The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
95
|
sequence length |
329
|
structure length |
329
|
Chain Sequence |
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLWEK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
pubmed doi rcsb |
| molecule keywords |
Probable tRNA pseudouridine synthase B
|
| molecule tags |
Isomerase/biosynthetic protein/rna
|
| source organism |
Pyrococcus furiosus
|
| total genus |
95
|
| structure length |
329
|
| sequence length |
329
|
| ec nomenclature |
ec
5.4.99.25: tRNA pseudouridine(55) synthase. |
| pdb deposition date | 2009-05-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01472 | PUA | PUA domain |
| A | PF01509 | TruB_N | TruB family pseudouridylate synthase (N terminal domain) |
| A | PF08068 | DKCLD | DKCLD (NUC011) domain |
| A | PF16198 | TruB_C_2 | tRNA pseudouridylate synthase B C-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 | Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 | ||
| Alpha Beta | 2-Layer Sandwich | Pseudouridine synthase | Pseudouridine synthase |
#chains in the Genus database with same CATH superfamily 1ZE1 A; 3U28 A; 1R3E A; 4LGT A; 1KSK A; 1PRZ A; 3HJW A; 3DH3 A; 1QYU A; 2I82 A; 2IST A; 3HJY A; 3LWR A; 1R3F A; 2RFK A; 1ZE2 A; 1XPI A; 1SGV A; 2AB4 A; 2EY4 A; 3MQK A; 3UAI A; 1KSV A; 1K8W A; 1ZL3 A; 1V9K A; 3LWP A; 2AUS A; 1KSL A; 3ZV0 C; 1V9F A; 2APO A; 3LWO A; 4LAB A; 3LWQ A; 3LWV A; 2HVY A; 3HAX A; #chains in the Genus database with same CATH topology 2CWW A; 4Q1T A; 1KSK A; 3DH3 A; 2B78 A; 2IST A; 1ZBO A; 2AB4 A; 2Z0T A; 1S04 A; 3M6U A; 2FRX A; 3LWP A; 3D79 A; 1J2B A; 4CI1 B; 1Q7H A; 4CI3 B; 3VSE A; 2APO A; 1ZE1 A; 1R3E A; 1PRZ A; 1IQ8 A; 3M6W A; 2EY4 A; 3IUW A; 3M6X A; 3M4X A; 1K8W A; 1KSV A; 2P38 A; 1T5Y A; 1WXW A; 1KSL A; 1WXX A; 2AS0 A; 1V9F A; 3LWO A; 3LWQ A; 4CI2 B; 3LJC A; 4DMG A; 2HVY A; 3HAX A; 4LAB A; 2ANE A; 2CX0 A; 2KKU A; 2CX1 A; 3HJW A; 3HJY A; 3LWR A; 1R3F A; 1SI7 A; 1XPI A; 1SGV A; 1Z2Z A; 1ZL3 A; 1XNE A; 1TE7 A; 2AUS A; 1WK2 A; 1IT7 A; 2E5O A; 3LWV A; 3ZV0 C; 1SQW A; 3U28 A; 4LGT A; 3M65 A; 3C0K A; 1SZW A; 2J5V A; 3LDF A; 1QYU A; 2I82 A; 2RFK A; 1ZE2 A; 3MQK A; 3UAI A; 1ZS7 A; 1V9K A; 1UOY A; 2DP9 A; 3M6V A; 1SB7 A; 2J5T A; 4TZ4 C; 2Q07 A; 1IT8 A; #chains in the Genus database with same CATH homology 1ZE1 A; 3U28 A; 1R3E A; 2HVY A; 4LGT A; 1SZW A; 1KSK A; 1PRZ A; 3HJW A; 3DH3 A; 1QYU A; 2I82 A; 2IST A; 3HJY A; 3LWR A; 1R3F A; 2RFK A; 1SI7 A; 1ZE2 A; 1XPI A; 3M6W A; 1SGV A; 2AB4 A; 2EY4 A; 3MQK A; 3M6X A; 3M4X A; 3M6U A; 3UAI A; 1KSV A; 1K8W A; 1Z2Z A; 1ZL3 A; 2FRX A; 1V9K A; 1UOY A; 3LWP A; 2AUS A; 1KSL A; 3M6V A; 1V9F A; 2APO A; 3LWO A; 1SB7 A; 4LAB A; 3LWQ A; 3LWV A; 3ZV0 C; 3HAX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
