3HAXA

Crystal structure of a substrate-bound gar1-minus h/aca rnp from pyrococcus furiosus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
329
structure length
329
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA pseudouridine synthase B
publication title Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein/rna
total genus 95
structure length 329
sequence length 329
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3haxA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3haxA02
3U28A 4LABA 1V9KA 1R3FA 1KSLA 2RFKA 3MQKA 3ZV0C 3DH3A 1QYUA 2I82A 1PRZA 4LGTA 1KSVA 3LWVA 1KSKA 3LWOA 2AUSA 3UAIA 1ZE2A 1ZE1A 1XPIA 3HJWA 1ZL3A 1R3EA 2APOA 1K8WA 3LWQA 2HVYA 3LWRA 2EY4A 1V9FA 1SGVA 2AB4A 3HAXA 2ISTA 3LWPA 3HJYA
chains in the Genus database with same CATH superfamily
4TZ4C 4DMGA 4Q1TA 1IT8A 3ZV0C 1S04A 3IUWA 1Z2ZA 2J5VA 3LWVA 4CI3B 2CWWA 1K8WA 2HVYA 2AS0A 3LWRA 3M65A 3LWPA 3LJCA 1IT7A 1ZBOA 1V9KA 1KSLA 1WK2A 4CI2B 2P38A 4LGTA 1UOYA 2AUSA 3LWOA 1ZE1A 1XPIA 3HJWA 1ZL3A 1ZS7A 3VSEA 1IQ8A 1WXXA 1R3FA 2E5OA 1T5YA 1SZWA 2FRXA 2RFKA 3MQKA 1XNEA 2KKUA 3M6WA 1QYUA 2I82A 1PRZA 1KSKA 1SB7A 1R3EA 3D79A 2APOA 3LWQA 3M6VA 4CI1B 1SGVA 2AB4A 1Q7HA 3HJYA 1SQWA 3U28A 3M6XA 1WXWA 4LABA 2DP9A 3LDFA 2CX1A 1J2BA 1SI7A 1TE7A 3DH3A 3M4XA 1KSVA 1ZE2A 3UAIA 2B78A 3C0KA 2ANEA 2Z0TA 3M6UA 2Q07A 2EY4A 1V9FA 2CX0A 3HAXA 2J5TA 2ISTA
chains in the Genus database with same CATH topology
3U28A 3M6XA 4LABA 1V9KA 1R3FA 1KSLA 1SZWA 2FRXA 2RFKA 3MQKA 1SI7A 3M6WA 3ZV0C 3DH3A 3M4XA 1QYUA 2I82A 1PRZA 1Z2ZA 4LGTA 3LWVA 1KSVA 3LWOA 1UOYA 2AUSA 1KSKA 3UAIA 1SB7A 1ZE1A 1ZE2A 1XPIA 3HJWA 1ZL3A 1R3EA 2APOA 1K8WA 3LWQA 2HVYA 3M6UA 3LWRA 2EY4A 3M6VA 1V9FA 1SGVA 2AB4A 3HAXA 2ISTA 3LWPA 3HJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U28 A;  4LAB A;  1V9K A;  1R3F A;  1KSL A;  2RFK A;  3MQK A;  3ZV0 C;  3DH3 A;  1QYU A;  2I82 A;  1PRZ A;  4LGT A;  1KSV A;  3LWV A;  1KSK A;  3LWO A;  2AUS A;  3UAI A;  1ZE2 A;  1ZE1 A;  1XPI A;  3HJW A;  1ZL3 A;  1R3E A;  2APO A;  1K8W A;  3LWQ A;  2HVY A;  3LWR A;  2EY4 A;  1V9F A;  1SGV A;  2AB4 A;  3HAX A;  2IST A;  3LWP A;  3HJY A; 
#chains in the Genus database with same CATH topology
 4TZ4 C;  4DMG A;  4Q1T A;  1IT8 A;  3ZV0 C;  1S04 A;  3IUW A;  1Z2Z A;  2J5V A;  3LWV A;  4CI3 B;  2CWW A;  1K8W A;  2HVY A;  2AS0 A;  3LWR A;  3M65 A;  3LWP A;  3LJC A;  1IT7 A;  1ZBO A;  1V9K A;  1KSL A;  1WK2 A;  4CI2 B;  2P38 A;  4LGT A;  1UOY A;  2AUS A;  3LWO A;  1ZE1 A;  1XPI A;  3HJW A;  1ZL3 A;  1ZS7 A;  3VSE A;  1IQ8 A;  1WXX A;  1R3F A;  2E5O A;  1T5Y A;  1SZW A;  2FRX A;  2RFK A;  3MQK A;  1XNE A;  2KKU A;  3M6W A;  1QYU A;  2I82 A;  1PRZ A;  1KSK A;  1SB7 A;  1R3E A;  3D79 A;  2APO A;  3LWQ A;  3M6V A;  4CI1 B;  1SGV A;  2AB4 A;  1Q7H A;  3HJY A;  1SQW A;  3U28 A;  3M6X A;  1WXW A;  4LAB A;  2DP9 A;  3LDF A;  2CX1 A;  1J2B A;  1SI7 A;  1TE7 A;  3DH3 A;  3M4X A;  1KSV A;  1ZE2 A;  3UAI A;  2B78 A;  3C0K A;  2ANE A;  2Z0T A;  3M6U A;  2Q07 A;  2EY4 A;  1V9F A;  2CX0 A;  3HAX A;  2J5T A;  2IST A; 
#chains in the Genus database with same CATH homology
 3U28 A;  3M6X A;  4LAB A;  1V9K A;  1R3F A;  1KSL A;  1SZW A;  2FRX A;  2RFK A;  3MQK A;  1SI7 A;  3M6W A;  3ZV0 C;  3DH3 A;  3M4X A;  1QYU A;  2I82 A;  1PRZ A;  1Z2Z A;  4LGT A;  3LWV A;  1KSV A;  3LWO A;  1UOY A;  2AUS A;  1KSK A;  3UAI A;  1SB7 A;  1ZE1 A;  1ZE2 A;  1XPI A;  3HJW A;  1ZL3 A;  1R3E A;  2APO A;  1K8W A;  3LWQ A;  2HVY A;  3M6U A;  3LWR A;  2EY4 A;  3M6V A;  1V9F A;  1SGV A;  2AB4 A;  3HAX A;  2IST A;  3LWP A;  3HJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...