPB 4B84A 2GM9A 3HKDA 2PPVA 2AF6A 3RYIB 2VQFB 4TWAA 3OT5A 1S0NA 4M9ZA 5JPCA 1DOHA 4R1SA 1EKXA 1Q19A 1SBNE 4FTWA 3BZUA 5JDIC 1E9FA 4MI6A 3ZWOA 1MWZA 2HQGA 4PAQA 4XIGS 4EGJA 3BBPA 4DB2A 4J9QA 1L3UA 3HVIA 3S27A 1VLZA 1FXRA 2BT4A 1PWXA 2IJRA 1YFKA 4AXJA 3AEUB 3FUXA 4AS1A 2B98A 2NZCA 1H2EA 3LDHA 1PD0A 2RHHA 1UZUA 4UOCA 2CBXA 1D2CA 4PS0A 5JVHQ 3BFPA 1IBCA 4POAA 1FEZA 2FUEA 3BXXA 1RYSA 3TTWA 4ZQEA 2II6A 5CA1A 1K4YA 4CKEA 3GG2A 2HA0A 4RMGA 2VJUA 2HHJA 3P9ZA 3V8QA 4JV5J 3U31A 4I5GA 2CQGA 3N05A 1K4KA 3MWEA 3OQIB 4WGGA 3ER9A 3G13A 2M98A 4PPQA 4LFBB 3ZZRA 4RD6A 2IOQA 3LBIA 3VSCA 3LWVA 1WC0A 2QL5A 3SC3A 5G4KA 3HSJA 4H7FA 4PX9A 4UJ5A 2YQ0A 3GPIA 3F9CA 3FWYA 4AKIA 1U8AA 5J1TB 3FI0A 2WU8A 5DB4A 3SLRA 2XB4A 3PVCA 1R37A 1S72S 5L46A 2CVZA 4IZ6A 5KYUA 4K4TA 2ZH6A 3BGFA 2B1IA 3DKIA 6ADHA 5L6LB 1IKWB 4E2FA 4U95A 3MEEB 1LA2A 1T9DA 2AJ2A 3I37X 1S77D 1IVNA 3INTA 5TGZA 1Q92A 1GYQA 3NATA 2OBXA 3MM5B 4Q5VA 3RT1A 1UCNA 3I9KA 5EDWA 4PZUA 1XEWY 1L4NA 4N5MA 1RA7A 3M0EA 3NBXX 1Y3BE 1P81A 1RLDA 2O8EA 1U25A 4QVGA 3G0CA 4K0KJ 4IQXA 2OP0A 3ABZA 5LZ7A 5IDXA 4HX9A 4ZVFA 4M98A 5HA5A 3GJQB 4WKPA 4DS5A 2KT2A 3JZAA 3H1PA 4OK5A 4LYHA 5LZ5A 1Z36A 4K2JA 5ETQA 1P80A 4JU8A 4DR1B 3COVA 2P35A 2I66A 4XVQA 4YRTA 5KYYA 3DAPA 2RS8A 1MF7A 3OZWA 3RIGA 3CPEA 5I7SA 3QUAA 1LVUA 4B45A 4E94A 3TQIA 4EAQA 1BQXA 4XB2A 3D6VA 4M0KA 5ESWA 2HHXA 2V7EA 2BONA 3FBBA 4JYBA 2Z56A 3T5PA 1CULB 3B89A 1A96A 1LQUA 3C1UA 3LUBA 2BANA 2NZ2A 4YP7A 2E5LJ 3IPRA 3O0TA 4HL9A 4XPIA 5TXGA 5HF9A 1JV2B 1SZJG 2J59A 5F7XA 2H07A 3N8HA 3EDYA 1YFZA 2VJPA 4K8RA 3RBXA 1RYNA 3UHFA 3DLTA 3OCZA 3OT1A 4OH7A 2F1KA 2Q0XA 3LW5C 5C31A 4ZO7A 5FYDA 4C0WA 4HT5A 2AZDA 5CT4A 3ITDA 1M7GA 2TS1A 5K45A 2BQ3A 2O5DA 2WWWA 1JSLA 1EWYA 1P2GA 2C2MA 1Y5LB 1U1GA 2CIMA 1SHTX 4DIEA 2MKYA 2W6ZA 1CUSA 1YH3A 1YI2S 3NCRA 2A58A 4KRXA 3BE6A 4ZGGA 3RLIA 1UEKA 3KLHB 1BD4A 3EB9A 5JYBA 4JI1B 3DZIA 1Z0JA 2ZJAA 3PQ3A 5AESA 3CRMA 2BFBA 3KDAA 1X70A 4MPJA 2JIMA 2O1PA 4C0JA 3SZOA 3GZ7A 1UAGA 4K87A 1VC2A 3U81A 3ZWAA 4YR2A 4G1QB 5FOVA 4JJKA 5I42B 2I7XA 3T99A 5AKZA 4LOAA 4M63A 1T9WA 3FDZA 3P3DA 3RJ9A 3WK5A 2WP8J 3ILJA 1JG1A 2P0AA 5ECDA 2CFSA 3ZGYA 4LF8J 4YALA 1ISJA 4D9GA 4JGBA 3SNHA 3ENZA 3VSEA 2PKXA 5EJ5A 5C4IA 1FKOB 2X41A 3ESDA 4FFBB 2ZFUA 4N8OA 3SEZA 3EXFB 2YYSA 2XRZA 4DM4A 2DVMA 3RBVA 1YF3A 5KFDA 2XY6A 1FJGB 2DT9A 2PH3A 2W90A 3D0IE 4N3AA 1VECA 2QP3A 3I5YA 2F4VF 2INGX 3MF4A 1TZCA 5A03A 4BMNA 3JR7A 3W5IA 4X7RA 2CNOB 4IVNA 3KM0A 4ZYXA 3F0TA 1XD9A 2A0YA 3BL5A 4NSNA 4BV3A 1R3UA 2B82A 4YCNA 2CLHB 1FRZA 1RJ9A 3U1BA 2OHOA 4EPWA 1U3CA 4MGEA 2B7CB 2VG5B 2ERYA 4OLOA 1TXGA 4WJZA 5BWOA 1PW7A 5FR2A 1TF7A 3K2QA 2QD1A 1BVHA 2HMWA 2QTNA 4GNRA 3HFVA 4A6EA 2O06A 2D1FA 3W34A 1YQDA 4USJC 1UPFA 3A06A 4QJ3A 1Y4AE 4RM3A 2OZKA 3I9ZA 3LBHA 4EHDA 2YX1A 3H59A 3DNCA 4KACA 1XMBA 2XZTB 4RY8A 2GM3A 3LO5A 3UXYA 3NOXA 1K7FB 1E2QA 2QNIA 1ZM4A 3WK4A 3UOAB 4A23A 3EUNA 2V3CC 1JDPA 1ORVA 4MQBA 3GU3A 1VIXA 1NP3A 2VVTA 4LSLA 1BDMA 2F3JA 2C9MA 3O9MA 3BIOA 2GVZB 2QYTA 1GSOA 5T6MA 4CG1A 3U5TA 1FXLA 2ZE7A 2QW8A 1OWNA 1QIFA 4MLCA 5JXWA 1C0TB 2HA3A 4E5MA 4YHHJ 3Q0EA 3A1WA 3ZHZA 1KQ3A 1VBKA 1NQAO 2B4TO 3A8JA 2C2YA 4GRDA 3SBEA 3ZK7A 1UBSB 3NTQA 3FRYA 3TO8A 4F9FA 1VFJA 1KAEA 1ZUNB 2YQ1A 5KDOA 2JBWA 4GIBA 2M7SA 2WJZB 4MJLA 1NJZA 4KO4S 1TVCA 3HU5A 2YPZA 3W5DA 3V80A 4MYRA 1M6YA 4Z53A 5CUQA 1NN0A 3PC7A 3S68A 3QW4B 3CRVA 1UT6A 2CL0X 3H8YA 6PFKA 4GMDA 4X6YA 3VO1A 4GPAA 4OHCA 1QPGA 4IEIA 1S8NA 2RB7A 3BO3A 5IH7A 1XZIA 3RW6A 4FHEA 5T67A 2XCIA 4GKJF 4R01A 4TTTS 3HA3A 1PJ3A 4WE3A 3E8OA 1M5VC 4DXLA 1WHWA 2VFSA 3L7YA 2VLBA 4LQLA 1A5TA 1MNEA 3EXG1 4QYWA 3UR0A 1H3NA 3L7AA 4D81A 2QSWA 2QLLA 4BOYA 4ALNA 2VF5X 4RJVA 4U2DA 1B7YB 2AU0A 4DUYJ 4WJKB 2WTAA 2ZR0A 1Y63A 2A0WA 5ECGC 4O3QA 1GQRA 3VU1A 2YFKA 1TUIA 1A97A 1U1CA 2DECA 4WUVA 2BJ8A 1BAPA 2CLIB 1SNYA 4LRTB 5GPBA 4ILKA 1TM5E 3HPQA 1IHPA 2E9RX 2XS2A 1OO0B 5IMSA 2PS3A 4R2LA 4X1KB 4NP6A 3H98A 1AHNA 5IPFA 4L78A 3DKKA 3WLPA 1XZJA 3H99A 5K6TA 1PJBA 3F6RA 2XDQA 5CDYA 5TS3A 2XZTA 4HGOA 3KWLA 3H2HA 2O1EA 3HCAA 2DR6A 1CY1A 2VONA 4YASA 1NVFA 5C2JB 2H9ZA 2FPGA 4CT5A 4RENA 2F3RA 1X1CA 4J9SA 4O2RA 5HQTA 3THWB 4H0FA 1ANKA 4EW1A 1GFSA 5A4JA 4Q34A 4DXHA 1NI4A 3NWJA 4QW8A 4A27A 2FMKA 3LWPA 4B3TJ 1FESA 5LXRA 5KX5A 1I5OB 3NBYC 3M6LA 3CPJB 1M74A 1I51B 2QVGA 1VTKA 2W93A 4CLWA 3NWEA 3CJ8A 4WCFC 2Q3JA 3K0FB 4Z0PA 3CGIA 4TTQA 3UKOA 1W5SA 2O1SA 1OYOA 2MB0B 1MW9X 1HNNA 1AZSA 1MMLA 4FYVA 3SEOA 1FKPA 2IPXA 1OX4B 5CJ2A 4D3SA 2ZH3A 1YAHA 1LFDB 3ROMA 4Q47A 3FH0A 4EKEA 2W8KA 1AUVA 1U8YA 1FLDA 4F3RA 5DKFA 4UDYX 3GEMA 4JC8A 3HBNA 1MIOB 2HFJA 4FDLA 3H2UB 3R4VA 4D02A 5JOQA 2BEUA 2ZSFA 2WD7A 1XDDA 1RTKA 4FFNA 5ECYA 4DG8A 5JAPA 2F9DA 1OBFO 4DLLA 4R7GA 2OELA 4EPTA 5LDHA 3C3KA 2FQQB 3O84A 1Z5WA 4E70A 1G291 1YU6A 1UJMA 1N2CA 1Q78A 3MCMA 5JMOA 5BR7A 3ONQA 1Z35A 3CZRA 3O8OA 3WRYC 4V0NA 3PE4A 3Q10A 3RVMA 4WY8A 1PX2A 2P8SA 1TM4E 2FJWA 4JSTA 4KKVA 4G4IA 3SKXA 1GM5A 4I9HA 3SYZA 3WX8A 2EZ4A 3MWBA 2DQZA 1JMKC 4JI3B 4CTAB 1DI0A 2BEVB 1OXMA 3F41A 5AOVA 2M88A 1ZETA 1PJQA 5ILQA 1VLMA 2XA1A 3ZVRA 3NTRA 2V4JB 2YMMA 4ECXA 1YDGA 4R9SA 4YDRA 4IICA 3MUNA 4MRRA 4GMXA 4M89A 3U40A 3L8ZA 1MO3A 3NTOA 1XD2A 1UVIA 2QGFA 4G5FA 3HXPA 2WU3A 3QSIA 4JV0A 1ECPA 1V16A 2YJ6A 4HJRA 4HNTA 1FSSA 4URVR 1CEYA 1THZA 1P7YA 4B7XA 2F48A 3E5HA 2ZBCA 1HLGA 1T11A 3IP3A 1N5MA 2QD3A 1R10A 1RYYA 5JH7F 2QSZA 2PRKA 2NO1A 2QVBA 4YV1A 4RVUA 2ZYTX 3B6JA 3LHSA 4Z2XA 2GWRA 1QZ3A 2ZRJA 2NYVA 2FDRA 3BZBA 3FQLA 1Z38A 3VAIA 3D1QA 1O95A 3RSGA 3NUZA 2O8EB 2VS1A 1JG7A 3DOMB 3OR2B 2ZJPQ 5IU6A 2VNSA 5F0UA 3ROPA 3L40A 5IT0A 3VTIA 3PW0A 3RS5A 1NI3A 1G8JA 1S1CA 2AD5A 1NOKA 1SG0A 3MPWA 1DQ9A 4AUKA 4G85A 1WOYA 4LZPA 2VG7B 1J8VA 3NEJA 5BSUA 4NBTA 2NVWA 5KZMB 1ZM9A 5HR5A 3FC9A 1FRIA 2DGDA 2VDNB 2O54A 4DOZA 3BJZA 1VHQA 2Q66A 5LBIA 4WLVA 4OJ3A 3FLEA 3TL2A 3GH3A 2G17A 2ORIA 2HTFA 2UYHA 5LYJB 2DPGA 3QIPA 1LF0A 3WYBA 1PKEA 2Z2MA 3UN3A 1Y00A 1B2RA 2X1BA 4DZDA 1SOAA 1Q16A 1M5TA 1PZHA 1FYFA 2HGSA 2RIPA 5H5JA 4L0QA 1WC4A 2DY9A 2IIHA 4F5EA 2KMLA 3H75A 3MRTA 1UEXC 4Y1RB 1QVZA 4DNPA 2ZB4A 4FE4A 1U3WA 4ZIRB 1P33A 5SZHB 2O8DB 1QGZA 1FKAF 4CUZA 4F6RA 2A78A 1MO5A 4MIEA 8AT1A 1FT8A 2I1VB 1LC3A 3A3KA 4ILEA 2ZJYA 1AXRA 1QY7A 1VLYA 3GJ6A 2PEBA 3GPCA 5FRDA 2YZ7A 4TL9A 2P6SA 3BF8A 4HN2A 4ZT2A 2J5TA 3LXUX 3NMRA 1OIXA 1NW9B 4EF5A 2H29A 3FWKA 5MAOA 4CODB 4TVSA 1KAQA 1TUGB 1CJSA 2BKLA 1VIOA 3WYAA 2VJNA 1Z5VA 1S1WB 3NAQA 1WB9A 4C04A 4E5VA 4WKNA 2P1DA 4ZAGA 1P44A 1R4NA 3VO9A 4F2HA 2P90A 1FJ2A 3FSJX 3IR7B 3F1KA 4UXHA 1XA4A 1UFVA 3LQKA 5ALHA 1VFPA 2CNWA 4GU5A 3TQFA 3C14C 1ST3A 1SKBA 2ZDOA 5EXTA 2HVZA 3L7MA 3DBLB 3PUYA 1L7OA 4YB8A 4HAVA 2BGGA 1YZ3A 4K5RA 1EUQA 3EA5A 1F8UA 1QHEA 2HI0A 1VPVA 3EXG2 3VX4A 1QKJA 4B2YA 2OPPB 3CJQA 5TQVA 3IHLA 3QVVA 1U3TA 3HFKA 3NHKA 3SU8A 2FEMA 3KTAB 1R00A 4DV2F 3VYSB 4D99A 1FPQA 4H4KA 2MGZB 4QWEA 1PGOA 1VXRA 1NK8A 1Z75A 2DPYA 1Z8DA 4KIJA 2ZU6A 3QIAA 2P9EA 3G96A 4WBXC 5TNXA 1CYEA 1RLMA 4TXSA 1NVKA 2F64A 4JYMA 1T6NA 3WJ7A 3W64A 4R0EA 3KYDA 2YBVA 2FP4A 3O38A 5DNAA 1AKRA 3QLHB 3PFBA 3QGGA 3NT4A 5SZIA 4NZZA 5GV7A 3DD5A 1LNZA 1PQYA 1JPVA 1C9DB 1CUHA 2KHDA 3FUTA 1XDGA 4IRXA 4P3XA 2AJCA 4D9IA 1D8ZA 1L5VA 2BUCA 3OI7A 2IYWA 3ZE9A 4FYYB 3VM6A 1EFDN 5JATA 3T1AA 1S0VA 5JUWA 2FQYA 2VRCD 2PS9A 1A95A 4JI2B 5GJCA 1ZPVA 4P32A 4PAWA 4UUOA 5IEJA 2C57A 3T9FA 1NBMD 2QZ9A 4X65J 2OCDA 2WM2A 3SLKA 2HMVA 1SUPA 4MR7A 3ICEA 1KBZA 3W5UA 4K6HA 1JG4A 4USWA 2ZUCA 4JLVA 5SY6A 2HQ1A 2FC8A 1HPZB 2QJ3A 1KQSR 4KPGA 4MVJG 4KVFA 4C8KA 2KLBA 5DEOA 4YYEA 5CITA 5ALWA 3ZDFA 1K1SA 4QNNA 3GP3A 2KFZA 1KTQA 1QSYA 1YJ7A 3TB4A 3QBVA 5FNZA 4OAQA 4LRBA 4GVBA 5TLSA 1GU0A 5CM9C 1Y8QB 1H5NA 1N5KA 2FP4B 2ZBEA 2EX0A 1RE1B 2Z0GA 2GESA 1DNPA 2ZH8A 4A8TA 4IVQA 3UV7A 4BY9E 1XDWA 2PUWA 1MC8A 2AF4C 1RGVA 5KTQA 5AUPB 2P62A 4D80A 2ZIUB 3C3DA 3MAAC 3BYRA 4OYPA 5A6PA 4RS3A 2Y1IA 1TV6B 3ZE1B 3GIMA 3TTVA 4X44A 4BVHA 4C4SA 4AROA 4W7SA 4YY3B 4CL3A 5AE3A 5HCIA 1EFTA 4ND8B 3BH7B 4E6PA 4LYYA 1KKHA 4OM8A 1LEHA 5JJLA 2YVSA 3OW2R 2GQCA 4OKSA 1JKIA 3UO8B 1MAVA 1N2OA 4P4SB 1U4OA 4PYKA 2WF9A 1WZEA 3A3PB 2IY8A 1R4ZA 1N9ZA 3G85A 1BS1A 2ZE5A 3PGJA 4J7CA 1GT8A 4B3MB 4FS2A 3VTZA 3DOLB 4X4TA 4MAAA 2V7XA 3I34X 3ZWDA 3ASUA 2HXGA 4G9GA 5ETPA 1NXIA 5EA2A 2POQX 3PXEA 4YB6A 5DHTA 4ZVPB 2VAXA 3ZBTA 5A9RA 2XZPA 2X0DA 1DTWB 4GVBB 3F5MA 3L0IB 1WKCA 4YXWD 4IFVB 3WWPA 4OZNA 4QWMA 3IILA 1ZEJA 4HTAA 3GY0A 2HEGA 3KELA 4BRWA 2WSEC 2ZANA 2YFHA 4NU6A 3FGVA 5F1PA 3D0KA 1ZIYA 1ECGA 1MX5A 1BN6A 1FVQA 1SAYA 2XEDA 2QZ4A 3C15B 2F1IA 5C5CA 4ZREA 1X7XB 2DGSA 3V32A 1VQ4S 4URHA 2CW5A 1P39A 3CJ2A 3JSBA 5T4HA 3T15A 3CU5A 1MKYA 4DMKA 1RXWA 1JXAA 3FOCA 2BBOA 2H9AA 2IXDA 5H4GA 1KYYA 3RR7A 4E5NA 1XTRA 1QRDA 1BUXA 1QYCA 1QGED 4TV8A 4FINA 2CWKA 4OL8A 1NR5A 1O89A 4Y1FA 3UGTA 1KKMA 4WBNF 4LWZA 2O3SA 1J49A 3M5PA 4E46A 4E31A 4NY1A 4I81A 1YV9A 3FCVA 1TZ2A 3OQHA 3RJMB 2CYCA 3DE1X 2M9MA 1F2TA 4IIJB 4X45A 1B00A 1VRVA 3INRA 1EK1A 1Y8RB 2H54A 3F1LA 4LJAA 2NNLD 2GAAA 1OH6A 3OQMA 2F8LA 3DQPA 3BZWA 3EQZA 2N9UA 3ILYA 1PYTA 4BLVA 1WSVA 4OLPA 3VNUA 2EWMA 3UGKA 4NLUA 3VDQA 3A6HA 4GVXA 2HNZB 1QIDA 2QF7A 3NBMA 4HZIA 5T7LB 4M21A 1AKNA 2IPLA 2ZS8A 5E2BA 2OE2A 5F1KA 1GPKA 4Q3BA 1RLOA 2AFIE 3HJRA 1MN9A 1QLWA 2BSQA 3UWOA 3F7TA 3CUSA 4ZLPA 4TL8A 4RTKA 4B2PA 3GQBB 5IT9A 3SC2B 2GWHA 3O3MB 1E7YA 3P20A 2ZHOA 3TSZA 5B4UA 2HQRA 2ZAYA 2EGHA 1KY5A 2ECPA 1LWCA 1DKMA 4DF3A 5K3OA 2FWBA 1MB2A 4X1OA 4DT1B 1DCMA 3PXAA 2JG3A 3ELDA 3FGOA 4QUAA 2X8LA 2IHKA 2Y1CA 1EWVA 1O9HA 3H90A 1KI3A 3GE9A 5AUNB 4IGFA 5AVKA 2XZDB 4X85A 5LCXA 4KHPB 5F8MA 1UT5A 2XO6A 2SCUA 1J22A 2BFOA 2RGYA 4UEJA 5E6UA 4PLHA 3K0AA 1HETA 1SKYE 1RBYA 2VG8A 5EE5B 1ZVJA 4NX2A 3R8FA 4U7FA 4MW9A 3VXKA 2IVYA 3P45B 1NB2A 3HZZA 2QG4A 4W9MC 5B6JA 1JYSA 5FDLB 3RAPR 2WJYA 4BS9A 2RB4A 1Y5IB 2R7VA 1NY5A 2X8JA 3SOPA 2U2FA 3EZUA 2ZK7A 4ZAYA 1UXKA 1F0XA 4DV1F 2J8ZA 1NHKL 4GBGA 3A1CA 2G70A 2P2DA 2AJTA 1P9LA 2W9BA 3O8QB 1EIWA 2H3EA 5IFLA 3OV7A 3UYLA 2C4MA 1BW9A 3V4VB 1XALA 5I01A 1AB8A 4G0PA 1WB6A 2M52A 2WUFA 2GA7A 2OG1A 3E22A 4QREA 2JVRA 1P8AA 1FFEA 4N7BA 4G0MA 2G6TA 2C5SA 2B5OA 1A9TA 3NOCA 4G3XA 3QTLA 2Q8NA 1YBUA 1LJUA 4IL5A 5HKAA 3OQIA 1WNTA 3S1AA 2PN6A 3HHLC 1FW6A 2AC4A 5GP1A 2FN9A 2DHEA 1QE5A 1WHVA 1NOIA 4C88A 3DU5A 4H59A 3P96A 3U9SA 1IIRA 3JZFA 2H2GA 1J2UA 4OREX 1BLUA 4ZD6A 2M6SA 4LQ9A 4DV5F 3BXHA 4Y67A 3PXXA 1BKSB 2JFFA 3W2WB 1F0NA 2P6OA 2ZRKA 5LP6C 3U3XA 1EGMB 3M5CA 2AK2A 1W34A 1XLWA 3WGVA 3ND9A 1TE2A 2Z3VA 2NADA 4DV5J 3HFRA 3IP5A 4CGZA 4BWVA 1GO2A 4BTEA 5B0BA 1MW7A 3O82A 4KR0B 5B2ZA 2RE1A 1YR3A 4KHPF 1JR2A 1SC9A 3FAZA 4WXHA 3NHLA 1ENZA 2HLTA 5COBA 4EY4A 2ZE2B 4OUKX 4RLSA 3EJWA 1U1LA 2X2FA 4RKUC 1KDPA 1XVVA 4AWAA 2O3JA 2Q1SA 3GR1A 1SOWA 4JI5J 1V8BA 3WGIA 1TFUA 1KQOA 4FF2A 5JZMA 4AF7A 2FEOA 3OZEA 2FVXA 4BTLA 4RNNA 2DJIA 4Y2GA 4DSEA 2EWWA 2HHTA 4Q7EA 5BW5A 4G07A 3R76A 3GUUA 4ZOEA 3R2CJ 1M2VB 1WXQA 2OORA 1NWCA 2HSGA 5JPDA 2J1LA 3GFOA 1M2KA 3G02A 3RRHA 3K8WA 4Q4LA 1BXRA 4P73A 3IM8A 5IYZB 5E6SB 4PINA 3VH1A 3RVNA 3WI7A 1T25A 4OA5A 1KQGB 1WC1A 2QZ8A 1KOHA 4PWYA 3LO3A 1VPEA 1K7EB 1ZGHA 1QKKA 3THSA 4HDAA 1U0SA 2OKCA 4ZIVA 5JT1A 1Q1GA 4IJVA 4RQUA 3CCRS 1GWNA 3DQZA 4Q2LA 1JDBC 3SQXA 6GPBA 4L22A 2O2IA 2PCJA 4DV5B 4YQZA 2R8JA 5CLLA 1GMVA 2Q1TA 2CVQA 4ZN1A 3LQVA 3ACCA 4IIFA 3PEUA 2XUPA 2DTXA 3T1YJ 1WLSA 1DADA 2C4KA 1FMCA 2IBSA 1KL7A 3CWZA 4ZI2A 4HQFA 3PXUA 4DN6A 4C6RA 5BOSB 1B6SA 5TY0A 1FRQA 1ULHA 2NYHA 1LBQA 1NHVA 1Z4JA 1G8PA 3ETNA 4QPDA 1CS0B 1JIQA 3STXA 1PS8A 2XB2A 1EETB 2NLWA 4ZO4A 3PR2B 3FNFA 3PLRA 1RKJA 1XCLA 7MHTA 2ZT8A 3LP2A 3Q88A 2O9JA 4FWTA 1EJ7L 1P0QA 2Z9CA 1FZQA 4YCBA 4GF5A 1R8QA 1DCTA 1TK2A 1R0CB 4OATA 5BR8B 1QUFA 2XCSB 4B3GA 1XXHB 2J31A 4B74A 4HH4A 3OWOA 1P3DA 3QHAA 3DM2A 1MMNA 4NV1A 2ST1A 2HIHA 3JVUA 1KIMA 2ZSBA 3UN1A 1SPBS 4LTNA 3E5MA 1Z0SA 2YWXA 4QDTA 3EPHA 4AYBD 1KK2A 4AL5A 3WBZA 1BGVA 2WICA 4OVKA 2X42A 1EX6A 4WNCA 3L2OB 3SQNA 4FNHA 4UM8B 1XN4A 3QMMA 5ALSA 3R9XA 1ZFNA 5HIJA 1OY6A 1KVJA 2DBZA 3DXZA 4WYLA 1NN3A 3OEYA 2Q1WA 3KKLA 2WAQD 4HHJA 3NH6A 3MMCA 5KFNA 2OHIA 1XTVA 4O4JA 4ACBA 2JD2A 3H2ZA 2PMZD 1K44A 4ER6A 2L42A 1VRTB 1SJ1A 2G4BA 4ZHQF 2Z8YM 1T34A 1FF9A 1P5FA 4QEDA 4IH1A 1BDJA 3FPSA 5B37A 1CT9A 5KFHA 3T5AA 2OO5A 4Y00A 4TS3A 3IAHA 2BH2A 4O5AA 3WMEA 1NH8A 3QVJA 4EZIA 1KYZA 1TT5A 1P62B 2DR0A 8ATCA 4KQIA 3E15A 4XKJA 4FBGA 3ZZUA 2DHSA 2QA2A 4KQWA 1C30A 3P4XA 2IX3A 2OCBA 3QM1A 1SXLA 2IXEA 3UBMA 1Y6FA 3DE5X 2XLIA 1HI9A 1N56A 1WPXA 1MDFA 4YLEA 1A76A 5E7OB 3AG6A 1FMFA 5KQSA 5DF1A 4UTNA 1XZAA 2LNDA 4PHHA 3QNWA 4NOHA 3A25A 1YDLA 1T2FA 1NNLA 5EIOA 3HN7A 3SZRA 3VYRB 1LW2B 4RW6A 5H9FJ 4F4AA 3KEOA 1BNCA 3WTBA 1VKNA 1B4DA 2HNAA 3UR3C 2PUEA 1WS6A 2WG1A 2CQ2A 4UEOA 1CB0A 4JQZA 4RZXA 4DA9A 2WLTA 2RGEA 3HLTA 2CQCA 4ID3A 3N59A 1XPJA 3T3MB 3QMPA 1ZD1A 1DBRA 1KYVA 2QTHA 1PTJC 4JLPA 3WGNA 1PVDA 4J6EA 2O48X 1SEVA 4M6WB 1RZMA 4BV9A 4V1CB 5IT4A 1LQTA 3HYTA 3Q4GA 2X5XA 3ZNQA 1I0IA 3QPVA 4H1TA 5L4SA 1JLQA 3WIBA 4F2PA 2WM9B 3AF5A 3ASZA 1L7QA 1L5HA 2RBGA 2VP9A 2Y1EA 3F56A 1B26A 2YY6A 4Q1EA 2C9ZA 3R6GB 3GYBA 2NYAA 4HGRA 4JIMA 1PJ2A 2ZRFA 3BM7A 1UC9A 3TRFA 4M5NA 2WLSA 3RUAA 4E0BA 4IW3B 4QU5A 2YTCA 2H7VA 1WETA 3FKSA 4RFVA 2YIJA 2V5AA 4EFAC 1Q14A 3AG5A 2VFAA 4OIMA 2AOWA 2I8CA 4RESA 1XTJA 1TEXA 3HLUA 1SCUA 2CSXA 2XZOA 2UUCJ 4JI6B 2XNDD 4US0R 1JLEB 2QZJA 2VHTA 1NXXA 4HACB 1W9MA 1IJBA 4A47A 5H1SV 4YAEA 3TAPA 4ZO9A 2P5SA 3JVVA 3WL4A 3P9IA 3EARA 4O3RA 3AKDA 3H9JA 3U6KA 4BX0A 4BECA 3I6PA 4Q18A 4C0SA 4I6YA 1KERA 4LHZA 4E5DA 5ALPA 1NYRA 5B3AA 1GMUA 2JH9A 4Q1DA 3ZHSA 4KJIA 1O97D 3IP7A 4J3NA 2YYAA 4KRWA 3GZJA 1I7QB 4ZHSA 2QLMA 3K8OE 5LU9A 2D4AA 3H2KA 3ED5A 3V5RA 3PGVA 4R2HA 5IJWA 3ANXA 3IBCA 3LMKA 3Q83A 3O95A 4L4RA 3ZGZA 3EX7B 4E88A 2MKIA 1F0PA 2NP7A 4JI2F 4PX3A 4ZZ0A 2E48A 3HB5X 1I5EA 2VJDA 3R5JB 1U98A 3GL9A 4D41A 1R16A 4EHNA 1A8PA 4CM2A 5E3IA 1DB3A 2O23A 4HRVA 1AT1A 3JTMA 3L0CA 1U2EA 2IC5A 1K2VN 2L17A 3EPIA 3CO0P 1G59A 3PYFA 1ZK4A 3PCRB 3J81k 3STUA 4RK0A 4JL5A 3VPBA 3D81A 4BP3A 1TF2A 1DWUA 1U09A 2CE7A 2GJ8A 5CEJA 1BJKA 1L6RA 1C8KA 1Z6XA 2HPHA 3CUUA 2IXBA 2VHWA 2X0NA 4N41A 3M9OB 3EZ9A 4B47A 2RGUA 3HKEA 4WINA 1QP4A 4AZTA 2J9EA 4YRPA 3TI0A 1PP4A 4IJ6A 4RPHA 2W4CA 2YUIA 3WB2A 2RFKA 2FN7A 4QU9A 4BEJA 2VATA 4WKRA 2ZCJA 4I55A 4J2HA 4FI3F 2P4UA 3H86A 4DCUA 3IBWA 2F4NA 1VKRA 4BJ1A 1XT6A 2X0KA 2Q7DA 2NXUA 3VHXB 1O94D 5K8UA 4O4GA 3K6KA 5CYQA 4NAHA 3QV1A 5LLSA 1M5PC 2HKEA 1TJYA 1TJ4A 4W7HA 3EUAA 3THVA 1SG9A 3GLIE 2EKBA 1WMFA 4HAUA 4DARA 4MH8A 3B36A 2R66A 4FOTA 1V3ZA 1KTIA 2HRDA 4Z7YA 2H65B 3L79A 1NG1A 3LDUA 1BY9A 2XMQA 2MSDB 3B4DA 2CVPA 2Q9CA 4Y2UA 3L7DA 4RKYA 1YL6A 2FSUA 2VWGA 3D2BA 2GPSA 3AF2A 3IQGX 1TFRA 2GCPA 3I56S 3AR9A 4W5RA 3Q9NA 2YJ3A 5CAEB 2QAJA 4NZOA 1H5QA 1RWWA 1W5FA 2B78A 4F5ZA 3EQ8A 3LUFA 5KYTA 4IJWA 3VU3A 1DEOA 4L51A 4BRSA 3F5DA 2MEWA 3SCIE 3HO1A 1CVJA 4Y0AA 1TU0A 4NXMB 1X8LA 4OYZA 3TR0A 5F41A 1TYCA 1SQSA 3V1UA 3V97A 3TQCA 3R0IA 3VOSA 2LDIA 4DDVA 4A8XA 1KTVA 4P81A 4YVFA 2AGOA 4HDNA 1NI5A 2FMFA 4WK2B 2D13A 1EM8A 1RLIA 4NOJA 1R0WA 3OCCA 3Q23A 4Q4HB 4QEKA 1GA1A 3HUFA 1FDVA 5EL0A 4DV1J 5FLXU 3MUEA 1Q79A 1XNRB 4K46A 2QB5A 4K9OA 3K4HA 1KMHA 5CH8A 1VJ0A 1AVTA 1Z34A 1FQWA 5CXQA 3BDIA 2E7WA 2E18A 2YVUA 4EO4A 1Q6ZA 2OCIA 3U4AA 4OBWA 1F9HA 3LKVA 2I62A 5AHOA 5EI5A 4XARA 3QX9A 1Z6ZA 2YNFB 3L1IA 3KSMA 3FVYA 2IYNA 1RJ9B 3ADKA 4HUTA 1N9KA 3GLFA 3VX3A 4WCEQ 2DGUA 2FX3A 3AW8A 1X7YA 3VQSA 2XZWA 1FYEA 1N32F 5KJFA 3IE2A 1NPPA 2WKWA 2OTLS 2JAHA 3A9TA 4UREA 4ACAA 2L41A 3ICVA 5C18A 3HKBA 4QC2A 4OHVA 1LRJA 4IH4A 4J0DA 1HBOB 2V8BA 4LDAA 5JPIA 1BC6A 1U3DA 2H4YA 4FQ8A 1LXCA 3S70A 2I4LA 5E6RA 1KYQA 2C61A 4O63O 4J9PA 2OBFA 2GHQA 2BKUA 1NKBA 5DCYA 4TV9F 4X5OA 1JEOA 3N75A 1D9DA 2WIBA 4R9RA 5HBMB 2ZG6A 4DSOA 2YZ2A 4RFLA 4C98A 3UJDA 4IOLA 4JBYA 1NU6A 2YWFA 4DJ5X 1XZCA 5HBRA 5F7ZA 1OU0A 4BMVA 4KYZA 4DZRA 2LDYA 3KSDO 4TZTA 1GZ4A 1PHRA 5K0SA 1U9ZA 2G7MC 3C8DA 3T1NA 4IKOA 5KOJB 4P4UA 1UXJA 1FQJA 4WXWA 3NHJA 4RMNA 1X2EA 2H1HA 4MITA 5I8ZA 4AMYA 3M6IA 3F8WA 2DISA 2UVUA 4B5LA 4TXHA 3ZKAA 3FKBA 1CP3A 2PMEA 3T7DA 3B70A 4LV5B 1XG5A 4A8WA 2PT5A 5HYVA 5DK6A 2H2HA 1OXXK 2WT4A 4OUDB 1R43A 1Z7BA 3GO4A 2PG3A 2ZZTA 1BXGB 1LV8A 1UC5B 2PD3A 4BO9A 2QN6B 1WXFA 4UUWA 1Q7RA 1XP8A 1ISSA 5G3ZA 4I1PA 3PNBA 2JAUA 3HRKA 1FLVA 3F98A 3CZQA 2BF7A 2DHXA 5IVIA 4NA3A 3INYA 3ETJA 5JSFA 3NHZA 4DCMA 3TH5A 3SZUA 3VNSA 4RF2A 1V9LA 3IUYA 1NM2A 4TKVA 1G0OA 2NSYA 3C87A 4MYSA 4RM2A 1K7CA 3RYIA 4EMBA 2AWZA 2FHJD 4N3BA 3IAM1 5JNSA 2C99A 5EIHA 3Q8KA 2O8FB 1HM5A 5CQGA 1E3JA 5P8WA 3FUUA 5LVAA 2NMVA 3NAZA 5CM8B 2W2QP 4X1IA 2N75A 1UC4B 1QSSA 1N2EA 4P10A 2FXIA 4BQIA 4NCGA 1J2TA 2QX8A 3NS6A 3JQBC 2JFDA 5DTEA 1NW7A 3TBHA 1X0FA 4DGQA 2E87A 4CMJA 2YWBA 5C0OE 4UDXX 1HRDA 5IJ9B 1YJCA 2WBMA 1CR0A 3B9RA 3LWQA 2WV9A 5JS1A 4DQKA 2EV9A 2FYXA 2C9BA 2BISA 3CCMS 1XCJA 4M1SA 1GLGA 3R6WA 4HHEA 4G4JA 4R1UA 1NWHA 4WN9B 3RABA 4IDPA 5FPKA 1HARA 4RK7A 1TELA 3U0VA 2VHQA 4CV3A 2VAMA 1X1EA 4LYJA 1RMTA 3UKJA 3RVOA 4H3KB 1NW5A 2CUTA 5HKLA 5IJZA 1VBMA 4PLPA 2QZZA 4HLUC 4F3YA 2N4DA 4QU8A 4R6WA 1W94A 2BBWA 1JH8A 4DSKA 2GO8A 3ORHA 2JARA 3LHDA 2IDEA 2C98A 1GQ2A 4QOJA 5K4AA 3OE7A 3U6BA 4LHYA 3KJXA 1U0FA 3OPYA 3OQOA 2ZVIA 4BZPA 2PT9A 5DETA 1A9XA 4ALJA 5ETVA 3F4KA 5FUWA 5LBTA 1SKUB 2O2CA 4PWDA 3N8IA 4M8IA 4LSGA 4YO7A 1NYQA 5A0YA 1OFTA 1CJUC 4HADA 5CB4F 1I1QB 4ZKEA 4QT4A 3GLGE 1MUUA 1YVEI 5EESA 4OMFG 3ICLA 4W5NA 5L6MB 3Q6MA 2ASJA 1GLNA 1TL3A 2AX3A 1GTHA 2V2ZA 1W1UA 4R7ZA 3GFFA 3FMBA 2QM3A 1JEYA 3I4LA 1DWPA 3OFFA 1ISRA 2BR0A 1U5AA 1XXHA 4FEEA 1QGOA 1LDBA 3LFTA 2C7OA 4NFYA 2RKOA 4EWTA 1BKYA 2QRLA 2PJRA 2NTNA 4TTIA 2DKOB 4JP8A 1GU7A 6AT1B 3GLRA 4PNPA 4PGHA 2K5UA 2Q2OA 4Q3EA 2G0IA 2Z8ZA 4GKKB 4HDGA 3WGTA 3M8PA 2CDCA 4NBUA 5K0JA 4OL9A 1KR2A 1T9GR 1ZICA 3I6BA 1DXHA 4BAUA 1BU8A 3PM9A 1WVMA 5A7HA 4MRPA 4YI5A 2R7TA 4RWWA 2PSHA 4Y6SA 3IO3A 3P9SA 4G67A 5IJ0A 1TQ6A 3K92A 1AHIA 3CA8A 3A1TA 2CWWA 3M2PA 4OOEA 3QX7A 5BV0A 1V43A 3MILA 1RT5B 2Q5FA 3GFSA 2HLHA 4Q2MA 3H6HA 2OSQA 2OOSA 4RNOA 1P3JA 3OFKA 3ZZPA 1UKBA 3P45A 1URNA 2AJQA 1JLCA 1K8RA 1DQPA 4QL3A 2BEJA 2Z30B 2CXNA 2YHBA 3UWSA 4YMUA 3CNOA 1SBRA 3EOBI 2BDEA 4PBTA 4B8YA 1I0LA 2G9VA 2A14A 2JGRA 4AKGA 3GLUA 5LPNA 1QGUA 3ZTWA 2LQBA 4ZVOA 4O2AF 1W59A 3K0CA 5ITZB 5ETTA 2Q6OA 1I80A 4EGAA 4ZJZA 4TYAA 3CLUC 2VT6A 2YQ3A 1ZH5A 4PQUB 1PR2A 2COLA 1NB7A 1RCTE 3WL8A 1EESA 2GERA 2ZE6A 4QOTA 4QWWA 1ZZGA 3LV8A 1Z39A 2A57A 3QITA 2WFLA 5LYJA 4G1CA 4HB0A 1F6TA 3ZDAA 4R8SA 4X41A 4B31A 4OJ1A 4QOSA 1N36J 3LPAA 1YKGA 5KNCH 3L8EA 2J0WA 1CLUA 4IG9A 1SVOA 5BNFA 4FIZA 4CEIB 2I2BA 3TZZA 1D0VA 2VPYB 2HHAA 2NV2B 3ZIAD 4OAOA 3I9JA 3HFZB 2E5WA 2HGNA 1QLJA 3ZV7A 3H4TA 5K4GA 2PFDA 2P9ZA 2J76E 4YMHA 1UPPA 4V3BA 3KYDB 3Q7TA 4KNVA 1E8MA 2FZ4A 3U7IA 3RW9A 4DUZB 2WT8A 2DCLA 2I6TA 3GGDA 2QYHA 4NYOA 3IKTA 4DV4B 2F9MA 2IVZA 2HFNA 2MXYA 4IG3B 3Q5GA 3TKAA 4NC9A 4CEHB 3O6QA 3PLAE 2ZT6A 2JATA 3OOSA 4ASUD 4G5YA 4IR7A 1XB2A 4Y2MA 4LF9B 1SY7A 4WFKA 5HWSA 4B6OA 2Z0TA 1E5VA 1EUYA 2G9RA 3MM4A 4XEHA 3O8NA 1P4AA 3EG9B 1L5NA 4P4NA 3KWMA 4UU8A 3VC1A 3PYLA 1DIBA 4YO8A 1Q8KA 2Q1YA 2WHEA 4DSJA 1L5QA 1VJQA 1SCJB 2ZPAA 3I2IA 4GKBA 2DIVA 4HK4A 3O7WA 1GDDA 3JVDA 7ADHA 2C9CA 4XW2A 2P2CA 1RT6B 3TDMA 4I1YA 4LHSA 2BRUA 3I42A 4MAMA 3RVBA 3ZOKA 1A4IA 1YHNA 2LUOA 3ZI7A 3G5MA 3EHDA 4ECZA 2WVGA 4B76A 3AVVA 1VYTA 1J23A 1HRKA 5L9AA 2DNRA 5JI2E 1Z6TA 3FCHA 4U9RA 1D2RA 3CY6A 3OEEA 4HDMA 3CS3A 1MD9A 4DFPA 1M1YA 1T0BA 1NSQA 1LW0B 1FDRA 6Q21A 1AW0A 4KGXA 4QOGA 2GEJA 1X94A 3G0IA 4NE9A 4G0WA 4GYKA 4RK1A 3OO0A 4RVNA 1P7WA 2GBGA 4P3NA 5CT6A 5E9WA 1Z0KA 2NV6A 1VE5A 4EO9A 3DZDA 1T1SA 2VZEA 3MUVP 4GC7A 1JHRA 3OQVA 5IULC 4NMWA 4NEQA 1KI2A 4X94A 3T9AA 1J1ZA 2J5BA 3H97A 3PUKA 4B3SJ 2CGEA 3DFMA 5SYNA 4I4NA 4BNNA 1X5PA 3NG1A 2QUAA 2IYLD 3GLJA 1TKXB 1JDTA 3C4QA 1JHYA 5I7RA 2FHOB 3KTQA 2AZMA 1WG5A 1K8QA 5HRAA 1JH9A 3LXXA 2Q2WA 2CJBA 3VZIA 1FTSA 4K2HA 4CL2A 4PO8A 3STYA 2G9NA 1GU1A 1KEZA 4MS1A 1U5CA 1WV0A 5BUZA 4Y65A 4XRGA 1HXHA 4L72A 1W4AA 2D74A 5E4JA 3QKIA 4LECA 5LMUF 3TUPA 1QF7A 4RACA 2X1LA 1BWPA 1VL8A 1CF2O 1SVWA 8MHTA 4CLEA 4D3YA 4F5DA 1GQYA 3ETEA 1VQ7S 3M4JA 2GN2A 1RC8A 5KSPA 4GLJA 5HKKD 2KB0A 1E79A 2M2IA 3QE0A 4Z4GA 3BN7A 1HL7A 4AQYF 1M0WA 3D6HA 3ZGXA 5ALKA 5DT2A 2O2YA 2E1PA 4I4BA 4OCZA 1SJ3P 4GXRA 1QIIA 3W3SA 4GOLD 5BSGA 2ILYA 2H06A 2GBLA 5E2QA 4KO0B 4KHPJ 4XWAA 2XULA 4FDUA 3DOMA 3OR2A 5K7SA 2X7JA 2X5JO 1X8DA 4ER0A 2P8JA 2GHWA 2V7UA 5GM2A 4UBJA 4GE0A 3WZLA 2KYZA 2QA1A 1TTQB 2HHHJ 1IK6A 1E1KA 4H6XA 5KQLA 2I38A 2ZH7A 3KLNA 1BW9B 3REFA 4YHBA 3EBLA 3T9ZA 2RQMA 1MXHA 2E5JA 5FTKA 4QBTA 1LK7A 3ULHA 1GZHB 3D9QX 3CTPA 3C6XA 2B9VA 1RCXB 4S2EA 3ABQB 2NXCA 3EGNA 1YQGA 1HI0P 2GFFA 2A33A 4MGYR 2C0PA 1FQKA 4OI4A 2A35A 4PYIA 3AXSA 3F6EX 4KXFB 4MA5A 1SCKA 3TRGA 4ZANA 4PAAA 4KK4A 4C7QA 1SELA 2EBFX 2Y71A 3ANSA 1NRJB 4DR6B 3RAEC 2EFNA 2OM6A 4KQFA 3HO8A 2OEPA 3L6EA 1NL3A 1TQDA 3H65A 4B83A 1U0EA 5CCBA 2J8AA 4KAFA 1CFJA 5J9FA 3AOAA 2BGRA 1XMOF 1HNWF 1ATZA 4J9RA 3QEOA 1REVB 2D7DA 2ATCB 2D0PB 4DG5A 4IJKA 1JUDA 2ZITA 2ZYGA 3EH1A 3IPLA 3EQ7A 2K8GA 1DUSA 3K8YA 3ZWWA 3MGKA 4D0SA 1GITA 2IS1A 1YZKA 4OV6A 2YRXA 4V24A 2HA7A 1O95D 2J85A 3FDFA 4F2DA 4L2IA 3EZ5A 2FHJA 3NDIA 3MWDB 1ZD2P 2QZSA 4KY3A 4KPUB 5LIRA 1U1RA 5ITZA 1F7UA 3PUXA 1XDUA 1ZA1A 3T6BA 2PH5A 2Z9BA 1J7KA 4YCAA 5JCZA 3E9NA 3OSZA 3B5JA 4XLLA 1M5RA 4ZVRB 4JFAA 4QBHA 3GWGA 4P3OA 1PFVA 2FUKA 2XUQA 2ZB8A 1E92A 2XNKA 5AJTA 4WZZA 5DP2A 1CULC 1FP1D 5A4MS 3KS9A 3I6ZA 4BFLA 3PDIA 2V7QA 5DT9A 4CE6A 2AW5A 3WLIA 3AFOA 1NLFA 3B6BA 1KMIY 2AZ4A 3B60A 5T4BA 5D7BA 2Y1WA 1DOAA 4F60A 4TVBA 3RC7A 5B1HA 5E95A 4DV7J 3IXLA 4MWOA 2I80A 3S2SA 3NNAA 2PL1A 3R4CA 4DPUA 3CNQP 4KWIA 1UKCA 1OZFA 3RD5A 2UZ1B 4NLXA 1PGPA 1Q0PA 3O9VA 4R1MA 4XJTA 3C3XA 3UAIA 3KAQA 3QJGA 2Q3EA 4WP9A 1O6BA 2X5NA 2BFDA 5EP1A 4G1IA 4TMZA 2W6PA 1AGXA 5JU6A 1YS1X 5CG2A 4L6AA 1XRJA 2XLCA 4TTJA 1GDHA 5JWOA 3OFHA 4BFXA 4MW5A 3ROEA 1F6DA 2R1TB 2ZR7A 4P9SA 4JI7F 4FSDA 2B5JA 2EHJA 2PLAA 2YN4A 3KLVA 4I19A 3UMFA 3ZD7A 4JX9A 4ZFNA 5BSKA 4Q3CA 1DDGA 1MOSA 2GF0A 1A2QA 1VBFA 3BL8A 4DIKA 1RVV1 2QR5A 2LXUA 2QI9F 4L4ZA 1DFHA 5ALGA 4YH1A 2B4RO 4RTRA 3ZVNA 2QV6A 5AKIA 3LC2O 1EVYA 1QE1B 1W36B 2ZSIA 2LU2A 3ZU4A 3ZWBA 1C4OA 4E13A 3TW8A 3WK8A 2ILTA 2HLNA 3D7KA 1W88A 3HP6A 2R1UA 4HH1A 2ERRA 5KKNB 4Z2YA 3HM9A 1RXUA 1TU3A 3DBOB 4WNYA 3CZAA 2YJGA 4JUDX 1N36F 5FNVB 2V34A 4MUBA 1NRWA 3WMWA 2NSJA 2EERA 3OM1A 1W26A 2DH6A 3PKJA 1TIKA 1KNXA 5BPHA 4G09A 3DCNA 4F56A 2RJNA 2DUNA 2CLEB 1V5WA 4ZDJA 1JKJB 4XOUA 2BGMA 3GLFB 5FDFA 2Y0BB 1I4DD 4R3WA 4QJ4A 5B08A 1UBJS 4U2BA 5CA5A 4DFJA 2GBCA 3EYAA 1HBJA 2I8EA 1C7ZA 3STTA 3M9MB 1U6FA 3MUMP 4N0MA 3NU1A 3T7CA 4KTTE 5HN0A 1DCFA 3NEYA 3FBGA 3K9GA 3OT4A 4KO1S 4OIFA 3TYTA 1XRMA 3D8NA 1MQAA 1DIAA 2A10A 1U9JA 2B9EA 2C2XA 4AJ4A 1Y42X 3ADDA 4X66B 2RIJA 1SG6A 3I4PA 1XRRA 3VYVA 2CZ4A 1AS0A 3KJQB 2A9QA 2DR2A 3FMFA 4GSKA 1LS6A 3W9JA 5B7NA 4CBVA 5M2UA 3QFWA 2NVUB 1RIFA 1J39A 2X1AA 3FNIA 3DP7A 1ZOSA 4KQ2A 1TT5B 1F9FA 4LXIA 3B4MA 3GMTA 4BKUA 4U1RA 2ZH2A 3O31A 5H4HA 2C03A 4J9VA 2KN4A 4FF3A 2WF8A 1R0SA 3NRJA 1UFQA 2HCFA 4I2PA 1G7SA 1YQXA 4U9IS 3FUWA 3ILHA 3HGTA 4QIWD 3HKCB 2A2ZA 4HAZA 1U6KA 4M5IA 4B3HA 5GVRA 1WW2A 4UDNA 2FSHA 5G02A 1DLOB 1POWA 3AFMA 2QTLA 3HHEA 5LKAA 1A9NB 3PFKA 1W0KD 2ASDA 1APSA 3I2FA 2PX4A 4B1FA 2F43B 5FWXA 3K59A 3K6JA 1JQKA 1NBMA 4K4XA 3P9NA 1T4GA 3I9V1 2V67A 1FPMA 1XTUA 1IY2A 4GP7A 5E1BA 3MLAA 2FCAA 1RWQA 2XY4A 3GMSA 3WYCA 5DU2A 2XHCA 3KKPA 4ZCIA 4BXOA 1E3QA 1KOGA 4PCVA 4IDDA 1SURA 4YREA 3OA0A 4QWDA 4LCBA 4CMAA 3UH1A 4GBMA 3M2RB 4YGYA 3ACDA 3OEED 1G9TA 2YXBA 4XYGA 5BO5A 3ISND 1Y9DA 3U3OA 5CHEA 1X5OA 2CMHA 2O7VA 3H6GA 4P0PB 4FCCA 3O3OB 4CLXA 1J5EJ 3CWQA 1E3EA 3G0GA 3T94A 2CADA 1UZNA 4PBSA 2J7UA 2IV2X 4Q0MA 3EYZA 2Q3BA 1BE8A 3R7SA 3IRXB 2JGAA 1V8DA 5EKSA 5LQCA 1Z2LA 3AWDA 3GXBA 5K01A 3M05A 5CCDA 2VSXA 3H2IA 3JQ8B 4K9KA 3HJUA 1F1BB 4RFSB 5H16A 5DX0A 2QLFB 3GV0A 4UD2A 2HBRA 2G8LA 1D2HA 2R2UA 1U9IA 3KIPA 1RTDA 5FQOA 2COKA 4BLSA 1JA1A 1L4KA 4BASA 2G0AA 1QHIA 1TMKA 1F6BA 2QGNA 3LQQA 4Z4HA 2K1RA 3CF0A 3UK0A 4DX7A 3AB2B 4RUKA 1Z06A 1WSDA 3KDPA 2GVDB 3FCXA 5AJHA 1P9WA 2Q9AA 2CZ9A 1Z08A 1N33B 3TLAA 5DBEX 5KOIA 5LWHA 1C7IA 4EKGA 1XZHA 2W7AA 3D5EA 2XMMA 1PFUA 4M8NE 1RT2B 4K9QA 3K7EA 5A3JA 2ZJ6A 3OU7A 4FNMA 1LRLA 1T8RA 2W7TA 4S0XA 4AZ3B 4YT2A 5AJ3J 5IJXA 1P2SA 5IM0B 1N5DA 2P68A 4I2NA 5JJIA 3L43A 5LSLA 4O4LF 2VSYA 1J5EB 1DMRA 2W0SA 7GPBA 2AB4A 3BH6A 1P1CA 4J1QA 4RKQA 3CQ9A 4BQNA 1IT8A 3HR8A 1YLXA 4MICA 3IN5A 2BFNA 4UNRA 4I6JA 4XVUA 2QQFA 3K73O 3CCZA 1KHTA 4H6WA 4DFDA 2E1CA 4DR7J 3DGVA 3ILLA 3OIWA 4R9UC 3KSBC 2L2QA 2G80A 4EYKA 5F3RA 5D4LA 1XWLA 1ND5A 8GPBA 1QDLB 3WDKA 3B12A 4B9LA 1L8QA 1JR4A 3WAGA 4RJTA 4REOA 4JUIA 1R0KA 3EGZA 5B5SA 2DRIA 1A2KC 2JVIA 2Y1RI 1G8KA 3RUDA 5CD9A 1K66A 4WNIA 5F35A 1CY8A 4JWTA 1NRIA 3HZEA 3L8CA 1MBZA 1SBYA 5L3VA 2HCRA 4IOCQ 5J3JA 3G2QA 1ZITA 3GUHA 5DS7A 1IT7A 1LBEA 3JRWA 3WSTA 3CN9A 1C4AA 4BVEA 4RCYA 3PJGA 1KU0A 4E5PA 4OF4A 4I1IA 4N0QA 4K26A 2VPZB 2IOFK 2VI5A 3OCUA 5EXEA 1RW4A 3J7ZT 3M3PA 2H1LA 3B1FA 3ENVA 4C8LA 1QAXA 1WBJB 3A4YA 3FYDA 5AVXA 3HPRA 1VCTA 3H1EA 2BQUA 1NK0A 1MAUA 3QKRB 4EO8A 3K31A 2YYYA 3V7WA 3BXEA 1IN0A 1FFBA 3CF4G 3QVKA 2BTEA 2QV7A 1NSAA 1X7ZA 3DM9B 1E2HA 1I7DA 3HDGA 1LNQA 2B30A 2QRJA 2RJOA 4BO4A 2H5IA 1T9KA 5ITSA 3JAWA 1VYVA 4G0YA 3GFTA 4FFDA 2BJHA 5EGNA 1XC7A 5CDUA 4EVIA 3E22B 4FSXA 1C8LA 3DMTA 4R8UB 4AKEA 2R84A 3R8XA 2GJKA 1D5CA 2FW8A 2LA6A 3C3PA 1NLYA 5HJXA 5KTNA 3FWHA 1IBKF 2R7OA 3A10A 1SQWA 2AJ0A 4KFBB 3NXZA 2D1SA 3TE7A 2QM0A 4N9WA 1O0PA 2VHGA 5PNTA 2LCQA 3TW8B 3DH0A 1HW9A 1CBKA 2YBDA 3GAMA 2IMWP 3G2IA 3BMCA 1R3DA 1V26A 3RFTA 3BUSA 3DZGA 4H4OB 4U67Q 1GL6A 4AULA 1FC0A 4B81A 4MNTA 1QBKC 4D44A 3E9YA 1QAYA 4BGIA 1CUGA 5BYAA 2W2NP 2O0LA 3T5KA 4ED5A 4BTVA 1XHFA 4Q6WA 4YT5A 2X1VA 1Z4MA 3IB3A 2TSYB 3MLEA 3VAZA 3FB4A 4CT9A 4KMOA 4LGMA 1VE6A 3A8IA 2OV6A 1J09A 1S2IA 5DK4A 2R47A 3GD7A 4MQ5A 3U7GA 2ZQZA 5ETKA 3OC0A 3VR2A 4JB8A 3CLUD 3LWNA 2AYMA 1JKMA 3N2KA 2CQHA 1X38A 4LOLA 1MROB 1IN6A 3HJCA 1YRQA 2V94A 2VPXB 1ZM3A 1GYRA 4KB5A 4IDFA 2WSSD 3RVPA 4CO4A 3C14A 1X3LA 4YB7A 4YMTA 5IZHA 4BNTA 3MMCB 5ERGB 4FN5A 1ITZA 4WFAQ 4RZHA 2P75A 3R2DJ 1Z7GA 2Q43A 1ZKDA 4OA8A 2FSIA 1Z4KA 2PKRA 4QW9A 4F4HA 1JFRA 4DR6J 3LW7A 1RR6A 1FFGB 3WBBA 3IQDB 4L15A 4XUGB 1OWOA 2CFCA 3L01A 4UAJA 2EGUA 1FNCA 4RE6A 3L7IA 4JK3A 3AD9C 1FX0B 2YMQA 5LQJA 3QFCA 5ICSA 2B5JB 2QMXA 4UVGA 4K81B 1QUVA 4NI2A 1QHNA 3QT5A 1NJGA 2DF8A 3MPOA 3F49S 1TU0B 1PT8A 2YZNA 4DLSA 2VF8A 4LZWA 4EGQA 1VMKA 3FVWA 2XMSA 3A7EA 2D3ZA 1MABA 5K3EA 3G87A 3W06A 2RHJA 4D6XA 5AKXA 4P80A 1PNRA 5FOUA 3AOCA 1VRUA 3OJEA 5K51A 3HT0A 1AK2A 1T2EA 4TYQA 3QZ8A 3QOYA 4XCXA 5HUHA 2DHGA 4C5BA 1O0CA 3OCWA 4NABA 2P40A 4L08A 3MECA 3IWLA 5L3QB 3BF7A 3ZIDA 4FFOA 3D4PA 2BBSA 4DZ6A 3QWIA 1DQSA 1T8TA 3QX3A 1T24A 1KVQA 4URQU 3LLMA 2FFJA 5ICGA 1K6IA 1TKZB 4LV6A 1NRXA 4DUYF 3OPMA 2IM0A 3S5JA 1ONBA 4ZQCB 1KQFA 4FFSA 2ZIEA 1BXGA 3PEVA 4N3GA 4U02A 3SNKA 1NE2A 1N32J 3SF8B 3DF7A 4NBKA 3SX0A