3C0KA

Crystal structure of a ribosomal rna methyltranferase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
395
structure length
395
Chain Sequence
SVRLVLAKGREKSLLRRHPWVFSGAVARMEGKASLGETIDIVDHQGKWLARGAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGLPGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQGPVTGELPPALLPIEEHGMKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTYRDRGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLFQKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0064 protein yccW
publication title Crystal structure of the Escherichia coli 23S rRNA:m5C methyltransferase RlmI (YccW) reveals evolutionary links between RNA modification enzymes
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 124
structure length 395
sequence length 395
chains with identical sequence B
ec nomenclature ec 2.1.1.191: 23S rRNA (cytosine(1962)-C(5))-methyltransferase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase
A PF17785 PUA_3 PUA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 3c0kA01
3.30.750.80 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA RNA methyltransferase domain (HRMD) like 3c0kA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c0kA03
3B3GA 4F85A 1SQFA 3EVEA 3GIWA 4QPPA 3GU3A 4YUXA 4YMHA 2B25A 1NE2A 1WZNA 2P1DA 3D2LA 2GPYA 2IH4A 1EAMA 2PJDA 3KR9A 3G89A 2OXTA 2G1PA 5C1IA 1IT7A 4MQ4A 5KQRA 4PYQA 3KQVA 5E8JA 4FSDA 1ZGJA 2XVAA 3KQYA 5BW5A 2OY0A 4RVGA 3SX0A 2JHCA 1D2GA 4AUKA 3QOXA 1YB2A 4GEKA 5K0GA 5DTRA 9MHTA 4X61A 3G2PA 4CTKA 3LSTA 2IDJA 2ZIEA 4GOMD 5DM1A 5H02A 2IIPA 2KW5A 3BXOA 4HSGA 4RSRA 3SM3A 1EG2A 1N7JA 3H2BA 3KHKA 2UYCA 1ZGAA 2GB4A 3BKXA 2ZFUA 1XDSA 1VE3A 2K4MA 2PXCA 2OKCA 2UYOA 3CGGA 3C6KA 4KDRA 4M7RA 5CVUA 1RI3A 3E8SA 2PLWA 4H0NA 4OA8A 4AX8A 2CL5A 4ER5A 1NW6A 3LHDA 4POOA 3LKDA 3A4TA 2E5WA 4XUDA 3CC8A 3UJ6A 3O7WA 1G8SA 2NXCA 5HFJA 4PYNA 3UBTA 3DULA 3IEIA 5EHGA 4EKIA 1WXWA 4RTPA 3LBFA 2XVMA 4BLVA 1R00A 2Y1XA 3Q7EA 4EMSA 2AN4A 5D1HA 3FTFA 3LPMA 5K0NA 1F38A 2WA1A 3Q87B 4FSXA 2JHPA 3HM2A 1D2HA 1QZZA 1H1DA 1NV9A 3GRVA 5EEHA 3GJYA 4HGZA 4KWCA 3NMUF 1YF3A 3SVZA 2EJUA 4LWOA 3FPGA 3NW9A 5LSAA 3LBYA 3B3JA 5DSTA 2ZBQA 1F3LA 3EVFA 2YR0A 1YFJA 5K8VA 1NW8A 2XYQA 3EVAA 5JR3A 2ZVJA 4C08A 3D79A 2I62A 4HH4A 4RVFA 5DTQA 3B89A 3TQSA 4RTKA 1X1BA 1SQGA 4OA5A 4QDJA 3UZUA 3ELUA 5DM2A 5EMLA 3MERA 3OZRA 5EHIA 2XBMA 4LECA 3TKAA 4C07A 1B42A 1XVAA 2YX1A 4YUWA 3DOUA 2ZW9A 4AZVA 1EQAA 4XUCA 2UYQA 5U4XA 2EFJA 2IH2A 2ONZA 3FPEA 4FP9A 4OQDA 1JSXA 5EZQA 3LL7A 3PFHA 1IM8A 4PIMA 4CXMA 4DMGA 4PINA 4C03A 5EMMA 5E9QA 5EPEA 1KPHA 3PT9A 2OZVA 5EKUA 3KR2A 5ICCA 2FK7A 5GP1A 1ORIA 2BZGA 5G02A 2OPBA 4U7PB 3EVGA 3I64A 3V8VA 2AOVA 3GWZA 4XUEA 3HCEA 3VC2A 4RTLA 1X1DA 4M38A 1JTFA 2VDVE 3TKYA 4QPNA 3FTEA 2JHAA 4PYIA 2PT9A 5HILA 2CMHA 1RI1A 3DMGA 1ZE1A 3EVZA 4YUYA 3MHTA 2PX2A 3C6MA 1IQ8A 3G2OA 3DMFA 5EIWA 3OZSA 3SXJA 4LG1A 3LCVB 4KRGA 5HIKA 3DLCA 5DX1A 5FULA 3TOSA 5EG5A 1WXXA 3I58A 2QYOA 2H11A 5LQCA 2BM8A 3A27A 3GGDA 2CMGA 3JWJA 4C06A 1ZL3A 2YXDA 5BXYA 5GIOE 4Q1TA 2PWYA 3UA3A 1SGVA 3JWHA 3MCZA 2NNWB 3OU2A 4P58A 5JUWA 2YXLA 5LQJA 2P3LA 3MAGA 5EQJB 3UFBA 3ER8A 2A14A 3EGEA 4WXHA 5GWXA 2P8JA 1XXLA 3CJTA 3I9FA 5T64A 4DZRA 2LD4A 3OU6A 4YV1A 1MHTA 4KIGA 2YVLA 2GLUA 3P9NA 3GO4A 2I7CA 1EIZA 5FQOA 4ER7A 1QAMA 2NP7A 1JQ3A 3S68A 2FK8A 4B17A 3KQSA 4UOEA 4OX9Y 3HTXA 1BOOA 5C9ZA 2P3OA 2AOTA 3G8AA 4L7VA 1G55A 4DCMA 2V7EA 1XDUA 3FPFA 3FYDA 4KIFA 4RYLA 3BZBA 5CVVA 5CVJA 3NDJA 4CKCA 3OE5A 1FP2A 1HNNA 1R8XA 4IV0A 2BH2A 4RX1A 2HV9A 3P8ZA 1RJFA 3CCFA 1EJ0A 4K6MA 1AQIA 4PIPA 4F86A 3MCTA 4E33A 3A7DA 2DPMA 2O06A 5KQSA 3HEMA 3KQPA 3TM5A 4C4AA 1WG8A 1JG1A 4ER3A 3HCBA 2Z6AA 3CJRA 4Y30A 2Z6QA 1K8WA 3AJDA 3R0QA 2I9KA 2P38A 2Q07A 2WA2A 3IV6A 4IKPA 4IV8A 2G70A 4DKJA 4GBED 5DT2A 4Z2YA 2GA9A 3BWBA 4P7FA 4QQNA 1NBHA 3UJ7A 3M70A 1Y8CA 2I6GA 2OB2A 2B78A 3DXZA 3PVCA 2EX4A 1AV6A 4JXJA 1R3EA 3E05A 3HA5A 4PYMA 5HIIA 4DQ0A 4R05A 3GDHA 3HCFA 1KPIA 3JWIA 3OE4A 3OZTA 3DR5A 1M6YA 4X63A 5HEKA 3UJBA 5CIYA 3P97A 1BKYA 3EVCA 5ICGA 3TMAA 3T7SA 2CX1A 1JQEA 1RI5A 3CJQA 3PLAE 4E2XA 2B9EA 4E2YA 2JH8A 1KXZA 1YZHA 2FHPA 3V97A 3AXSA 3EMDA 1L3BA 3KQMA 4HTFB 5E1OA 5E2BA 4E30A 5ICEA 5K0JA 1G8AA 1HMYA 2QY6A 3FTCA 5EVJA 2QRVB 1FBNA 3PFGA 5K05A 5EEGA 3C3PA 3EVBA 3OCJA 2IBTA 4PYKA 2VS1A 4GUAA 2AN3A 4QTTB 4QTUB 5FADA 4QDKA 3GNLA 1EJ6A 1ORHA 3SR4A 3NWBA 2BR3A 4E2WA 3FUTA 4GC9A 3KKZA 1I1NA 1P91A 1ZQ9A 5DM0A 5FUBA 1NW7A 3G88A 3HA7A 4PWYA 2ZZNA 1YZ3A 1PRYA 2BR4A 2OO3A 3A25A 2OBFA 3ID6C 4PYLA 5FTWA 2OYRA 4AZWA 2PX8A 5DTMA 1O54A 2G8NA 5E2AA 5FA5A 2BM9A 4P7JA 2C7OA 2VP3A 2B3TA 4RVDA 3HP7A 1L9KA 4GQBA 1IT8A 3G7UA 4P7KA 3I53A 2ZTHA 4PGGA 4BY9E 1G60A 2AR0A 3LX6A 3MB5A 3HCCA 3M6WA 4CTJA 3B3FA 3HVHA 3LDGA 1ZE2A 2AS0A 5LQAA 3VYWA 2PY6A 5FWDA 1VBFA 3HCAA 3P2EA 2N47A 2O0LA 1V39A 1SQWA 2Y1WA 4GOLD 4RWZA 4BP1A 2UZ4A 1SG9A 2Z6UA 2ZSUA 5E9JA 1RJGA 3DUWA 3LECA 4V0QA 2O57A 5LQNA 3KPJA 3LGAA 3M6VA 3RIEA 3HVKA 5CCXA 2IDKA 3T7RA 3KR1A 3BKWA 3THRA 4CKBA 4DCGA 2PBFA 2PXAA 3QV2A 2J5TA 3ELWA 5D1NA 1WS6A 2GAFA 5EC8A 1QYRA 5E8RA 5HIJA 4R8RA 1TW2A 3RW9A 1ZKDA 3GRUA 4R8SA 3E7PA 4ER6A 3KPVA 2EG5A 2PX5A 1XDZA 2CX0A 3PTAA 1JSZA 2AOUA 5CM2Z 2VDUE 3I5UA 1Z3CA 3HVIA 5KS2A 4IWNA 4MWZA 4RTJA 3TRKA 1FPQA 1KHHA 1KR5A 1R18A 4PONA 2XYRA 3DTNA 4QQKA 5P8WA 3K0BA 3G2MA 5E9WA 3UJCA 2ADMA 2PT6A 4DA4A 1WY7A 3A26A 3NVMB 1KYWA 4FT4A 4U7TB 4YUZA 1M0EA 2VDWA 2ZBPA 3MTIA 3WSTA 1Q0TA 2G71A 2P35A 3M4XA 4KW7A 4X1OA 5EIFA 5BW4A 3NJRA 2ORED 3C0KA 4AZSA 1ZS7A 3TLJA 3TR6A 4CWAA 4RTRA 2VZ9A 1VQ1A 2PVCA 2V74B 3L8DA 4QVGA 3ELDA 1I9GA 5FWAA 3EVDA 5DRTA 5C0OE 4CKEA 5F2NA 5EKXA 5KVAA 4RTMA 3P2KA 3ERCA 3G5LA 3KQTA 1T5YA 1O9HA 3ELYA 3GRYA 3AY0A 1NV8A 5KYGA 1X1CA 3BWCA 1JG4A 5CUQA 2AN5A 3K6RA 3KPWA 3UJAA 5DLYA 3FRIA 2ZCJA 2NXJA 4X41A 4ZTBA 1SVUA 3PB3A 2NXNA 4GC5A 4ISCA 4X60A 5DX8A 5FCDA 3UJ8A 1OR8A 2GS9A 1R8YA 2O05A 1ZHFA 3SMQA 5CD1A 2UYHA 1FP1D 2Q41A 3ANXA 3KQQA 3FYCA 4RVHA 2PWPA 4NECA 3VC1A 2G72A 4LWPA 2R6ZA 1RI2A 2HNKA 4E32A 1AF7A 4RV9A 5FHQA 4V0RA 1P1CA 5DRYA 1L3CA 1NT2A 4M37A 4AZTA 3HA3A 1JG3A 2ESRA 5F2KA 3SGLA 3UJDA 4RTNA 8MHTA 3M33A 2IP2A 4RTQA 5CVDA 1M6EX 3EPPA 2ZZKA 3SSMA 3GRRA 5GIPE 3VSEA 2DULA 2HTEA 2ZBRA 1G6Q1 3G2QA 5B1SA 3R9XB 4HG2A 1IY9A 5K0LA 2QE6A 3F4KA 4PCAA 1QAOA 1PJZA 1DUSA 2BR5A 2FYTA 5DPMA 3P9KA 4EVIA 5CVEA 4FR0A 4C05A 4C04A 3SSOA 5GM1A 3FUUA 2CWWA 2AZTA 3C3YA 3LKZA 1BHJA 3OPNA 5DXAA 1VPTA 2IPXA 5FA8A 3REOA 4ATNA 4E31A 1N2XA 2P41A 5GOZA 2P3QA 4PYJA 3GXOA 3B5IA 1DL5A 3OU7A 5DM4A 1XTPA 2EJTA 2GH1A 1P39A 3TFWA 3O4FA 3GRZA 1X19A 2PX4A 3FPJA 2JG3A 5EMJA 4YUVA 1VP9A 3P71T 5GINE 1UWVA 4ER0A 2ZZMA 5K0EA 3TM4A 4E70A 3EMBA 3LDUA 3UA4A 2O07A 3BWMA 3KQOA 1VLMA 1R74A 3HVJA 3OFKA 3FRHA 1JG2A 2P7HA 3EEOA 1JR4A 1VL5A 4P7GA 3EGVA 2AOTB 2B2CA 3HCDA 1NW3A 1J2BA 3P9IA 3BWYA 3MQ2A 3R3HA 2PGXA 4M36A 5F2OA 3AXTA 4MHTA 5BP7A 5DX0A 3KU1A 3X0DA 4PYOA 5EMKA 2CKDA 1P1BA 5HZMA 5LR6A 2ONYA 5EZSA 3CKKA 4DM3A 4EKGA 1NBIA 4F84A 2F8LA 3O31A 2JH9A 3QOWA 4YV2A 3UJ9A 3U81A 3G8BA 3M6UA 4QVKA 5HOQA 2C7QA 4OQEA 4EK9A 3FUWA 3R6TA 3NWEA 3NTVA 4KDCA 3TPZA 1INLA 4HGYA 1UFKA 4OBWA 3LCUA 5E1MA 2PXXA 5MHTA 2YXEA 2HWKA 3HNRA 4GF5A 2ZWAA 4GOOD 1Q0SA 2PSSA 4E2ZA 5HIMA 3CVOA 1SUIA 3EGIA 5K03A 7MHTA 3IHTA 3T0IA 5CCBA 3MTEA 4R6XA 1FJXA 3E23A 4BP3A 4PCLA 2FCAA 3A7EA 2P7IA 1N7IA 2C7RA 3DXYA 2NYUA 2C7PA 2AOXA 1XCLA 2FPOA 2ZIFA 4HRAA 2ERCA 4R6WA 3ER9A 1VIDA 4HC4A 3KQWA 10MHA 4FZVA 4FGZA 1NW5A 3BUSA 1TW3A 1SUSA 1AQJA 2AVNA 3LCCA 2H00A 3UWPA 3PX2A 4MIKA 5EGSA 5GM2A 5T6BA 3PS9A 5LQUA 3BGVA 2ZULA 3OFJA 4WVLA 3ORHA 5DSXA 2ZIGA 2R3SA 3DP7A 1U2ZA 5FHRA 1VP3A 3FPHA 4FT2A 3SSNA 4YV0A 2NXEA 1RI4A 5DWQA 3KR0A 1NKVA 5E1DA 4DF3A 5LQRA 2FRXA 1XCJA 5EOVA 5IH3A 1D2CA 2IH5A 1KIAA 1R3FA 1IXKA 1T43A 2WK1A 1JQDA 4O29A 2PV0A 4A6EA 1R6AA 4XCXA 3T7TA 5M5BA 2ZWVA 5K0CA 2NP6A 4PNEA 1Q7HA 3NDIA 1L3IA 3UAIA 2J5VA 4BLUA 2AB4A 4Y2HA 2IBSA 2QM3A 2HMYB 2PKWA 1I4WA 5K09A 1YFLA 2XYVA 2IGTA 2P40A 3FTDA 4EQZA 3THSA 1G38A 3KPYA 3M6XA 2H1RA 4BLWA 3IYLW 4A6DA 4PGHA 5IKMA 5K01A 1KPGA 4G56A 3BGDA 2OB1A 1KP9A 1YUBA 3DMHA 5LQKA 5ICFA 1X1AA 1BC5A 1MJFA 1ZG3A 3LDFA 2YUIA 2AVDA 3KPUA 3R24A 3PX3A 1RJEA 5FQNA 1KYZA 3FUVA 1RJDA 5DXJA 3G5TA 5K0FA 1QAQA 4FS8A 1SKMA 2HR1A 5T67A 3DXXA 2YTZA 4HTFA 3NVKI 4MTLA 2ZLBA 3EEYA 1QANA 4KVZA 2QRVA 2YQZA 2IFTA 3FUXA 1O9GA 3AWIA 3MGGA 4RTOA 2AOWA 3DLIA 1UIRA 3CBGA 3RODA 3BT7A 3GCZA 3BGIA 3P9CA 3P2IA 5ERGB 4YMGA 1TPYA 4RTSA 1L1EA 4GOND 2JJQA 1XJ5A 1DCTA 3JWGA 4OBXA 2AOUB 5K0BA 3DH0A 3ME5A 3B7PA 1JTEA 3FZGA 5E1BA
chains in the Genus database with same CATH superfamily
1X9HA 5BOSB 1TO6A 1MRNA 1ZOIA 4LDJA 3QPWA 3M2PA 3EUEA 4EHLA 2NZYA 4FI3C 2R5NA 2ZSEA 4TMFA 2YW9A 2O8CB 2FX3A 3HC7A 2GF9A 2WG0A 4V0ME 1EAMA 3ONWA 4J0CA 4CV2A 3G89A 5JNWA 4MGHA 1WVMA 1N9KA 4ND5A 4A0FA 3ZKWA 4PRYA 1M1XB 1O96B 5ALUA 4OJTA 1U0FA 2IP4A 2QPOA 4OLAA 4U39A 4YGXB 1C9NA 1U7PA 1JBKA 3E18A 4AS1A 2E21A 3CR8A 4JA0A 2QM7A 4OL9A 1XCOA 4C4XA 1OH5A 4ZHQF 4CMJA 2JJ2D 1HQKA 1Z34A 3K31A 1E0JA 4CTKA 4A0QA 5KBYA 1H5QA 1IEQA 4N40A 5KYKA 4NBKA 1E1KA 1F60A 3PGVA 3TTUA 4YPVA 1S3IA 1SCUB 2EKQA 5FNVF 3D5EA 5C4GB 3GJ6A 2Y0EA 3AEUB 1J49A 3AVQA 5KQGA 1J5XA 1JJBA 3FMOB 1PO7A 2YN0A 1EE1A 2Z09A 1BVYF 5DGIA 2Q45A 3H2BA 1CB0A 4HSEA 1WY5A 2I1WA 3RYFB 4A0HA 1BE1A 2IYTA 1M0WA 1QIFA 3K6KA 3KT0A 3I6YA 3VKFA 2OCBA 4PYNA 5BRJA 3A6ZA 2XI4A 3ETDA 1P4GA 4GKAA 1RRGA 2ZB8A 3LT1A 1VI5A 1RMTA 3UKOA 3INNA 2GBGA 4Q7QA 3D6MA 2HA5A 1KI6A 4K9KA 3OQNA 1W2HA 4NYIQ 3FH0A 1QP0A 3ZZNA 1AKEA 4EDHA 1MF7A 1UJ6A 1E2PA 2E49A 3I23A 4HXEB 4M0FA 3V7FA 3PUYA 1FRNA 1HG1A 2IITA 2ZCVA 3MS4A 2R751 3QLTA 2DT8A 4U6NA 3FCXA 2YR0A 1PZHA 2E4YA 2Q5LA 3WWCA 2XYQA 3INYA 2P5UA 3PF9A 2I62A 5JSYA 5C52B 3P9YA 4Z0PA 1M8GA 4Y9RA 5DHFA 5DV9A 3ELUA 5DP1A 4QULA 3U56A 1YI0A 2GCNA 2BP7A 1C7JA 3F3MA 5EJ4A 1L5YA 2JD2A 1E7YA 3CRW1 5KOJB 3OX1A 1YA6A 1CUHA 4UHCA 4Y8VA 2B1RA 4AY5A 2V96A 2W2MA 3HO6A 3LL7A 4MA5A 2C2XA 2QBYA 1NN0A 1NGSA 3PXXA 4HYTA 1A2OA 4MUKA 4OAQA 2OD7A 4N3CA 5EESA 1IEVA 4DMCA 4XUEA 3PWKA 3BSFA 4GP9A 2WNSA 1GEGA 3PXUA 1NG9A 4JJZA 1JE1A 3HM9A 1EB9A 1RI1A 4HBZA 3FM9A 5SYNA 2F67A 1IN7A 1EWYA 3BXGA 2VAWA 3SZMA 1IQ8A 1TECE 2EBUA 2NUAB 1LU9A 3MA0A 4XASA 4WL0A 4CLEA 3HBLA 1I24A 3KWMA 4MR7B 1CPYA 3A1EA 3PC2A 4C6TB 4CKYA 1YGYA 2A88A 2HQRA 3CZMA 3L7IA 4HQ0A 2CLFB 3CUUA 1XWWA 2G1JA 1R0LA 5FOQA 4IIDA 4BAZA 3M3HA 3EZXA 1W96A 1CJUC 4IOLA 4UBNA 1OJ7A 5D7NA 1XK6A 1Z12A 3IJPA 3EGEA 5GWXA 1B3BA 1XXLA 4DZRA 5JAUA 4TRJA 1FFXB 4CLOA 5CLFA 2VWQA 2FK8A 3HB0A 2FRDC 3QE3A 1OI2A 3GVXA 1H23A 5BV2P 3LP6A 3M4YA 3T7AA 4GXQA 2RE8A 3BJZA 1MG0A 2OCLA 1FQOA 3CG4A 3FX2A 3LCRA 1TIBA 1HWYA 2BKEA 1DIBA 1RWOA 2R6R1 3DE1X 3L79A 1W8DA 4YTEA 5KTOA 1W36B 4V1CB 1ZHHA 2IYVA 1XDUA 4KSBA 3FYDA 1O97C 1SXHA 5CX4A 2EQ5A 4E7PA 3OE5A 1P19A 3ENNA 4ZCPA 3KSDO 1CZLA 2IVZA 4LIPD 2XMZA 1RVDA 1LWOA 2J4CA 3A7DA 3EJ6A 5COQA 3ROQA 4WESB 4BGVA 2G40A 2ZYVX 1PHPA 3BIWA 3LSYA 4JBWA 2OPHA 5IC6A 3EFBA 2W8BA 2AJCA 4HUTA 4PN7A 5C5IA 1VIAA 3W5JA 1PT5A 1FLAA 4IIVA 2NO6A 4EKNB 5JMWA 3D4BA 4EJ6A 1K8WA 3OICA 1VBMA 3IILA 4MIOA 3ZY5A 1QORA 2H5LA 2HJSA 2XRYA 3AHJA 2C7VA 1OILA 3FLAA 1ZJ4A 2Q3LA 2OV1A 4C78A 1EZ4A 4G2NA 1UZNA 2VSOA 5D3MB 1B0PA 3ED5A 4OSOA 2ZWIA 4RESA 1TTQB 2IZ5A 3I5AA 4V0SA 5G1NA 4RPIA 2J3HA 2RHHA 3GYBA 2QK4A 1UBHS 5LU9A 3HA5A 3T5MA 1PQUA 1UK9A 5ALTA 3F9CA 2DKFA 1S1CA 4FFLA 1DBVO 4Q15A 5ISMA 4C4YA 1Q6ZA 5DBGA 2XNDD 1ZJWA 3IT2A 1M73E 4KEAA 3GJ8A 3V8BA 3OVMA 4DM7A 4EG7A 2B21A 1QCZA 1W52X 2QF7A 3O1JC 1Q1NA 2I6TA 1YZHA 4WK6A 5C3UA 4C7JA 4CG1A 1L3BA 5JASA 3B9QA 4YRBA 8LDHA 5KNDA 5CIYA 4BVBA 1LZKA 1W94A 4GOKA 1JSLA 2F4NA 2NADA 2BKAA 4AY4A 4OP1A 4GE3A 4CF7A 2AW5A 4U2EA 4Y6SA 1QQAA 1FX1A 5EJ6A 2A1IA 1SKUA 3I01A 3LWQA 1SJ9A 4H3SA 1GQSA 4PYKA 2WV7A 1R4NB 3WLNA 2LP4Y 3A9SA 4DLBA 4F6RA 3EZLA 3GNLA 2EL7A 1O5OA 1ZISA 2A0KA 4YIKA 2GPAA 2BIFA 3HPRA 1TZMA 1KJ9A 4DR1B 1E4EA 1XK7A 4OXKA 4F04A 4CLXA 4UCXA 4EF5A 1XNQB 1KTIA 4PZZA 2GPJA 2WYUA 4RK1A 1XAJA 5F3DA 1ACMA 1N5KA 1ENOA 5DWDA 5L7TA 1XD2A 4PPNA 3OQPA 1G6OA 1N2CE 2DUNA 2VBCA 3HP7A 3UWOA 3WLSA 3X2EA 4DQDA 5A1JA 1EFRA 4B3SB 4DEVA 1HL3A 3NEPX 3OZEA 4ZOCA 3RS2A 2H2WA 2PIAA 3RUFA 4Q9LA 2D1QA 2C2MA 3EC1A 2O2CA 2VNSA 2OSVA 4O2AF 1PT8A 1KZGB 5CPBA 2Z57A 1F8GA 5D3ZA 1Y9JA 5JD3A 3DUWA 4QAQA 3LECA 1BFDA 4IP0A 3NM4A 1VI2A 3QKTA 1P45A 2D5LA 3TZKA 2SKEA 4HVTA 4LFAB 1NQXA 1KGDA 1X7HA 1GTZA 4G4SO 4RIHA 1W5TA 3KR1A 4TMTA 3O21A 4W99A 1UXKA 3C8HA 3VPAA 4D9CA 1SKQA 4RJTA 4GBJA 2GAFA 3O0DA 1QG4A 2X3YA 3OFND 1VXRA 3EIHA 4M89A 1L5QA 3UPUA 2AUMA 2Z08A 1YR7A 2YHBA 1RPNA 4KR0A 1NX6A 1LC3A 2OZLA 5M04A 3OCYA 5BQPA 1T2CA 3I5UA 3BQNB 3F71A 3FAKA 5ALOA 3PKZA 5CK4A 3NASA 4REQA 3ZDFA 3G2MA 4MS1A 1IB6A 3NBAA 3GLFB 3WGLA 1HC7A 2VDWA 4HWSA 3MTIA 3V2IA 4C76A 4RH3A 2P35A 4QXRA 3C8MA 2ZTVA 1C3VA 4AYTA 2VHZA 1OGIA 1T4DA 3G0GA 3T1OA 1GCOA 5C35A 1D4AA 3ASZA 3GN1A 3MD0A 2BE7A 4CWAA 1XZCA 3I45A 4XCQA 2VCEA 3DAHA 3LK6A 1LBIA 2EDCA 4CKEA 5F2NA 3BGWA 2H57A 1JFTA 4MJ7A 1YQEA 1IIRA 1Z28A 4IIFA 3KQTA 4F97A 3WL5A 4KRXA 2QSYA 3K09A 2ZKIA 1LDEA 2ZR7A 2VXOA 3SX2A 3R41A 4XWTA 3AHDA 1ZUD1 3KPWA 4LHYA 4OGGA 3H5RA 2XIQA 2QLNA 1JECA 1JU9A 4Q7JB 1XF9A 2QX7A 2QIOA 3ND6A 3WIOA 3VPBA 3H5NA 4EA8A 1X13A 1EVKA 4X8LA 4F3KA 1TAQA 1U2DC 1XU4A 2HMTA 2QLJA 1A5ZA 2QD2A 3BDAA 4RV9A 3JD4A 3KX2A 2C42A 4L8LA 3IGFA 4NU8X 4IJQA 5KMGA 3IEMA 1AZSC 1X94A 1T29A 3ROMA 1JEEA 3U5TA 1SQ0A 2DU8A 2EW2A 4PC7A 4HFNA 3HP1A 1WE2A 4QNNA 5BRAA 2FPRA 2YL2A 5CVDA 3NY7A 5I3CA 2ZUVA 3RSZA 3NVAA 4ENWA 3G7SA 3I6ZA 2Y68A 2XVXA 1UOEA 2FR0A 3BHJA 3G2QA 4OF4A 1FDIA 2F1HA 4B44A 1TB4A 3VMMA 2MSCB 4NENA 2V7XA 3HKDA 1W8IA 4LUCA 4MGZR 2O8EB 5JCOC 2P91A 4RVNA 4A2PA 2IHKA 1RNLA 5ECYA 1I2MA 2WLSA 4GZ5A 2EJBA 1Y3HA 1QONA 4MJ3A 4OK6A 1Y6GA 1QO0D 2QI9C 5IRCD 3GUZA 1F8YA 4ZJYA 1X77A 3DP9A 4ITUA 2O1SA 1EX9A 2P41A 3ITNA 2FP3A 3VVMA 1KJ8A 5FTJA 1XCMA 4FYMA 1U04A 3GXOA 4DANA 5KNLA 1QC5A 1T1RA 3LQ4A 4WN9B 3O92A 5DKFA 4Z49A 1Y6RA 3ICVA 4YJ2F 4NOJA 1ONBA 4IW3B 1UKEA 1DV2A 4IIJF 2H4JA 2JD0A 3UJHA 4MRSA 1ZNWA 3ZK9A 4AECA 2BGIA 2F90A 2IXFA 3HXLA 4V38A 1ENPA 3B20A 3QU2A 3T4EA 5SYMA 1KVQA 3NHBA 2ZTMA 3WKEA 1J9GA 1XHLA 3VR5D 3N7UA 1Z25A 2CBGA 5LOVB 4BIMA 3R3HA 2PYDA 1KOFA 4TWRA 3ZLBA 3F2IA 2WWGA 3IDFA 3BQ9A 3P52A 4KQGA 4Q3DA 2YBDA 5K4HA 2MYTA 4DCUA 1J6UA 2QNIA 2W2TA 1K5PA 3Q85A 5K3FA 4EWLA 1N6OA 4PFJA 3K9QO 3H17A 2F8LA 2MSKA 1RE0A 4II7A 3VV2A 1ZK3A 4LS3A 2X8WA 1HTBA 4AMZA 4BV3A 1IU9A 5FOWA 3KXKA 3ROGA 5CG2A 3AHGA 1MG5A 3MZ0A 6AT1A 4D26A 4MSUA 2EZUA 4BNDA 4KXLA 3L0SA 1A04A 1SRQA 1ZRSA 3LWPA 3QMVA 5AM1A 4RZXA 3WKBA 5EZ6B 2I3GA 3VDXA 1NONA 2RDMA 3HUTA 3O84A 2AK3A 5L3ZA 5ER6A 1T9GR 1FDWA 1VKJA 1HY3A 4GIBA 2VSXA 1GCGA 2JANA 2V7PA 2JCVA 1EDEA 5BT8A 3MOSA 1U3DA 1KRWA 3IBCA 2CFSA 1UBUS 1USVA 1WTCA 2JFXA 3BZWA 6CHYA 1CK4A 2VQ6A 4C2AA 1N25A 1T35A 3A7EA 4GR5A 1T4CA 4B85A 4X1IA 3S5JA 1ORDA 3W90A 3OPMA 3MTQA 1EFUA 1VI6A 4J0FA 4BGDA 4TRMA 4K9DA 4KZKA 1OF1A 3IOCA 4A10A 3Q7QA 3NHZA 5HJ7A 3SIRA 4QGSA 3WWZA 3DM5A 3Q6IA 4RD3A 3BJEA 4DCNA 1N7GA 4P98A 3TI7A 2C9MA 1LWNA 2HGSA 5EI5A 5LQUA 2RGAA 4WXPA 5DBFA 3A6DA 3FJYA 3GCDA 4DDHA 4RJLA 4FT2A 4IIGA 3P27A 5H3CA 3RVMA 1NY6A 5CB6A 4N8DA 1WX1A 4EJFA 1G66A 5ILOA 1PLJA 4L0MA 3CUSA 5AIAA 1WXQA 3H11B 4O29A 2XUZA 4ZZ3A 5AVQA 3OQOA 1F4VA 1SB9A 2B1GA 2FPIB 2J0VA 3ADCA 4FMCB 4XD2A 1IJFA 1OA0A 1M6NA 3S8MA 3UK6A 4DADA 1UPTA 4H27A 4FMDF 2X2PA 2HTFA 3EQ7A 4G36A 2P30A 5B1IA 3T5GA 4DBVO 4X1IB 1DKMA 3EGWA 4MAFA 3WTBA 3AUYA 4O0LA 2ZE7A 1QVWA 2HMUA 3DZBA 3K53A 1PAUA 3SZUA 2YHUA 3QEAZ 4GX1A 3WWDA 4MUFA 1N0HA 1NN5A 5A7GA 4YN3A 5IYZB 1AO0A 2SICE 1EX1A 2WHPA 4G9GA 4KQCA 1XAHA 2VPQA 4M4SA 3ZUGA 2CHVA 3FFTA 4F2PA 3GRCA 1UKZA 1Q44A 2YS6A 1PHRA 1A77A 2BD0A 3DEZA 3HGMA 2BHNA 5HA5A 5C8ZA 1G7TA 1U11A 1U0TA 3PX3A 3R24A 2A5YB 2EBWA 2SKDA 4BEBA 4B75A 1CUZA 2CNLA 1I80A 3NKLA 1SBHA 1ZW6A 3S27A 3CVWA 2DJ5A 4KVZA 1YS1X 5CCXA 4N0EA 4ETNA 3PUWA 3JQQA 1N2IA 3UCXA 2G76A 2AOWA 2BDUA 2BZ0A 3IR5A 4BNMA 3GUHA 1FZTA 1NMYA 3GPDG 1XGKA 3AEKB 3OX2A 4DRZA 2ZXEA 4HAUA 1ULSA 3FMVA 2HI0A 4LDZA 4Y6LA 1QOPB 3AB8A 1NFFA 4GWLA 1P5FA 5DXFA 2QN1A 3W4KA 3WZMA 3I1IA 3THYB 2PWBA 3RUDA 4BUZA 2QUKA 1QIHA 3T3NA 4H7IA 3ME5A 3B7PA 1BX1A 3B3AA 3LX5A 1TFRA 1QV6A 2BMWA 5JNTA 2CV0A 3FTNA 3F4BA 1NE2A 5DN6D 2VUUA 4LA4A 3QPUA 3PR3A 2PKYX 2QOEA 3LLMA 3GLIB 3ZH2A 2YBEA 4ZODA 1GU0A 1OIVA 1G6KA 1G9XA 1G16A 1Y9DA 2QX4A 3DBRA 4TTPA 2KX7A 4UU8A 1RWPA 4YX9A 3W2GA 2BELA 3VU1A 1ZP6A 1UWKA 3O03A 4CTMA 3RG8A 1OASA 1BXRB 1ZGJA 4WTOA 1ABBA 3A9WA 4R2IA 2D5CA 1D2GA 4O3FA 4G86A 4X61A 3G2PA 1J06A 2WTEA 2OL4A 3UTDA 2AK2A 1U0NA 2PSEA 3IUEA 4J1TA 1MCZA 5I5EA 2A92A 3E1KA 2RRLA 3HY6A 2WSBA 5C1BA 5LLTA 4DDKA 1JWLA 1QIIA 1U1FA 4DLTA 4W6QA 4MW1A 2R00A 3GVHA 2IY9A 3K32A 2J6BA 5ECWA 3CVXA 1ID1A 4YMTA 3OT1A 1SC6A 2DAPA 2PLNA 2QRZA 3F96A 4HWPA 4B74A 2PWZA 4XIJA 1GGHA 1XYVA 2GEFA 4BQOA 2E55A 1T0JB 3DEAA 5J1TB 2FPGA 2DUUA 1VJ5A 4QOIA 4DV0B 5HVNA 2ACVA 4ZQIA 2YJ4A 2UYYA 5E7IA 2QM8A 1A7UA 3P2OA 2XWQA 2F64A 3H3FA 1T9KA 4ILEA 3NTUA 4NPCA 2RHMA 3ONFA 1RQLA 1DINA 5FFFA 3LC0A 1DZIA 2YZNA 4HVAA 1CZUA 1IBMB 4B6PA 2Y0PA 4CIDA 3ITEA 4B73A 4X84A 4Z8XA 1KQ3A 2I2CA 4NESA 1Q84A 3K92A 4MRMB 1A2KC 3TEMA 2RHRA 1PT6A 3AL3A 1OROA 3JPYA 3KJFA 4X7BA 1WVIA 5AMXA 1NW8A 4XD7A 4LOHA 4ZDIA 5BNWA 1LX7A 1X7XB 3AF5A 1SFRA 1OWOA 1Y7PA 4N39A 4EL5A 1USIA 1UQTA 3AY6A 1DJMA 2X9QA 2NQ2C 4OKSA 3NNDA 1IN4A 1HETA 3FDIA 3A9CA 1SHLA 1ZUIA 4HH0A 4TLAA 4YUWA 4IIBA 3KEFA 4D0RA 3PCRB 1QHYA 2H29A 4YC7A 2IH2A 4YPFA 2H5EA 3STYA 4FP9A 2JS7A 5BWCA 2XH8A 2Z0TA 1EEHA 1P0MA 2FN7A 3L4BC 4LV5B 4EG3A 1K5HA 3CWZA 3QNWA 5IVDA 4NOKA 1WB9A 2WE8A 1N6KA 3K70B 1G8KA 4R2LA 1P1FA 5KQLA 3OMWA 1JDBB 3JZIA 3WMFA 5G02A 3AUAA 1I7NA 3DDUA 4W1RA 2RHTA 4R0NA 1CE8B 1GR0A 3M34A 3DOFA 3S70A 4DLWA 5HKKA 2A33A 1XAIA 1XVTA 3RRFA 4AMBA 2JHAA 3BOSA 1HG0A 5B58C 2II6A 4MV5A 2PX2A 3V8RA 3WADA 1XTQA 2UUOA 2GCEA 2PGIA 4E4TA 2V7QD 4OAOA 1IN6A 4QHSA 1XRRA 2V7BA 2SHKA 5ALXA 4FGSA 2NU7A 1FUKA 2VI5A 4EUSA 3OG9A 3IB3A 4RL6A 1U0SY 2B7BA 3C3EA 3JYNA 2XEDA 5BXYA 3K15A 3U6KA 2IHNA 1CDZA 1UL1X 1LB1B 3IBSA 4XSHA 4N1AA 1CQPA 2P3LA 4B8ZA 1UOPA 3MFYA 1D09A 1H1LA 1UZMA 4LE2A 4D0LB 3IRVA 2AFHE 3OZAA 3LV8A 3BS4A 4WXEA 3FPKA 3QVJA 3RBAA 3RFCA 2PO5A 2FN4A 5A4MS 4DB2A 2VDLB 4JUFA 5AUQA 3BBPA 3NAGA 3PWZA 2GAJA 2B4TO 5CFQA 3ZJ5A 3QP9A 1GU7A 1Y4SA 3H3XA 1BMFA 1NBWB 1OI3A 2AWOA 2V7GA 4CG2A 1JJVA 1JXAA 2BCEA 2DUWA 5FTKA 1HEUA 4JR1A 4Y6GB 1LTKA 2G82A 2R6GA 1U3CA 1UBTS 1JHQA 3WYEA 2QRPA 3WYBA 2BFCA 4YLYA 1GCUA 3TLEA 4HYQA 3IAM6 3EBOA 3G0DA 3DPUA 2JCXA 1I10A 1G2IA 3Q3CA 1BX3A 4HB4A 1KGSA 4IINA 3DE7X 5JTTA 3R8FA 4KBYA 4TMZA 3S29A 3OZDA 1FSGA 1XP5A 1LVHA 1KK1A 4KYVA 1DFIA 1Y1RA 1EFVB 3CB2A 4D9JA 3NZEA 3CTPA 3LQRA 1MT0A 3FTQA 3D1VA 4E4YA 1FVFA 2GILA 3Q5DA 4PV7A 1K8YB 2VDKB 2R6CA 4CMBA 5FWNA 3LWRA 2JASA 4YQFA 2ZGVA 5F1KA 1TVMA 3SJCA 4URVR 1BCRA 3L8MA 2G1UA 1ZX1A 4FYXA 3T3PB 1F2TA 4V03A 3E9RA 2D62A 1QO0A 2WD7A 2PR2A 1KQNA 1IDOA 3NX4A 4I5IA 1N1EA 3ZTBA 1RJ9A 1K6IA 3MCUA 4NF2A 3SYRA 3Q41A 4D02A 1H4ZA 2BFMA 1QE3A 4MI6A 4RHYA 2Z3VA 2P0EA 3IMKA 3T7DA 4QJ3A 2JIPA 2ZTLA 5FEMA 3TL2A 3MHPA 5BSRA 2BM0A 2IW3A 1XZIA 3WLEA 1XLTC 3VZPA 4E2YA 1KXZA 5BN3B 3QX9A 3D7KA 1UMBB 2IOFA 2QY6A 3K5HA 1KK0A 4L3VA 2PZMA 1NULA 2WT8A 1FBNA 3MWEB 4HWRA 2B94A 4REMA 4R5HA 1IATA 1OCEA 4TVKA 3VR5A 3REFA 4ITRC 3NP7A 2JLBA 3JR7A 4KK4A 4K86A 4AQDA 3AR3A 3RU9A 1SBIA 3C3AA 3GUUA 3ZGNA 3JQRA 2GZAA 2FPUA 3IEPA 4M7PA 2C84A 3BMOA 6REQB 1AH2A 3HKCA 3R5JA 1GNVA 1JJFA 4I46A 4I55F 5BUSA 3EPRA 1A9ZA 4IKEA 2CLCX 4EI7A 3V3TA 4RVOA 4W1PA 4UTRA 2HC9A 4JODA 4OQPA 5FNZA 1YBHA 2I6FA 5JPCA 5K8VA 5KNCA 1UOOA 3JATA 3UICA 3FWKA 4DWOA 2PUDA 3QA9A 2HIHA 2E4ZA 2H1LA 4MINA 3UIEA 4HFMA 3TLZA 3HNOA 1O4WA 2RAVA 3IXMA 3STWA 1WWKA 1J0EA 3UCFA 1T0IA 4H7FA 2JF0A 4GLFA 4FC6A 2WWWA 3SZRA 1BRMA 1FYDA 5FPKA 4H7EA 4Y2SA 1DG3A 3CLRD 1XMIA 3P94A 1VKNA 4ZQHA 1R6BX 1S2DA 1BWSA 3CCBA 1U2EA 2YWDA 3BTSA 4UTOA 4ZGWA 1XAGA 1JAHA 4GOLD 4HNGA 5LA6A 3MIIA 5J2TB 4P5PA 3AILA 3GEGA 5ES3A 4C4PA 5JDIA 3MBOA 5LQNA 1HORA 3SHTA 4NOMA 3LPAA 4Q1EA 2PTHA 1WEHA 2HBRA 1XFDA 1Z88A 2ATXA 2GEUA 5EY5B 4CM4A 3QVTA 3ZY3A 4ZIRA 3C1UA 2IYQA 3NBQA 4CCYB 2H63A 4D6YA 5KI6A 3IDOA 2VQFB 3AX6A 1BNCA 1H6AA 1QVRA 2BGKA 2IYOA 5LQSA 1KDVA 3U80A 3ZBQA 2VWHA 1H66A 1N3BA 4Q16A 4QXOA 1OA1A 3GLRA 4NZ9A 4N0PA 4CI1B 4CLDA 3A31A 3EGXB 2PZKA 1VG1A 3OAAA 4JAVC 3MMZA 4D4HA 1JHPA 5BOSA 4BNXA 2RKWA 3OIFA 1G5HA 1KR5A 3T1YB 4QQKA 2ZVDA 2O8CA 5A4DA 4FGLA 1E9DA 1K7XB 1KAHA 1RRKA 5GQSA 4RGQA 2QMEA 1ODFA 1QF6A 2J3KA 4BWFB 3DB1A 2XUFA 3VPDA 1O96A 1NQOA 2X58A 2IYRA 2QL6A 3FIJA 3IERA 2F9FA 1YL5A 1E79D 1VYTA 1R5NA 2HMVA 3EXAA 3IO3A 4PHHA 1G7SA 5HRUA 3F98A 1UK8A 2P9JA 2EQAA 2AFRA 2PVCA 2X0RA 3NV9A 4K9OA 4QASA 4YEDA 5KINB 3I92A 1O77A 3PA8A 4N3BA 4Y6RA 5FBRB 1WSDA 4QU0A 5JMPA 4IF6A 3STTA 4ZC1A 2JLXA 4P0TA 4EYGA 2CMDA 4P86A 2FMFA 1SCUA 2I78A 1P0PA 5CUQA 3RRMA 4MWBA 4AFNA 5KHOC 5ALVA 3AEUA 3PB3A 5TE9A 3D6JA 3VNVA 4FONA 4F8YA 1YQTA 2FSVA 3QEKA 4ZRNA 3J7TA 3V1KA 5BSFA 3IIEA 3KB1A 3RYFA 3EQ2A 2PWPA 2VXCA 3CWQA 2R6ZA 2Z2KA 3PHGA 1P17A 4DCSA 2VPTA 5JMOA 2EJVA 1T24A 2HF9A 2XCIA 3F97A 1GQOA 1W19A 3QU5A 4ZZ2A 3RVOA 2D1SA 5AW4A 5EFOA 1Q20A 3AZQA 4RSMA 1DWPA 5D00A 1ZXBA 2GYWA 1E2FA 5D01A 3F47A 4G0WA 1EDBA 4NONA 1FDUA 2P2DA 1CIPA 2NTNA 1DOAA 1Y7LA 3ENWA 2F9MA 4OLJA 3ZWQA 5HIAA 3SC3A 3PLNA 5ITWA 3ZD7A 1IY9A 4PCAA 4C88A 2VSQA 3D03A 2IPLA 1Y7IA 1Z18A 1Z38A 3PE6A 3PTZA 2HJGA 4EBFA 3A6FA 2W58A 4AZ0B 1M1YB 3GF4A 4B83A 5EERA 1J21A 2FJ0A 2CFTA 2R87A 2VHVA 3O4FA 5DZSA 1A2BA 5ECGC 2QYTA 4WKNA 2IOFK 4GKBA 4R31A 2M6LA 4Z8YA 2ISQA 4U9UA 2VCYA 2I7DA 4ZYLA 5B53A 3HJGA 1E1CB 2J6HA 1XMSA 3B1YA 1IOVA 3Q3VA 2PKCA 3BWMA 2C77A 5IJWA 4IFBA 4BKPA 1CZRA 3FRHA 5A7HA 3ZIAA 7ADHA 2C92A 3D6HA 1VL5A 3CF0A 3LFUA 2AOTB 4AJJA 1SHJA 3BE4A 4HYEA 4AO8A 1TUBB 4IH4A 1RHUA 3RC2A 1HFJA 4UUAA 1BVUA 3BJRA 4I1UA 4BB9A 4MHTA 5BP7A 1WRBA 1OFIA 2QE7D 3F6SA 2CKDA 2FUKA 1VDZA 5LR6A 1MB4A 4RD4A 4EA6A 3PUIA 3PQ5A 1KQPA 1KKLA 2NUAA 1F9AA 1P4SA 3QOWA 1NOJA 5A9RA 2CLOB 2EWWA 4U7HA 4WJZA 4MR7A 3VTFA 4C6TA 3PGA1 1XALA 3CSDA 5ELLA 5EUCA 1JLLB 5HOQA 4CU2A 2YRFA 1Y3BE 2XUGA 3G2NA 3PHJA 5ELMA 1U0BB 2RMKA 4U9HS 2FW1A 1UPAA 1HEIA 2F1KA 1TCVA 2JGNA 1E61A 3ZVNA 5H8WA 3KBOA 4LY0A 4NLLA 1HRKA 3DVSX 4JVLA 4EFLA 1KP2A 1TAGA 4E2ZA 4NV0A 5HIMA 3VOTA 2A0WA 3SR4A 2OVBA 1POWA 1I2BA 3IHTA 1FFXA 4LQLA 3NBXX 2X1LA 4XARA 2O5EA 3MS7A 4YXWD 3HE3A 2CLSA 4Z2AA 3KZCA 1GRCA 2QVBA 3GZJA 2FPOA 1ZU5A 1LNQA 3KB6A 1HFEL 4OK5A 1WABA 2Q3HA 3D9QX 4V1CA 1YR6A 3BXZA 3IAUA 2R25B 1MEEA 1TO2E 2QU7A 2Y05A 3EF3A 3GI1A 1U5CA 2QEQA 1KBOA 4QQFA 4ARSA 3P45A 1VKOA 2HQSA 1Z5NA 2JLRA 1YRHA 2XTAA 2ZIGA 2J9FB 3L4SO 2CYAA 5CGZA 3A1TA 1U6JA 2AJ8A 2IHBA 4QREA 1BGVA 2C88A 2FF5A 4MVJA 4GRDA 5LB4A 4AJEA 4LSZA 2XSZA 4HAZA 4O4IF 4Y98A 2FRXA 3GJSA 3RUEA 4CGZA 2C0QA 3BMCB 3KHSA 1PIWA 4Y1EA 4XWOA 1QDUA 5FI5A 4G0YA 4PQRA 3MCVA 3ESCA 2AX4A 4ETIA 1P0QA 1K6MA 1CWUA 1LQ2A 4RQAA 4LBZA 1P6QA 4FKMA 3SIWA 5EZYF 5D3MA 3ISJA 3R7FA 5CDHA 1QU2A 2X5KO 1M34B 4BFZA 4BQEA 1H2WA 2IGTA 2O1WA 2ECOA 4FX2A 4EX7A 3EWAA 5JH7B 4IOMA 5F7OA 5AUNB 4V1CI 1DXOA 1FX0B 1U8YA 2R8ZA 4Q1DA 1GD1O 4JLNA 2G6BA 4HX9A 3VKGA 1I30A 4U2BA 4NNJA 2OB1A 2OT3B 2XUQA 1KMNA 5LQKA 3GX1A 1JDVA 1E5DA 3LDFA 1IZ7A 1GHTA 1HLPA 1NVDA 3G2LA 3KV3O 3RSSA 4OMCA 5KNBA 4CI3B 4W63A 5E2IA 1EXWA 3LOUA 4B8YA 4BHTA 2NQTA 1CNEA 4EPRA 1V3QE 1Z7EA 3OURA 2P6NA 4BX9A 3D6FA 1Q21A 5BV7A 4MDFA 4OI0A 2MR5A 2VJKA 3IJEB 5A0TA 1YRWA 3SOZA 1GUDA 4UC0A 3PE3A 1HE2A 1N4DA 1VGVA 1UODA 2HU5A 1R4NA 2ZXFA 3MFQA 5FUYA 3AWDA 1R15A 2Y1OA 5CLHA 2GD2A 3CW2A 1V43A 5F73A 3TTTA 4XDYA 1KEKA 5DHUA 1QHFA 4H4DA 1VCHA 2P90A 5A4JA 4HGRA 4JBHA 1Z0DA 4OBXA 5JV5A 1BQ4A 3DH0A 3DMYA 5ALIA 5TDHA 3NLLA 3RUAA 3CVJA 1OBFO 2SBTA 5LP6C 3ETNA 4F85A 2FSSA 5K0TA 5F3RA 3IUSA 4UE2A 1O89A 1WTAA 3GDGA 4IJ6A 1EH5A 4XEHA 1T3ZA 5LLSA 5CH8A 3QTTA 2Q3DA 3ADKA 3DZGA 2AUNA 3F7NA 2PIDA 3L1VA 3QOFA 1Q1EA 2DE0X 3BK2A 5TSDA 4MWOA 1V95A 2VHWA 4Q19A 4Z86A 2DGDA 5TMEA 4EJSC 3R5HA 1ELOA 1RADA 2BGMA 1GFZA 3HLYA 4Q00A 4D4IA 4F1KA 1EIWA 2X77A 4C6SA 1A7KA 2AXQA 4GOMD 1TVCA 1XZLA 1ZLXA 3K0KA 4BUCA 3PJRA 4NBTA 1MN6A 1Q16A 1DQZA 2VJNA 5D8DA 3LPNA 5DW3A 2O20A 3Q10A 4ZCQA 5CTJA 2YWEA 4A73A 4B2PA 4AX8A 2ZR0A 3FOBA 1Z45A 1EVEA 2XX3A 3W3ZB 4E5KA 3UHPA 4RVCA 2H48A 3HI6A 1YUNA 1HDRA 4JYAB 3RS3A 4ACBA 3CUTA 2VNAA 3UJ6A 1Z37A 4F11A 1G8SA 2NXCA 4AG6A 1ESNA 3AU8A 2IZOA 2V8BA 5JXWA 1CVRA 2QENA 3P9PA 4Q1FA 5DLEA 3W04A 3ZDQA 4EMSA 1T5HX 2Q3BA 3D4LA 4NV1A 1MO2A 1SUDA 1V1MB 1KI7A 3GLFA 1PNRA 4PLYA 4HLQB 2Q7XA 1PUXA 2CVQA 3SN6A 4AC9A 2F1RA 1M7GA 1MJGM 1EA5A 1PJTA 2AXNA 2PS1A 3B13B 1UPXA 4KWCA 4TV9F 3W1VA 1XLVA 3WOHA 4BMZA 5LN1A 4AKHA 1ZRMA 3S2EA 3EW7A 2IIQA 1C1DB 3LBYA 3AUFA 3NGLA 4OB6A 2RGGA 6NULA 3K2IA 4O4JF 4PC3A 3EYWA 4M1WA 4LDPA 3D79A 3EISA 1E6CA 4NNOA 4RWEA 4TL6A 5DTQA 3S2YA 3V2GA 3PC8A 2XCTB 1FSPA 1VJCA 4EGSA 3HFRA 4DCJA 2HWWA 1DE0A 2C9DA 1SOMA 3EE6A 3JYOA 4JSYA 4RF3A 1WSBA 4E94A 2ZI7A 5KTYA 1I4OA 4F5WA 3H4TA 5KWSA 1D2NA 3RYHB 1YL7A 1ZO8A 2TYSB 3KVNA 2Z5VA 5KTNA 1P1KA 5K3SA 3GFFA 1KSHA 2ZRAA 3PDIB 4HT3B 4GICA 4W6ZA 3NOVA 4MEJA 1W0KD 1XZHA 1HNXB 3A4VA 3UMSA 2VAXA 2R48A 2Z1DA 1JU3A 5JAMA 1KPHA 1FSFA 4QODA 3WB9A 2I9PA 4ISBA 2AI1A 1KJJA 1WMFA 1P4AA 4RPHA 2XGJA 3D7LA 3OTHA 4G97A 1MDBA 1VRVA 4YP9A 2IWHA 4W9NC 2C3OA 2AOVA 2A5FA 2CZGA 1X1DA 2QVCA 2VDVE 1CUGA 2ZS8A 2AH5A 1T3GA 4FDTA 1XKQA 3O7MA 2HA0A 1E18A 2XMQA 4Y9TA 2EU8A 3T7CA 2DY1A 5LLDA 4CI2B 3CX4A 1NAHA 3GNQA 1IN8A 4H60A 3HG7A 5DX1A 4B4VA 5L3QB 3GGGA 5C3MA 2ZYAA 4D8VA 2BLLA 4DXDA 4RZ2A 3E81A 3T06B 2DP4E 4N18A 1HE4A 1HH4A 2H7XA 3JTEA 1JFLA 4Z0TA 3ZHUA 1LFAA 2NNWB 1ISSA 4WN9A 1KNQA 4S1OA 4RY2A 1NATA 1X9GA 1PV2A 4YALA 3IDZA 2JCSA 1C2YA 3L9WA 4K6KA 1P5JA 4NAHA 4YIHA 4M88A 4BC0A 1UCFA 1H42A 2R5WA 1SXQA 1DAIA 2AE2A 4AKSA 1GUZA 4B17A 1Q0ZA 1VLJA 2EIHA 1UOYA 4AJ2A 2Q9BA 2V5VA 3A9RA 5TIIA 1QVAA 4MVCA 4L7VA 5I7RA 5LOVA 3B6IA 1N34B 5ALSA 1P7VA 2H8GA 2BAGA 3FPFA 1V0JA 2CNKA 1Z4IA 5KTSA 1CR0A 5KOIA 5JY1A 3HYTA 3EPHA 1I6LA 2WILA 4BP9A 2GETA 5HMLA 5HM6A 2E6UX 3A2MA 2B98A 3CR3C 3HHEA 1A7AA 5J4LA 4B1FA 3B48A 5TMDA 3DF9A 1P44A 3EWSA 2E1PA 2NVWA 1MEJA 1X1TA 1Z2DA 3MRXA 1NBAA 4L0DA 5TGDA 3VISA 4AU1A 2Z6QA 1ILEA 5FPYA 3WHKA 1S2OA 5B6JA 1GQRA 5BRNA 2ZI6A 4IV8A 4UJ3A 3TG2A 1ZEMA 2RCNA 4WQMA 5JI2E 1FLNA 3CNBA 4ZMRA 4P7FA 3KDPA 5TT0A 1FNMA 5HRAA 2LGJA 5UKDA 5HKBA 4XA8A 4ON9A 1M83A 3A0RB 2D1FA 3PZRA 4GKVA 2NLOA 1FQWA 4GECA 2VFAA 1NWCA 4LWZA 1SU7A 5DNEA 1A5TA 2Y27A 4XGKA 3VJRA 2QN2A 2B4YA 2BUCA 2G36A 3GT4A 1DKOA 1NLUA 4RNDB 1EK6A 2WJGA 1X3SA 5DCUA 3UWSA 3VAAA 5JZVA 4X63A 1KEPA 3QWHA 1DEXA 1GIAA 4TM8A 3KZXA 2NSHA 1YQQA 3AFMA 1FTGA 4DDWA 2W2OA 5M7EA 2CX1A 2XR1A 3GJZA 2JH8A 2XDQB 3SZLA 1MA0A 4LKOA 2GKOA 4HWTA 1O6CA 5EL0A 2V6FA 3ZGOA 1BYIA 3AEYA 4H1UA 4N3GA 4NCKA 2QQFA 4RJKA 5K05A 1R6VA 2R8BA 4ND1A 1W76A 2JBWA 3H1GA 5K0SA 1PJRA 1AA9A 2WF5A 4G1BA 3RIXA 3RNLA 1ZOPA 1FFEA 1EJ6A 1WIWA 1ORHA 3H11A 3MRSA 1WCWA 3ZXXA 2FPIA 3HJWA 2NMVA 1ZEJA 4TKZA 5F52A 2XGMA 2D00A 3RAPR 4LPSA 3CKLA 3NVDA 2WKQA 4D8YA 1BWQA 4K05A 1DO0A 2EKPA 3AQ4A 4E5VA 1TIPA 5EE5B 3IP1A 5EJ5A 2L19A 1FDRA 4D9GA 2PUHA 2BR4A 5CB4B 1D4FA 3WGHA 4CEJB 3EMVA 3GY0A 5DTMA 5E2AA 1OI7A 4U6QA 4AUNA 4ZOLF 3X43A 4OG2A 1KK3A 1R9NA 1PJSA 1FA9A 1KJNA 2GJKA 1IT8A 1JIQA 3IQEA 1IUOA 3B1JA 1PN3A 1TKAA 2ECPA 5IEBA 5CD9A 4LDRA 4FBLA 3GH3A 1K1EA 2DCMA 3HCCA 1UBLS 1X15A 4FFMA 4DRYA 3L02A 3D0QA 4R0VA 5LD2C 3TM5A 1WZEA 1ML4A 3HCAA 4EKYA 1HOXA 5BWLA 1WBBA 4YXWA 1U99A 4CCSA 2CNBA 2VNIA 5E9JA 1XPRA 1JZTA 3FPLA 3IBGA 3IQWA 4OXXA 3DOHA 5JZBA 4AJ9A 1A2QA 1AF4A 2C2WA 4BFYA 4P84A 3M6VA 4FNMA 3RIEA 4HHEA 4FLFA 5E6UB 2HZBA 4DNXA 1CCWA 1YS4A 3AEKA 3EXG2 4AKIA 3Q40A 1JIKA 1WS6A 5B3KA 1ZKDA 1WDMA 4OQNA 1ZK4A 1BQEA 2A9RA 4DPMA 3THYA 4ZRDA 2M98A 3H19A 4XOIA 3LWDA 1UMCA 3BT7A 1TE2A 1V5GA 2A0UA 2FY8A 3ESBA 3GXBA 3K8ZA 3PNPA 1YB1A 1H3NA 4Q6WA 3ZJ4A 3COZA 1VRCA 3RB8A 4IG4A 2C20A 3N8GA 3OQIB 1YI1A 2NO9A 1M6VB 1NVEA 2KB0A 2W7TA 3H7AA 3JD2A 3U37A 3WGOA 4B80A 4BU0A 5FUQA 5K3EA 2V0GA 3RI3A 3ZHBA 1SEVA 1ZS7A 3WGMA 1BXRA 2E7ZA 3QU4A 4RTRA 1SCBA 1R3UA 1SC9A 1SQ6A 4IJVA 4OHUA 3R77A 8GPBA 3GG2A 3LUFA 2EKBA 3VUFA 4LJKA 5CT8A 2HLNA 2FZWA 1EWVA 3HL4A 3S2ZA 5INTA 1WUKS 1XHEA 3JZFA 1WZCA 5D85A 4B4UA 4FYWA 1ORWA 4NMMA 4HGQA 2FLKA 1SVUA 3K8QA 4X60A 3L8YA 4MGIR 4TM7A 3ILSA 2YMMA 3ZWNA 4LWQA 1VSTA 3B78A 4KN6A 1EFLA 3U6BA 3OZCA 2A1TS 3FYCA 2PJRA 1VMAA 2OBXA 3MYYA 1RI2A 3JYLA 2GZHA 2C1XA 3MELA 3SU8A 2XHZA 4AZTA 1M2FA 4M37A 1NVVQ 4N7BA 4CIAA 5JARA 2PBZA 4IZOA 3KKPA 3ZHYA 1D03A 3SEFA 3R7WB 4GX0A 4JT9A 4KUHA 3GMFA 1DSSG 3KAKA 1ECPA 1G64A 1YK0A 1Z8FA 1XZFA 3I2HA 4F06A 3ZZ0A 3GLSA 3T9BA 4MRMA 1SZPA 1UZLA 1Y4AE 4YNBA 1OYWA 3HDHA 2PGNA 1FJ2A 1GPJA 3GEDA 3T3GA 3ZHOA 2FI1A 5JXIA 5LP1A 1S6YA 1X7XA 1KC3A 1P62B 1UBRS 2ZT7A 4J6EA 5M34A 4GMDA 1LDBA 1HA3A 1VC2A 5BMOA 4OHBA 2FMTA 3BSYA 5GZ1A 2HMSA 3GRKA 3REOA 5JS6A 2GPNA 1SVLA 4EUKA 4HY3A 4HDQB 3HV2A 2R7MA 4PLZA 2P3QA 2RGNA 2CB0A 1QZTA 4BV8A 4BNYA 1RPZA 2KKUA 3N0TA 3KSBC 1OYOA 2R6DA 1MO6A 1U7HA 2HIMA 2LIVA 3JQEA 1POXA 4KUEA 1HRDA 1VP9A 3T6KA 2ZZMA 5TX7A 3UAGA 4WK0B 1PJ2A 4QVIA 1HZZA 2JGKA 3E8MA 3HU1A 2NUPB 4JZYA 1EAYA 4XTCS 1NZFA 1ZSNA 2FUCA 3JQDA 4J75A 2VF2A 2VHUA 2HU2A 4D0NA 5LXTB 3P9IA 1V5EA 3HRIA 4XLLA 3SC2B 1RP7A 2BEWB 2B8NA 2H4FA 4K9NA 1MB9A 4M36A 2XKKA 2VQDA 1CE8A 2O9JA 4KTVE 1ODTC 5K3CA 5CA1F 2GERA 3G6KA 1H9AA 1PDVA 3Q3GE 4HB2A 4XM0A 4NBSA 5U9CA 5DBEX 5IKEA 3VOAA 2A9QA 1CBUA 5ICSA 5CA1B 3EMKA 5DDIP 3WIBA 4GQIA 3Q9NA 1K68A 2AFIB 1BE0A 1P2GA 3COVA 2H52A 2IUFA 1K0FA 2NO7A 3AESB 3D8HA 4QVKA 5DI3B 5J4KA 3QBDA 2GM5A 2YN2A 1RM3A 1IY2A 3K2QA 4JI5B 1E4OA 4TROA 3FGOA 4MP3A 4N8SA 4BFTA 5J2UB 1COWD 3I4LA 4A8JC 2I54A 2PUAA 2ADOA 3OJOA 2QY9A 4AY6A 1NRIA 4YCCA 2IS2A 1MR3F 3D59A 3L7CA 5DIFA 7MHTA 3IIIA 3OMLA 4NYIR 3O8OB 5A5EA 4O4LB 1FJXA 2HSDA 5JYCA 2RGRA 4R1OA 4C20A 3LVQE 3OIYA 2SKCA 3T5CA 5L6MB 3W1EA 4UBLA 2XZOA 5KSYA 4MPTA 5DMXA 2ZIFA 4QLOA 1FMJA 2FHSA 3H97A 5ULLA 4TYYA 2FDRA 1TYAE 2G09A 2ODTX 4ZI2A 3ONVA 3LIIA 5DF1A 1NW5A 4I9GA 4RJ2A 4D1YA 1KK2A 3IDQA 3QYFA 3OIWA 2FB9A 3V4OA 4KQ1A 3W5SA 2X0DA 1CUJA 3K30A 3DAFA 4FQ8A 2OO5A 1LLQA 4FC7A 1BWRA 1JDZA 1RKBA 5DK6A 3K0SA 3EXHB 4D96A 2FPLA 4F91B 4TLCA 3ICPA 1NKVA 1DAPA 4QATA 5IJZA 2PFSA 3GGCA 4OK3A 5EJFA 4LNHA 1IJKA 1WUJS 1A4RA 2FJPA 1R3FA 2O7QA 1EFVA 3L6RA 2G04A 4ZVKA 5BV8A 2Q7OE 2D0OB 4A6EA 2FZLA 5DJ5A 1FP7A 1GTRA 2COUA 4EO9A 4BZQA 1IHYA 1NR5A 1WL8A 2I5PO 4MB0A 2HM7A 2GBFA 2Q1YA 5F1OA 5K9ZA 1TM1E 1EQ2A 1HE5A 1JL3A 3N8IA 5BSHA 4MXDA 2ZE6A 3EEQA 2ZYIA 4A6DA 1GZ6A 3WMGA 1II8B 4XVHA 5CM9C 5E9AA 3USCS 1TCBA 5GJBA 3IH8A 2YUIA 4WV3A 3TYXA 1IQ0A 1E66A 1O58A 3W6PA 1WSAA 4AMUA 1RJDA 1DFGA 3MT7A 1NI4B 5JEEA 2DTDA 4YI3A 5BN3A 3UV6A 4MULA 1UMBA 2YH2A 4N0QA 4RZUA 4FWTA 3ZNOA 1Z8NA 4AUEA 1ZAYA 2GZRA 3H5WA 4KL8S 3MWEA 2PN1A 4M1EA 3RARA 1KBZA 5FBZA 5KREA 1DRVA 3NWOA 2ZRBA 3C85A 1DIGA 4D8WA 1FLDA 2DVMA 4FQ7A 4ZYZA 4M1SA 1CRPA 5ERGB 2QUHA 4MWTA 2VK2A 4DUZB 3EWNA 2GXQA 6REQA 4PLVA 3NC4A 1QB7A 3IL2A 1VIYA 3WHPA 1AD2A 2JJQA 3NM5A 4H4EA 1A76A 3V7NA 5AQ1A 5DNCA 1NNUA 1GQYA 1P75A 2R65A 2Y8EA 3C7CB 4E14A 2OLJA 3DYIA 1XMQB 1LQTA 1JTEA 1SEPA 3B3GA 2H4HA 1Z13A 2VDNB 4XB6B 4XR9A 4HF7A 5JTUA 1E1NA 2DSNA 3AZPA 4M8KA 4Q7MB 2XZPA 5JFGA 3AGEA 3L3BA 3ENKA 5BV0A 4XPZA 4BFVA 2X2EA 5JSUA 1QRTA 4B9AA 4Z9YA 4I9NA 2YOFA 5L51A 3QX3A 3R76A 4MQ4A 1W30A 1C3EA 1XQ9A 3O38A 3OPYI 3LUJA 4BB0A 4L5YA 2HF2A 5DNVA 121PA 3B6ZA 3MC1A 3PEEA 2X5NA 3HDYA 1IBSA 2BHTA 3ZEIA 4KVFA 3I9V1 2CJPA 2DOKA 5DTRA 3V2UA 4H77A 2RH5A 1A9QA 4J9UE 4JKIA 1XNGA 3UAYA 2NU9B 4ENTA 4Q9AA 1O3YA 4CCWA 5J2TA 1QBKC 4MUNA 5KHAA 3SEZA 3I09A 5EKTA 1D5WA 1RPAA 4U9IS 2XCOA 7GPBA 2UYCA 3M49A 2NO0A 2XZDA 3CLUD 1K5GA 4MV6A 4D9NA 1T5LA 2JARA 2UYOA 2OKCA 3HB1A 2ZJ2A 4M7RA 4CCYA 5KKAA 5A5FA 2PLWA 1Z2AA 3ZK8A 3HWX1 4FE7A 1J56A 3RVBA 3TGPA 1JKMA 2EZ9A 3LU1A 3ABIA 3GA0A 2FSIA 2I71A 4GYJA 5IC5A 3L6BA 1N5JA 2ODQA 3L7JA 3GA5A 3K3PA 3SNKA 1Y81A 2P11A 4PNZA 3QVUA 3U1VA 5EHGA 1Q0QA 2QTLA 1B43A 3EGXA 3TIFA 4AXBA 4AULA 2VYFA 3LBFA 1LPAB 4J91A 1CRLA 2A8YA 2YV5A 3PUKA 4IMJB 1AKRA 2BSAA 1OREA 2OM2A 4Q3NA 5FIUA 5L3RA 3RU3A 2G7ZA 4NBRA 3WNCA 4A4DA 1F38A 4MKRA 1ABEA 4GM0A 4I1YA 3IP9A 4DJ5X 2JHPA 2LZ0A 3Q4GA 1DRWA 3W06A 4ZVOA 1CY7A 1E2UA 3GJYA 4D4JA 5BR4A 2DKNA 1EFAA 4RQBA 4B47A 3SVZA 1UFQA 1RKQA 4DR2B 1RYNA 4XH9B 3BL8A 3N6XA 4IMRA 1F3LA 2OBLA 2QB5A 4BMOB 2I2FA 4IS2A 3MT9A 1FU4A 1P2UA 5E3JA 3F3KA 3CF6R 3KOYA 1HX7A 1KDRA 3W9YA 4YDSA 2ALJA 3L7YA 2ZR8A 3RAGA 5EMLA 3EN0A 4LJ5A 4QJBA 4UDNA 1VL2A 2IXDA 2PPLA 4NZMA 2HT1A 3QXHA 3FDZB 4BX0A 1JR6A 1FCFA 3GCWA 1GFSA 5KSOA 2UYQA 2ACKA 2OD9A 4QPDA 5LU8A 1C7EA 5C8XA 4ZMBA 1KJQA 1UFVA 1HTWA 1QG2A 4HYLA 2HBZA 2VBIA 2XYGA 3U0BA 4CQLB 5BR7A 5TS2A 2WUWE 5T3YA 4Z9FA 4RAOA 3EPKA 4AQYB 3L07A 3VOSA 1OC4A 1DBWA 1G5TA 2WHXA 3LC7O 3WJ2A 2HHJA 2AWNA 3MWKA 1GL7A 4IUYA 2TMDA 3WYNA 1K8RA 4Q9DA 2XZTA 2Y1KA 3I3OA 1YQXA 1IL0A 3JQ7B 1B41A 3UENA 3PHHA 2P5SA 2O8FB 1FXSA 2FWPA 5HF5A 4EVSA 1TAHA 3TUZC 3CN9A 1G98A 4GLJA 4MV0A 3GG9A 4BQQA 2FN9A 2CLHB 4HDRB 1RAIA 5I4IA 1KQGA 2C97A 1QCCA 2H4WA 5FULA 2N0SA 1M8FA 2QDKA 5EG5A 3MUEA 5T4EA 3VO1A 3I58A 3USES 3B2EA 3T6OA 2AG6A 1KH1A 3KKMA 2J3EA 2N9UA 1AUPA 3BHNA 5K8CA 4CBVA 4P36A 3Q8MA 3HWRA 4AZ0A 1Q3HA 1M1YA 1ZWKA 5IK2A 4OGLA 1PGPA 5HFNA 5I5GA 3RF7A 5IXYA 4JI0B 5AHOA 1H2BA 4WLUA 3G85A 2Y1GA 4DN6A 2C3UA 1LBSA 4YV1A 4K81B 1AG9A 5TF4A 4KIGA 1FMCA 5LBTA 1JV2B 1E1CA 1F2DA 4L5BA 1PWEA 2C59A 4QM7A 4QELA 3S68A 1NNLA 3IBFA 1YTLA 1QTNA 1XQWA 1N2JA 3MG9A 4K9MA 4IXDA 5CTAA 5AOBA 2ZB7A 3FVTA 5C4MA 2X4LA 1ZCBA 4BKUA 2HPAA 4BL5A 2DCUA 1QFZA 5EIXA 2AOTA 1TUBA 1G55A 3E7FA 4RYLA 4IDHA 4YAWA 3ADDA 3ORQA 5CEFA 2ZRKA 1FP2A 1KFCB 1L4NA 2PUWA 2WZBA 3GGPA 3LHKA 5EXPA 4DBLE 5TS3A 1CULC 1WXGA 1A9RA 1Z4PX 4UPVA 5IDVA 1L5NA 1MNAA 1ZMBA 2FFAA 2Z6VA 1SXJE 4LPKA 1Y4ZA 4UFNA 5TGTA 2BZ1A 2GYYA 3PC7A 2ERYA 1R8QA 3PFIA 2C5HA 4WUTA 3U9LA 1AHHA 1Y1KE 1ESMA 1JLLA 2Z8XA 2R62A 2IIVA 3F78A 3RG2A 1MAAA 5KZMB 2P4HX 3UMFA 2R8OA 2P6PA 3VR6A 3GJ7A 4DKJA 1SD5A 2VJBA 4GBED 1N8TA 2YY5A 2ZRCA 3OTWA 4TRNA 3B85A 5DCLA 2VRBA 5BMVF 3L1HA 2H2AA 4P0PB 4XI9A 1F1BA 1SC1A 2IE8A 2YQ4A 5CYPA 1U2PA 1ZHOA 3PYLA 1ORRA 2XD4A 1K6JA 1M0TA 3U28A 2R1TB 1DWUA 3DXZA 4FHEA 4IFIA 3SAJA 2BMJA 1V26A 2Q0HA 3B36A 3ZCSA 2O2ZA 3V42A 2EYUA 1Y4UA 2VHJA 1ZM2A 2CVPA 2Q3CA 3OE4A 1IK6A 4URWR 3SE0A 5KWVA 1O97D 3JWEA 4WZAB 3M1AA 1AGYA 2AJTA 4NG4A 1PT7A 1RI5A 2A9JA 2VT7A 3LUAA 3OM0A 4NCNA 3U5ZB 3R3UA 1YRYE 2FHPA 4O63O 5KQMA 1G7CA 4P4UA 1LBTA 2CXNA 2ZBUA 2PVPA 2QTRA 1SHUX 1PQWA 4WECA 5FD8A 2QRVB 4Z7NB 1DX9A 4NNPA 3SBEA 2J9FA 4F9EA 2CUKA 3LUDA 1R5BA 1XZMA 1RRPA 2XHEA 3Q5EA 1E3DA 4QTUB 4UASA 4MITA 1H8EA 1E2LA 1NUUA 3BMCA 3N8NA 3D4PA 4QT4A 2AQKA 3RD5A 5AT1A 1JT2A 3V8NA 4ENPA 5ITSA 1T4MA 5D3QA 1A71A 4DJTA 1VHDA 2CNWA 5IW8A 3TJMA 3A1WA 3EXFB 4B48A 2XT0A 4ZT7A 4DLXA 4ZK6A 1KU0A 4WKBA 4EY8A 1IIBA 5BWMA 3OFVA 1NW7A 3VYVA 1QR6A 2P2ZA 2PM8A 3P0HA 4FHGA 2W48A 1QFSA 3CURA 4JI8B 1DCMA 1M34A 2IX9A 2K5UA 2RGCA 1CQIB 3G9ZA 3NC1C 4RK5A 3TSYA 5JH7A 2PX8A 5KSWB 1C9YA 1QVVA 5FA5A 4B6JA 1Y8RB 3EZ9A 2HUNA 1FX0A 4HPWA 4P92A 4BCCA 4E6PA 4A2QA 4P7KA 3VDQA 3WLTA 3ZCXA 1NSTA 3BX1A 3I53A 5PNTA 4AE2A 2D7CA 2D0PB 4YRTA 2XCRB 8ATCA 1CR6A 1N6IA 5DK4A 4NCIA 1ZE2A 1XUOA 1RHKA 1VXOA 2E4WA 2N47A 2PMBA 2UZ4A 1Z47A 2ZSUA 2XUKA 2ZIUB 1USWA 4HAIA 4XQGA 5K3DA 5EJIA 4B7CA 4DV3B 3K4HA 4IBOA 1QE5A 2I87A 1CZKA 5AW7A 2PXAA 2J5TA 3AV0B 1VSUA 4CF6A 3RW9A 1KI1A 4Q6BA 2BL4A 2J9GA 3PCXA 2RARA 1E3JA 1E2MA 1EXNA 1JRLA 3K09C 1TVEA 1KZYC 1VE7A 4Q4JB 1H2EA 1QRAA 4EARA 2RI6A 1EGHA 2PUCA 3I6BA 4KB5A 4MARA 1Z3CA 4OD0A 3UJNA 5KS2A 4PCUA 2LR0A 2Q5HA 5IVIA 5FYQA 3TRKA 3NETA 3ZJVA 1Y5NA 1R18A 3ACDA 3DTNA 3GRFA 2AC2A 2ZSIA 4WLOA 5P8WA 2WWHA 5I7SA 3RC8A 2CLKB 4YP1A 3OY2A 9GPBA 2XGGA 1L7AA 1GY8A 4CI9A 4DOMA 3PRHA 4RLSA 1T8PA 3IXLA 1PDWA 2F3TA 3TLJA 4OBBA 3TR6A 1ZM9A 4EYQA 5BW8A 1TA0A 1IOZA 1GILA 1Q5PA 1QGOA 1G20E 1XT6A 2DWOA 2O2JA 3DB2A 3FDFA 4UNQA 4X93A 2WD9A 4M98A 4DLRA 3DE5X 3L0IB 1TZ2A 1MLDA 1OVMA 3LJKA 4IY1A 1ZZEA 4LOIA 4PVCA 4XVRA 4DXAA 2WJYA 2ZCUA 3OQ6A 3GRYA 4A7PA 2QRLA 4JVMA 1G8GA 3AY0A 4RFSB 1OH8A 2WJAA 3TJZA 4JU9A 5KYGA 2FEAA 4RANA 4X3PA 1RPJA 1Z68A 2ZBEA 3LY8A 1XJWA 2G17A 3FCOA 1OR8A 4DY4A 2O05A 2OO7A 1UDBA 4JL5A 3TO5A 4RENA 4E07A 1ZIPA 1L2TA 3O9VA 5K6AC 1SZJG 2YFHA 4DIOA 1MNQA 3C14C 5J63A 3WAGA 5EXDA 2A9FA 5IDWA 2VDRB 4RELA 2BOVA 4IO1A 4J03A 5H68A 4B34A 2IOHA 1V1MA 4G5GA 4BQPA 2DR2A 4QBIA 4DREA 5FEUA 1H93A 2ZZKA 4NZYA 4V2IA 4CMKA 4JHLA 2PE5A 3W4IA 1PG0A 2HTEA 1G2PA 2PMCA 3DE6X 2QUIA 3KKNA 1C1DA 1DCFA 1IH8A 1KL7A 2R8YA 2PWAA 4Z0NA 1OT3A 4UQPA 1GLNA 1IN5A 5B2ZA 1QHIA 3GAAA 3F5MA 4CL2A 1LLCA 1LKZA 1EP2B 1QB8A 4RW0A 2FPPB 2OHVA 3B1ZA 5IF3A 4ZP1A 3IF5A 4WACA 4BNHA 2CFCA 1YK1A 3D1LA 5CJPA 2B99A 3FCEA 3I83A 1ZONA 1MX5A 2QN7A 2ST1A 4LCEA 2ARKA 2EJTA 3DDOA 4FYYA 4US0R 3RYHA 1C50A 3I9V6 2GAIA 3FMFA 3H2IA 4C3OB 3EC2A 3PDIA 4OJNA 3PFNA 3DWIA 5A3RA 4EENA 2P1ZA 1SIOA 3A10A 2QV7A 3VU0A 1T15A 3X1ZA 3EUAA 4BFSA 4WGGA 1WLYA 4W5HA 3EEOA 4FXPA 2BFDB 4FZVA 1JUDA 3CISA 1AKTA 1J2BA 4FTWA 4JL6A 2JGLA 4C0JA 1DT3A 4G0QA 3UMGA 1KAOA 3RLIA 3JD1A 4I3HA 1DPGA 5EMKA 3C7AA 3ZGYA 2CE7A 3ABSB 1E1RD 3P0EA 1ZJ6A 3R3WA 4BWGA 2OHJA 4F60A 4M3NA 3T0FA 1NQTA 1T1IA 1D9ZA 2UYGA 1ZI6A 2O5VA 2C4TA 4ZCLA 3T95A 4A1OA 5A7FA 3S3TA 1F7UA 1Q57A 2ZIVB 3CZCA 3JQAD 5ENDA 4ZT4A 3ZX4A 5L3QA 3IE2A 2OCAA 2HLDD 3QSGA 4OQ4A 2QD5A 4TYMA 2J0EA 3U13A 4B31A 2Z0MA 3TX2A 2YHIB 5C46F 2DP9A 3TPZA 2EP8A 3V1NA 5KU7A 3QXJA 4HOYA 1WCYA 4Q18A 1E92A 3PU6A 3K4PA 3MUOA 1S8OA 2TS1A 4S12A 2PSSA 1SIUA 4TLLB 2OLKA 4DDMA 3RUCA 2K87A 3RM3A 2AG8A 4JLVA 1N32B 2HA2A 1LPOA 5EUZA 2BJVA 1XSEA 4HWOA 4EG4A 3DXYA 4P38A 3OJCA 2JLYA 5JYEA 1EDZA 2IEBA 4PX9A 5G4KB 2BM1A 3L0PA 4HRAA 3CNEA 4X5OA 3AVWA 4AJNA 4JLOA 1JB9A 1NBMA 4B6RA 3AM1A 2UXBB 3LY9A 2JNWA 4MCAA 3TTXA 5THKA 5J23A 10MHA 4RO0A 5KYVA 4JIMA 4BQRA 2DXNA 2QLBA 1J7XA 4F3RA 2EYQA 2NV6A 5CLIA 3UWPA 1ZNZA 3I30X 2ZULA 4YVFA 1BX0A 4JK3A 3NEJA 3JVDA 1UKAA 2W2NA 4HDOB 1U2ZA 1P73A 5EXXA 3GEBA 1RI4A 1I13A 2DBVO 2RGUA 1FXWF 2B83A 3W0LB 2Y76A 5JCJD 3WRYA 1T34A 3DLPX 4FFNA 2IEGA 4I8DA 4UUQA 4RVUA 1JG7A 3ZWDA 4F2GA 5TLSA 2VR1A 3E1GA 4BTEA 2DH6A 3RIYA 2GHTA 4R1SA 2VZLA 4NI5A 4WBNF 3VR5H 2QRNA 3ZDDA 3KLPX 4RGBA 2J5XA 4L9AA 3QUSA 3ZV4A 3GLIA 3WGJA 4FHZA 1S89A 2AZDA 2XDYA 3IYLW 3QEMB 1Q3TA 1YUMA 3QK7A 5ED0A 3NHRA 4EGFA 2DFKB 2R6JA 4KWIA 2OAGA 3BGDA 1NP6A 1PUIA 5I9LA 3MJHA 1AUQA 3ZVRA 5ICFA 4D45A 1GVHA 1O94A 1ZD4A 3IELA 4K0RA 3RSFA 1AUXA 3L0BA 1R0CA 2H18A 2QPTA 1KEWA 3KFXA 4O0MA 4O8ZA 2XDQA 2JIQA 3VR1A 3ZDBA 3VA7A 1VJ1A 1WO8A 4LBYA 3EEYA 5GJVC 3KRTA 4BFWA 4DDUA 2QXYA 3ECAA 4WNIA 2QRKA 4HAXA 5C80A 1ZOOA 2YMQA 1UXOA 3ODPA 3PSHA 3A4LA 3AB7A 4JCOA 4EUEA 5IASA 3AOEC 1OZAA 3DLIA 2H51A 3HO1A 3ICWA 2Q49A 1TJ5A 3TZCA 2QVXX 4QEDA 5B5SA 4Z3OA 3EVTA 3DL7A 4J1TC 1YMVA 3A05A 3OLWA 4AVYA 5MN6A 1UMKA 2I2XB 3W79A 3VAZA 4YYEA 4DB4A 1OX5A 1BEUB 1WUHS 1E64A 2NPIA 2R2GA 3OTOB 4MWDA 3BRCA 3HDTA 1YJCA 4AJ4A 1NZJA 5FLKA 3WX0A 3PC3A 5AR1A 5ALMA 5CB4A 4NFLA 1JJAA 4WNCA 4WDRA 4ZZ0A 4CEJA 1GSAA 4A1FA 3VPHA 2UU9B 2V9PA 2G9QA 1S2GA 1BS9A 2OXTA 1OPRA 2W6JD 3TOVA 2NZWA 3BXXA 2XEXA 2EWVA 4MW2A 3CPEA 2I3AA 3R5KA 4J3FA 1A9OA 1EFHA 3P4UA 1ZGCA 4JQOA 4PG4A 5AW0A 3SX0A 4PRKA 3TXYA 1GUYA 3C24A 4AUKA 4YT4A 1HZJA 4P22A 1GAWA 4EELA 1Y6FA 1KJIA 1YIDA 3WKDA 1QE0A 2KW5A 3O4VA 9ABPA 1QHSA 2GWHA 1Q6YA 3KOXA 1E6KA 3KTOA 4TQ9A 5E6UA 5LYJF 2O3QA 1FFHA 2OYRA 2WU3A 4B3RB 3GJ5A 1EUCB 4H1HA 4OLFA 4MVWA 4TTIA 2CL5A 2YVKA 3U7QB 2GSDA 4KMMA 2K2QB 5K99A 3HPQA 4UBJA 1NAIA 4MV8A 3CC8A 2QZJA 3W9UA 2PZJA 4YLEA 2I91A 4ALNA 5AKJA 3O82A 1JDTA 2IYZA 2I34A 1WXWA 4H6WA 4ZJPA 5IABA 1PVVA 3GVIA 1L7EA 1TKBA 2QM0A 4RA9B 4TQGA 5K0NA 1QGYA 5SICE 5IMSA 3TECE 2TMYA 4ZDWA 5AW1A 2WEKA 3FPBA 5FI0B 4KI7A 3OQIA 1N6EA 4OFBA 1M6VA 2I6XA 1PEYA 1TRKA 3HDJA 3PNLA 5CAEB 1XRPA 2PAAA 4Q4HB 3NW9A 4ZO8A 2QD3A 4XR4A 2GXUA 4KXWA 4CR8A 2HYIC 3JASB 1JXOA 2FMHA 1PTKA 2YWXA 4ALKA 1BEZA 4QRDA 2O2XA 1L5KA 3P96A 4ARVA 1NPDA 1SQGA 3C8UA 2OC4A 4QQ8A 3M89A 1H6DA 4FYJA 4UZSA 3UWDA 2GARA 7MDHA 5KSPA 4BP8A 4CM8B 1NM5C 1CC1S 3U4QB 1ML3A 3QPVA 5BNFA 2ZW9A 4AZVA 4JJIA 2AZMA 3IAAA 3LXUX 1GNPA 3FPEA 4AJ1A 1E98A 3CFYA 3FROA 3E9EA 1G291 3RSOA 3WP0A 2DETA 1EBBA 1P5ZB 3GJTA 4KKXB 3OEHA 4NCJA 1PEKE 3KR2A 2GA8A 2FK7A 3NAMA 3RT1A 1VLLA 2XCUA 3KUXA 2R79A 3IBTA 5JG7A 3V7WA 3GWZA 1TOAA 3VC2A 4P3NA 3GRAA 3R7WA 2WWRA 2PMDA 4JP1A 5LP6B 1FDSA 1UBCA 5A3VA 3EYAA 3LG2A 1U2SA 1ZH0A 3CMMA 2XOXA 2Q5IA 4JFAA 4PYIA 3DMGA 2ATCA 4GOJA 2ZRJA 4FILA 3TSZA 4YUYA 1Y5RA 3L92A 3QRWA 3WVNA 3VI4B 3TI9A 3VQTA 3AHFA 3DMFA 4CR6A 5JNVA 1UM9B 3TRDA 1QK5A 1Z5PA 1ZCAA 2HRRA 4H9GA 3QG1A 1EZ1A 2JGAA 3SYNA 1V8PA 2J3IA 3PD7A 3KQKA 2W2XA 3GFOA 3ZWVA 4I2NA 4EI9A 5IANA 1KMHB 4DMUB 5GVRA 1SGVA 1EBUA 2IXBA 2HV8A 2FWAA 2PKQO 1ENYA 2M1XA 1HFWA 3TFQA 4C0WA 1E3QA 3HDGA 2A14A 2E5OA 4DR7B 4U7DA 1U7TA 2RIPA 1N2CB 4UNIA 3CSSA 2FSGA 2LD4A 4IRMA 1YU6A 3LE8A 1GTMA 3BAZA 4ER7A 1O08A 4M1MA 3EIQA 4R2HA 4EP1A 1C8BA 1YZLA 3HACA 2NUPA 3GT0A 5H7XA 3VOBA 3WGVA 3AP1A 2QW1A 4P34A 2LE0A 2F9LA 3JVEA 5ALGA 5DHRA 4QUEA 5LXTA 5ED4A 1TK2A 2P3OA 2QTZA 1NP3A 3SKVA 1QGED 4B3IA 3PENA 2BEWA 3SC2A 2AMFA 2RKBA 2F1OA 3KT3A 5CVJA 2UVQA 4K40A 3ZOZA 5IVPA 4DNPA 1E2IA 3U60B 5IZCA 1SRRA 1IM5A 4IV0A 3HB5X 1TILB 3P8ZA 2DPYA 3F46A 3JVVA 4HWKA 2W6MA 2YYZA 4YQYA 4JV5B 1UINA 3C6QA 4AURA 2DPMA 3SM9A 2Z2YA 1MJHA 4LHEA 3RVRA 2AFIA 4G1UC 3ZDXB 1WG8A 1JG1A 3U17A 3IR7A 1ONOA 3H9CA 3L0YA 5D87A 2R84A 3AESA 5DI3A 4F21A 3R3ZA 3DDNA 3LQFA 4TLEA 2I9KA 3K6JA 2P38A 3W5BA 4NZZA 4UUNA 4YRRA 5AQEA 3ZQ6A