3C0KA

Crystal structure of a ribosomal rna methyltranferase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
395
structure length
395
Chain Sequence
SVRLVLAKGREKSLLRRHPWVFSGAVARMEGKASLGETIDIVDHQGKWLARGAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGLPGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQGPVTGELPPALLPIEEHGMKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTYRDRGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLFQKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Escherichia coli 23S rRNA:m5C methyltransferase RlmI (YccW) reveals evolutionary links between RNA modification enzymes
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
molecule keywords UPF0064 protein yccW
total genus 124
structure length 395
sequence length 395
chains with identical sequence B
ec nomenclature ec 2.1.1.191: 23S rRNA (cytosine(1962)-C(5))-methyltransferase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase
A PF17785 PUA_3 PUA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 3c0kA01
3.30.750.80 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA RNA methyltransferase domain (HRMD) like 3c0kA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c0kA03
5LQAA 4PGHA 2AVNA 4PONA 3SXJA 3EPPA 3MQ2A 3B3JA 1SGVA 2FCAA 3E8SA 3KQMA 3OU6A 1BHJA 2GAFA 3QV2A 5CM2Z 2IFTA 1P1BA 4PYQA 3GRRA 4RV9A 5K0EA 3V8VA 1JG2A 2NP7A 5KQRA 3R9XB 4C4AA 3FRIA 1TW3A 2PVCA 3GWZA 5D1NA 5ICCA 4RTOA 2OYRA 4MWZA 5E2AA 3OU7A 5GINE 5H02A 2ZW9A 3LHDA 2ZBQA 3UJ7A 5KYGA 4RWZA 3P9CA 2P3LA 1NKVA 3HVJA 2XVAA 3BWBA 5DRYA 1AQIA 4JXJA 3HVHA 3OZSA 1FPQA 4RTPA 4PINA 3FUWA 5EVJA 3FTCA 1SQFA 3PX3A 5EIFA 5DSTA 1P39A 4P58A 2ONZA 1T5YA 2IIPA 3WSTA 4C04A 2AOUB 2I9KA 2OY0A 4X1OA 5DX8A 5EHGA 5DWQA 1L9KA 3P2IA 3NVMB 4V0QA 1JTFA 2B9EA 1JG4A 1UFKA 3MAGA 3OE5A 3DLIA 4HH4A 4E31A 5IH3A 4R8SA 3A7EA 4P7KA 3OCJA 5HIKA 1XDSA 3ER9A 2B25A 2ZWAA 3LPMA 2IH2A 3UJDA 2BM9A 3LSTA 3NW9A 4AX8A 1ZG3A 1NW7A 1AQJA 3TR6A 2VDUE 3F4KA 5LQRA 1D2HA 5EG5A 2ZIEA 5C1IA 2C7QA 4OX9Y 3UAIA 1PJZA 3ME5A 3PB3A 2UYOA 3BWMA 3ELYA 4CKBA 1ZGAA 3DMHA 3H2BA 2C7OA 3OPNA 5DTRA 2PY6A 5EGSA 4RTSA 1NT2A 3PX2A 2OB2A 3KR2A 5DM4A 4B17A 4DQ0A 1FBNA 3LBFA 4CWAA 2F8LA 2Q41A 4KRGA 3QOWA 3FRHA 3C0KA 1ORIA 5T67A 2XVMA 5FA5A 2ZSUA 4HTFA 3P9KA 2G71A 3P71T 3EVBA 3OFJA 3B5IA 2OXTA 3NMUF 3M6WA 3FUTA 3KR9A 2JG3A 4IKPA 5CVDA 1M6YA 5CVEA 1VP9A 1KPHA 4HSGA 2B78A 4FR0A 5T64A 1IT7A 3T7SA 1RJFA 2QY6A 3EMBA 4X63A 1X1BA 4DKJA 4ER7A 3HCCA 4CTKA 2BR5A 2CX1A 4EMSA 2FK7A 3BKXA 5CVJA 5DLYA 5DM2A 5EQJB 5HIMA 5JR3A 3HVIA 4PYNA 2P7HA 3LDFA 3CVOA 3S68A 5E1BA 4BLVA 3HEMA 4RSRA 2UZ4A 4PYMA 1WG8A 2QM3A 3LBYA 5K0CA 2FPOA 1RI2A 5DM0A 1N2XA 4XUCA 4E2XA 1JQ3A 1KIAA 3GRUA 1AV6A 1RJDA 3RODA 2WA2A 3GRZA 3BUSA 3MGGA 3LKDA 4YMHA 2Z6UA 3EVGA 1AF7A 2I7CA 2BH2A 4M38A 1RJGA 3C6MA 2JHCA 3M6XA 5E9WA 4E30A 4EK9A 1Y8CA 5BP7A 2IDKA 4MTLA 1ZS7A 3U81A 3UJBA 3LECA 2EG5A 1I9GA 3CBGA 3DLCA 4GUAA 2ZZMA 4P7FA 2QRVB 1JG3A 5LQKA 1XDZA 4XUDA 2AOVA 1N7IA 2ZCJA 1IXKA 2NYUA 2IBSA 2H00A 1VBFA 1SKMA 2PT6A 5EZQA 3R3HA 3B3GA 4YUXA 4YV1A 3EVCA 5DM1A 4CKEA 4YUYA 5C9ZA 4OBXA 3KKZA 2Z6QA 3ERCA 1SQWA 3P97A 2B3TA 5M5BA 3TM4A 4PWYA 4YUWA 4U7TB 3R0QA 3SSOA 2PX4A 1L3BA 2ERCA 4GC5A 3KQWA 5DTMA 4ER3A 2P41A 3JWJA 4QQKA 3C3YA 5K0BA 3OFKA 5K05A 3TFWA 1F38A 3HM2A 3MTEA 4A6DA 5CCXA 2P35A 2NXCA 4E2YA 2EX4A 4ER5A 3HNRA 1QZZA 4DMGA 1G8AA 1YZ3A 5FCDA 1DUSA 2Y1XA 5DX1A 1WZNA 4PIPA 5LQCA 3Q7EA 4YV2A 4C07A 1WXXA 1KPIA 2DPMA 1O9GA 3KPUA 1RI4A 3HCEA 4YMGA 3JWIA 3D79A 3G89A 2EJUA 5E2BA 2O05A 2ESRA 2OBFA 3PT9A 1KP9A 2WK1A 2JJQA 4QVGA 1SVUA 4F85A 3B7PA 1J2BA 2ADMA 2VDVE 4C08A 4XUEA 4L7VA 3HP7A 4KIFA 2YXEA 4GEKA 2AZTA 3REOA 1UWVA 4DCMA 3UA3A 2O06A 3DR5A 4FSXA 3R6TA 1JG1A 1NV9A 1R3EA 1EQAA 2P7IA 1ZGJA 3QOXA 5K8VA 3EEYA 1WS6A 5BW5A 4E2WA 4PYLA 3AXTA 5E1MA 3G88A 4QPPA 5T6BA 5K0GA 1SUSA 5FHRA 1YF3A 2HWKA 1EAMA 4PCLA 3L8DA 4KDCA 4RVFA 5DPMA 4Z2YA 3D2LA 5E1OA 4C06A 2VDWA 5EIWA 4ATNA 4AZSA 4DA4A 3HCBA 5LQNA 3P8ZA 2FRXA 3LCUA 2JH8A 1VE3A 3I5UA 3G2OA 5EKXA 2OZVA 4AUKA 2CL5A 2ZULA 1SG9A 1X19A 3MERA 5F2NA 2NXJA 3X0DA 4CTJA 3DP7A 3CJQA 4RTMA 3BT7A 3A4TA 2ZIGA 1V39A 3DXZA 4EKIA 5K09A 4RTRA 1JTEA 1VIDA 5K0NA 1B42A 5FQOA 1NW8A 2PWPA 9MHTA 3T7TA 2YVLA 2AN3A 2PLWA 2ZFUA 3UJ8A 1G38A 1WXWA 1EIZA 4GBED 4H0NA 2YXDA 1FP1D 4ZTBA 5P8WA 4YV0A 3I9FA 2BZGA 4OBWA 1JSZA 3KPYA 2K4MA 4IWNA 2V7EA 5FA8A 1FJXA 3M6UA 2PBFA 3BGIA 3BWCA 3LGAA 1I1NA 1Z3CA 2GLUA 4ISCA 4O29A 4P7JA 5DRTA 5EEGA 1SQGA 3NTVA 1ZE1A 2JH9A 3FTFA 4YUVA 4OA8A 4BLWA 2NXNA 1M0EA 1NBIA 4P7GA 1VP3A 4IV0A 1NW3A 4GC9A 4HGYA 1P1CA 2G70A 2YXLA 2CKDA 5LQUA 2XYVA 3TPZA 4F86A 3FPEA 2PJDA 5FWAA 3K6RA 1R8XA 2ZBPA 3EVAA 1P91A 4PGGA 3DOUA 4A6EA 3A25A 3HCAA 4BP3A 1VQ1A 1XCJA 3ANXA 3M70A 5JUWA 4RVHA 3KU1A 1BOOA 4KW7A 2HNKA 1NW6A 2P1DA 2PX2A 3GRVA 4FZVA 4PCAA 4WVLA 4Y2HA 5GWXA 2QRVA 2ZVJA 3SSMA 2UYCA 3BGDA 2V74B 4K6MA 4PYIA 4R8RA 3TMAA 3CKKA 3VSEA 3UJ9A 4LG1A 2G72A 3BGVA 3GDHA 5GP1A 4GF5A 5CIYA 5HIJA 1QAOA 5KQSA 4HTFB 1K8WA 4EVIA 1TW2A 2CWWA 2FK8A 1BKYA 1BC5A 3CGGA 3P9IA 4QVKA 5FWDA 5KS2A 2OPBA 1PRYA 2VS1A 5ICFA 3A27A 3KQOA 1KPGA 4PYKA 2VP3A 3FPHA 3KQSA 3OZRA 3PVCA 4OA5A 3NWEA 3HTXA 1D2CA 5CVVA 2P40A 2GPYA 2R3SA 2UYQA 2OB1A 3BWYA 4DZRA 3KR1A 1KXZA 4AZWA 3IEIA 3DXXA 5HZMA 3DH0A 4E33A 3PLAE 3MCZA 2I62A 3KR0A 1JSXA 3G5TA 2A14A 5EHIA 1NW5A 2AR0A 3HCFA 3P9NA 2P8JA 4HRAA 1G8SA 1WY7A 4M7RA 1XTPA 5EMMA 1KYZA 1X1DA 4QTUB 1O9HA 2ZTHA 1KYWA 4FGZA 3E05A 5DTQA 4X60A 3B89A 3UJCA 1MHTA 5HEKA 4R05A 3T7RA 2AOUA 3BZBA 3IYLW 3EMDA 1VPTA 5HILA 5FTWA 2ZZKA 4FT4A 3SGLA 2HTEA 4HC4A 2EFJA 4X41A 3HA5A 5ERGB 3UZUA 3ELUA 4UOEA 5LSAA 3FTDA 3FYCA 5HOQA 3EVFA 1JQDA 2PX8A 4E2ZA 4G56A 5B1SA 5E1DA 3A26A 3CJRA 2ORED 1N7JA 1XVAA 3MHTA 3HA7A 4WXHA 1I4WA 4M37A 1NBHA 1UIRA 5EMKA 3VC1A 2NNWB 2GB4A 5EPEA 3UJAA 1L3IA 3V97A 3G2PA 2C7RA 3R24A 4HGZA 3UJ6A 4CXMA 4BY9E 1QAQA 1RJEA 1INLA 1QYRA 2P3QA 2JHPA 2YX1A 2ZIFA 1YB2A 3LL7A 3ELWA 3KPJA 5DXAA 1YFLA 3C6KA 4KDRA 1G60A 3G2QA 3HVKA 5E9QA 3CJTA 5GM1A 3UBTA 2OO3A 2BM8A 4RX1A 4POOA 4C05A 3LX6A 3NVKI 1DL5A 1XXLA 1IT8A 3KQVA 4EKGA 2IPXA 5U4XA 2IH4A 1NV8A 4KIGA 4M36A 1IY9A 1X1AA 1R8YA 2G8NA 7MHTA 2NP6A 3CC8A 3AJDA 1Q7HA 1Q0SA 1KHHA 4FP9A 3TKAA 1VL5A 5F2KA 3G8BA 5EC8A 1SUIA 3GNLA 4LWOA 5DT2A 3JWGA 3PFHA 3O4FA 3SMQA 3TKYA 3RIEA 2NXEA 4KVZA 2IGTA 4E32A 3KQPA 1JQEA 4GOMD 3LCVB 4OQEA 1HMYA 3EGIA 4GOLD 2R6ZA 2IP2A 3GGDA 3KPVA 1XDUA 3OZTA 3OU2A 4FT2A 4Q1TA 4GOOD 3K0BA 3VYWA 3FUVA 2DULA 4GQBA 3UWPA 3VC2A 1QAMA 4YUZA 3EVDA 2GS9A 3SX0A 4NECA 3IHTA 1F3LA 3I58A 4FS8A 4QDKA 3B3FA 3ORHA 1RI1A 3I53A 4R6WA 1H1DA 2AVDA 2AS0A 3THRA 2H1RA 5KVAA 3DMGA 2JHAA 3FPGA 1D2GA 5E8RA 3NJRA 5CUQA 4QTTB 4PNEA 3O7WA 4ER6A 2QYOA 3DUWA 5EKUA 5EEHA 3I64A 1ZKDA 5LR6A 3EVEA 3IV6A 5BW4A 5DXJA 2YTZA 5DSXA 3TLJA 4RTLA 5EMJA 2AN5A 2AOXA 2PT9A 5FUBA 2AOWA 5CCBA 1YFJA 1YZHA 3FTEA 1EJ6A 2E5WA 2YQZA 3AY0A 3TRKA 2C7PA 3HCDA 3MCTA 2IDJA 4DCGA 4PYJA 2PGXA 3MB5A 5K01A 1VLMA 5K0LA 4RTJA 4RVDA 1R74A 3DMFA 1R3FA 3M33A 4RYLA 4RTQA 1NE2A 4KWCA 1O54A 3TM5A 1HNNA 2H11A 3FUUA 4IV8A 5MHTA 2ONYA 4FSDA 2PX5A 2XYRA 3G7UA 1YUBA 2O57A 4BLUA 3NDIA 5IKMA 5GIOE 1KR5A 5BXYA 3GRYA 3LKZA 4XCXA 3SM3A 3PTAA 1L1EA 3T0IA 3UFBA 2BR3A 1RI3A 1T43A 3GCZA 5EMLA 2Y1WA 3DULA 8MHTA 1M6EX 2IH5A 3G5LA 1IQ8A 5K0FA 1EG2A 1G6Q1 3ID6C 3KQTA 2CX0A 2G1PA 2EJTA 3AWIA 3DTNA 3KQQA 4AZTA 2J5TA 4AZVA 3FYDA 1XJ5A 3Q87B 4BP1A 1U2ZA 3EEOA 2CMGA 1ZQ9A 1TPYA 2BR4A 2GA9A 3GIWA 3OE4A 3P2EA 4RVGA 3SR4A 2ZBRA 1JR4A 3ELDA 3FPFA 2AB4A 5EOVA 4E70A 3GU3A 2IBTA 1G55A 3KHKA 4QQNA 2ZZNA 4PYOA 3LDUA 1IM8A 2AN4A 4R6XA 1QANA 3G2MA 5DX0A 5LQJA 3G8AA 2OKCA 1R6AA 1ZE2A 1R18A 3EVZA 5CD1A 5K03A 3CCFA 2XBMA 5ICGA 2YUIA 2PXAA 2ZWVA 2GH1A 3M6VA 4DF3A 3ER8A 3O31A 4HG2A 1ZHFA 4MQ4A 2PKWA 3A7DA 4CKCA 2PSSA 3THSA 4C03A 5ICEA 5GIPE 4RTNA 3SVZA 2KW5A 2Z6AA 2HMYB 3E23A 1RI5A 3LCCA 5C0OE 2VZ9A 2PXXA 1XCLA 3KQYA 2N47A 1X1CA 3FZGA 4OQDA 2PV0A 3KPWA 5FADA 2UYHA 4X61A 5K0JA 3MTIA 2PWYA 3TOSA 2HV9A 3PS9A 2AOTA 1MJFA 2QE6A 5GOZA 2CMHA 3BKWA 3SSNA 4QPNA 3GJYA 4EQZA 3JWHA 3DXYA 3EGEA 2WA1A 5E9JA 2ZLBA 1FP2A 5FQNA 1EJ0A 2Q07A 4MHTA 2PXCA 4PIMA 1OR8A 10MHA 3TQSA 2P3OA 5FHQA 1ORHA 4ER0A 4LECA 3FPJA 2J5VA 3EGVA 3GXOA 3UA4A 2B2CA 2XYQA 4RTKA 2FHPA 2HR1A 3HA3A 3AXSA 3E7PA 2P38A 5E8JA 4V0RA 5FULA 1L3CA 1DCTA 5HFJA 3C3PA 1Q0TA 4DM3A 3RW9A 3LDGA 2O0LA 4Y30A 5F2OA 4MIKA 3PFGA 2I6GA 5GM2A 3GO4A 2YR0A 3FUXA 5G02A 3BXOA 5HIIA 2AOTB 1ZL3A 3P2KA 4QDJA 5EZSA 4GOND 4LWPA 4U7PB 2FYTA 2LD4A 3NWBA 5CVUA 5D1HA 4F84A 3NDJA 2O07A 1R00A 3M4XA
chains in the Genus database with same CATH superfamily
1RKVA 1QFJA 4NJEB 4Q01A 1P80A 2B3DA 4O2AB 4EHIA 2UVDA 4YUAA 5HZKA 3OU6A 4OMDA 1FDWA 1J9ZA 4N8EA 3V8VA 1BS9A 1TF7A 1DQNA 5KQRA 2GPTA 2QJRA 3FRIA 1MF7A 2G25A 2IHVA 4MB0A 1SN7A 3OU7A 4K2HA 1R66A 4UHBA 2ZW9A 5CXXA 4H1TA 4LQLA 2H57A 1M75A 1NIJA 1FF9A 2Y0EA 4YR9A 1XU7A 2O3UA 3I01M 3H2YA 1FUEA 1TM2A 4ZPJA 5I7UA 2QMHA 4RGYA 4WLUA 2FJUA 4OLHA 4FOTA 4NMMA 2NLOA 3QU7A 1PFYA 2V4ZA 4LJRA 2HDNB 2CLFB 5GZ3A 1WDMA 5DOZA 1Q57A 2Z5FA 4IOKA 2GPWA 1Z8HA 2QV0A 5JS7A 1EYZA 3P2IA 2C92A 4V0QA 1VE9A 3BE4A 3C8ZA 3FPKA 5JLJA 2UXDB 4I9HA 2X3YA 2DUNA 4QWMA 2B82A 3FBGA 4Y6PA 3VNBA 5L6MB 4P7KA 2AEFA 2C20A 1I3KA 3HACA 1KQNA 3UJDA 4BNUA 5CRIA 5ENZA 2Q3EA 3QSYA 1YWGO 4PZYA 2G40A 5IN4A 1BAPA 1ZMRA 1XRPA 2WFLB 4CCWA 3L0DA 1G8HA 4LX8A 1PJZA 1K8QA 1Q44A 3BTSA 3EA0A 3W2TA 5AHXA 1PEYA 3RK1A 1LPNA 3SF0A 4DYHA 5KOJB 3DEKA 3PRHA 1RQRA 3LVRE 4IZOA 3BCUA 1HL3A 1C7JA 1XN1A 1BHO1 5FOQA 1NDUA 5EJ7A 2YN2A 3EZNA 3PHLA 4F2PA 3THWA 4HTFA 2JCVA 2CXHA 4PCUA 3VR5D 4C0XA 3NUGA 3W5VA 5KJCA 3MS7A 3NMUF 2GCNA 4D43A 2JG3A 4G65A 3I1IA 1ADGA 1MKYA 5EJFA 1ZGHA 1JU4A 1DE0A 4ER7A 5JAPA 3C4JA 3DDZX 1NMYA 4DWOA 1S8FA 1VXRA 4ROTA 3N5CA 1IEVA 3IUMA 3HCPA 2BIFA 1CJMA 1YU6A 3SEQA 2RK6A 2Q5IA 1X80A 5TGDA 3BE8A 1UJBA 2N1MA 2ZJ4A 3PP8A 4HB0A 1U1FA 4I6GA 4OQLA 1L5WA 1M1UA 3DHWC 3MBIA 3QKWA 1JEQA 4E2XA 2O7SA 1RJDA 1ZBQA 1LF0A 1UDWA 4LRWA 1DKLA 3TBHA 3HXMA 3NUZA 1QDUA 2ZB2A 4CMCA 4KO4S 3E3MA 3DJFA 5TQVA 4X00A 2B6NA 5E9WA 1WE2A 2VHUA 3DONA 4BQFA 1KFJB 1K9SA 4BNGA 3T3IA 2C0PA 3H1AA 4EW3A 1HDIA 4XD7A 1I9GA 2L17A 1NXQA 4UBJA 1TCCA 1VJ0A 4TV9A 3GUHA 4ITRC 4B87A 4X1KA 3RTBA 3E7WA 1ENPA 4R1MA 1E9SA 1DWOA 2X0FA 3ZGOA 2M6LA 3TIXB 3B1XA 3EHEA 4BNZA 4KQIA 3R3HA 3A3OA 2WHPB 2C2BA 3PQCA 2FWAA 2W6NA 1VL1A 2PPLA 4MGEA 5FD8A 1OIVA 4S05A 3HZHA 1EJBA 2C4TA 2BKLA 3FYHA 1E6EA 4PWYA 5FUVA 4DAEA 2H0QA 4YUWA 5DTMA 3TGWA 1A27A 3T7IA 1QVAA 1GCUA 5K0BA 1TO6A 5H82A 4BVEA 1Y5MA 5DHQA 3TNYA 2P35A 4E2YA 1W85A 1XGKA 2NZXA 4PIPA 3T9EA 3CXUA 3HN6A 1W34A 3DBLA 4XQ9A 3SNHA 1WSWA 4C7KA 1W5AA 1P8JA 3F5SA 4G5YA 5HRUA 1R0LA 1RKBA 3EK2A 3E03A 5JY1A 1COWD 1I33A 2EJUA 4QUDA 1M54A 2PBRA 1KBQA 1FFSA 1ZD4A 2JJQA 1SVUA 4OP3A 3PJEA 2P75A 3OIRA 2V58A 1TC1A 1W8DA 1PJSA 1I3MA 2YFYA 3F6CA 5JHHB 4A26A 4NKRA 1DKMA 2HX1A 3C7CB 3RRBA 2A86A 1KEWA 3DR5A 4ZVVA 4BNYA 1TRKA 4KQFA 1DNPA 4MICA 3UCFA 3FOEC 2ZJYA 1CUYA 5CDGA 1B8NA 2GF0A 2PT5A 3AR8A 3K9LA 2OO7A 3U16A 3AEUA 4LZAA 1KBOA 1YRAA 2V6MA 1N8SA 5T6BA 5K7SA 1VSQA 3QE0A 3AVWA 3RS9A 4X5OA 4Q7QA 3A6HA 1N34B 3AF2A 2JAXA 5E1OA 3EQ6A 2HBQA 4O4IF 4LCEA 2X2EA 4TTIA 2DP4E 2I8AA 1QYDA 3UJHA 3P8ZA 5KNDH 3QXCA 3ZE8A 3U7JA 2FMIA 3A31A 3GN2A 5LDDC 3PNYA 4F3KA 4B2LA 3A4MA 4GPZA 4CLRB 3LO5A 4QWWA 3ZGLA 1N36B 1ACMA 3U4HA 4CI0B 3LA8A 4ZCMA 4O2AF 4ASUA 2VF2A 5IKPA 2WWYA 1IAQA 1SOAA 4F38A 3FGZA 1M6NA 1DELA 3UMBA 3LLOA 3B70A 3BWXA 5HTOA 5G0UA 1Y4ZA 2JBAB 4ND6A 2DRIA 3WKBA 1SXJB 1VHDA 3RSHA 2WP8J 4D9KA 1W76A 1WXWA 1EIZA 2AFHB 2P62A 1NRXA 3T7JA 3T4PA 3I9FA 4RPGA 5CFRA 2ZPTX 2JLBA 5CDUA 3OBIA 4BN5A 2UV8A 1FJXA 4PAWA 3QK7A 1ZD2P 3BWCA 2WF7A 1D3AA 2GO1A 2GKGA 2MDTA 1M34A 2GLUA 3KKOA 4GI1A 1EX7A 4PHFA 1T4CA 4TUYB 5C8YA 3H4IA 1R6XA 2ZS8A 4IOMA 1CJBA 5FPHA 1PD0A 2QVYX 4PM4A 3LBHA 1DUIA 5J47A 4JLPA 3E9ZA 1FDTA 1JFTA 1DX4A 1SD5A 1II9A 4FE7A 3RLIA 4I3HA 4JUIA 3G7SA 2IRWA 2D8MA 3ZX5A 3FXAA 1C7RA 1UMCB 1KOFA 3GCDA 1SOUA 3LUKA 4NESA 1Y3BE 2PQ0A 4XPIA 5CH5A 5LQUA 4WWHA 2JLVA 1HR0B 1VGRA 1DINA 3OJEA 4I4TB 1PR4A 2JGEA 5JECA 5KTYA 1RZRA 3A1VA 3L8GA 3CUUA 2HZBA 1Y3CE 2DB3A 4NYJR 1OILA 121PA 1XA4A 4P4NA 1AM4D 1KR2A 3PUVA 4B34A 3N2GB 4I1PA 3E0XA 1BU8A 2Y1KA 2VLIA 4Y2HA 1YTUA 1RVV1 4EA7A 5KJ1A 4RY8A 3ZU3A 3DE0X 2JIZA 1MB4A 3GFQA 4K88A 1FLAA 3WNDA 2WWXA 4UZFA 2E4YA 3GDHA 4G1FA 3G9XA 3MW8A 1UOPA 2AYZA 3G0DA 1DU4A 3OIYA 3QBEA 4G36A 4IMJB 3RO7A 1JXAA 1J1UA 2RG7A 1Y34E 2HCTA 4ZHQF 2IY9A 1O2DA 1FB5A 2LP4Y 3L4BA 3TO5A 2FLWA 4GMXA 1ORRA 9GPBA 3OPYA 4EPXA 1T91A 1XVVA 3PR1A 5GV7A 4F3CA 1CJSA 4BAZA 2UZ1A 3OM9A 1LBHA 2WU4A 2QQFA 1COWA 3MMSA 1FS4A 2PVSA 2WTMA 3ZHSA 5M2QA 4CG0A 1G17A 5CX4A 2P40A 4BVFA 3AV0B 4NQRA 2OO5C 1XPRA 2VWGA 2QVLA 5ECWA 1KXZA 5GOTA 2ZJ6A 3IEIA 4HQOA 2D2IA 2FDXA 1Z6AA 3KR0A 3CEAA 3F9CA 3B36A 1TKCA 4JLDA 3E7FA 4WI1A 2MJLA 1CPYA 1XZCA 1DIAA 2P8JA 3HK2A 2R7AA 5DYTA 4MRAA 5T8KA 3KQLA 1XJ0A 4LQDA 1KYZA 4MO2A 2XB8A 3O8OB 3HXKA 3K53A 2BGMA 4UFPA 3LNCA 2QPTA 3B2NA 1X9GA 3LQKA 2ZSAA 4MJ3A 3S0JA 3EMDA 3OC6A 4ZOQI 3M1YA 3RJZA 1J97A 1FPMA 2Z3ZA 5FTWA 4AN1A 2F1IA 4NFSA 4EHHA 5HVNA 4WFKA 4FIZA 3MT0A 4OGLA 1NPDA 1LQ2A 1Z2OX 3BH7A 3K31A 1AZTA 4KVAA 1ZVJA 4OFWA 4TWRA 4E4RA 4DR5B 2YICA 1XD2A 5CLHA 1JXQA 1I1OA 4MPPA 5K2OA 3T95A 2XE8A 3CWZA 5HOQA 1Q77A 4I55F 4Q4HA 3BQ9A 1N9GA 4E2ZA 4E46A 4E7PA 2X5JO 2ZUEA 2LGJA 3BDAA 3OJXA 1QFSA 2INGX 1XVAA 4U0KA 5IWAB 4ZP1A 1MC4A 1PX2A 2RKWA 4M37A 2Z2XA 4MV3A 2FSPA 1PJQA 2PAFA 3E15A 4PPGA 5KNBH 2CVFA 4UE3S 3CKYA 1BXZA 1JP7A 3DVAB 3KVOA 4Y7DA 1IRIA 5HF9A 5JD3A 4BNDA 4URXR 4DCVA 1MR3F 1WTCA 1JPVA 1YBHA 3CW8X 3GDGA 1U3GA 4Y9UA 3EIUA 4L2IA 4HNHA 1INLA 4CUKA 5AW3A 1HQDA 4L4SA 1M33A 1TVKB 2Q7XA 3ELWA 4N3GA 3DAYA 3WLOA 1DZIA 2OECA 1N8NA 1UJ6A 1Z7EA 4FPXA 1LFAA 1VYVA 1FXWF 1A5AB 3E9QA 1GDDA 4CKWB 2PZMA 4K9DA 1VIYA 3W5SA 5DP2A 3FSJX 4YN3A 3NNNA 5A5VA 3I42A 2Q8PA 4J91A 2GASA 4UE6A 2YV3A 4BQIA 3ADDA 1MEOA 5C5EA 1A69A 3K9HA 3JAWB 4OHRA 4Y2VA 1NA5A 4YREA 3QYFA 2YRWA 2CUNA 3KTAA 1VI6A 1U2QA 1Y9EA 3BSYA 1VJTA 3NR2A 4V3CA 4XQCA 4JYZA 3VPCA 3H18A 4K9QA 1O8CA 4QJIA 4OHFA 4D81A 4LF9B 1H1LB 3FPLA 4B3DA 2DQZA 5F2KA 4QBHA 5CH3A 2BFAA 2CSXA 4KEAA 4GWLA 3SYKA 1EAYA 2HU5A 4Q3NA 1EE9A 3MAAC 4LC9A 4KQ2A 4M60A 1TDJA 4N54A 4UJ3A 3HR8A 4GI3A 1KEUA 1K68A 1VOTA 3UMFA 3KYDB 4DWWA 3KZKA 3ZQKA 1PN3A 2C2YA 3OFND 3K1TA 4FMBB 4ODIA 4TXJA 4I5IA 1GPKA 2AN1A 2VPYA 3GGDA 3QKRB 1XDUA 4DBVO 1YQDA 5ALDA 2EZ9A 2FEAA 3AO0B 3BCSA 1JF8A 3ETLA 4NECA 2NTJA 3OX3A 2MIIA 4P82A 2B20A 5IN5A 1ZK3A 3C7DB 3DPUA 1MHPA 1S2MA 2IS2A 4A10A 2PYIA 1GV1A 2ZS9A 2MT9A 3S8EA 5DJ5A 2JI4A 3I9V1 1J1IA 2WWVD 2CT8A 1OD6A 4URVR 3NUQA 3RBXA 2FKAA 2GD2A 4IIHA 4QXRA 1P0MA 2W2QA 3FZQA 4UFOA 3UCEA 4RS4A 1UFQA 2KKUA 1NQUA 4CE6A 2PGXA 4IGKA 3ELBA 4LF8B 3K94A 1J5EB 3D4LA 3MM4A 2BFCB 4RA6A 3KWMA 4J1TA 5ENVA 3ZWWA 1FIUA 1SUFA 3GUCA 2PUDA 4HMOA 2UDPA 2Y3IA 3T52A 4B81A 2BGRA 4F3TA 1JT2A 1E2BA 3R09A 5EUQB 3FAZA 4KFCA 4JI6B 2HQRA 3R41A 3QE4A 1IEQA 4ESEA 3IRVA 5K3OA 5J9FA 5JXGA 4BDSA 3RC8A 3EPLA 1MH9A 2AW3A 2C3OA 4L5CA 4QUGA 4UBIA 4D02A 4ZICA 8MHTA 5TQ0A 1KEEB 1M6EX 3IP6A 2IU3A 4F2WA 1I4TD 3EUWA 3O47A 4TRNA 3SC4A 4EUHA 1SBCA 4I9UA 1YE5A 3WGHA 4K9LA 3RRXA 4TWAA 3GUUA 3QU4A 3FWYA 1XJ5A 3ZX4A 2NX2A 2B1IA 4P5DA 1TPYA 5IDQA 3AEKB 1H8HD 2P1ZA 3IOEA 3JQBA 4H6XA 5JD5A 5LP6B 2ZWIA 3F47A 2PFKA 1VB5A 4K87A 4QQNA 1Y0BA 3HCRA 2B0JA 4RVUA 2A67A 2NTNA 3JSAA 2OKCA 3B2QA 1ZE2A 1ZAKA 2GBFA 2X6QA 2ZATA 3GRCA 1BCSB 4REQB 5K03A 3JWEA 1DG9A 1DPFA 3DHNA 3F49S 5ICGA 3M6VA 1B41A 2K7ZA 2A9VA 1LUAA 5EJ6A 1K6MA 3RU2A 3OA2A 1TK2A 1GILA 1UPTA 2G4CA 5L3ZA 3SQNA 1J2JA 4BLSA 4BX9A 5A3RA 5HPYB 4LF5B 1BDMA 4OK6A 3QVGA 4UM7A 2GILA 4R3UC 1ZLYA 2Y1EA 3B7GA 4NNJA 4F4FA 1SVOA 2PWYA 4HEHA 5AHRA 3RYTC 1OUMA 1OZFA 5EXPA 4BFXA 1HDZA 4WFJA 2JZOA 3AFHA 4ALIA 1WSBA 1D9ZA 3S4YA 2KMLA 3O95A 5C51B 3GLRA 2Q4RA 2AHRA 3WZMA 2ZU0C 3SFTA 1H8ED 3MPOA 4LS3A 4D97A 3NHMA 2ZG6A 1MTZA 3WAGA 2OZKA 4LYYA 1BA2A 4GSKA 2P3OA 3TIFA 3QYPA 4PPFA 1EBFA 2P0EA 4QOFA 3MXOA 4U2DA 5J2UF 2Y77A 4OHCA 1JDZA 1NJ6A 2EKBA 4W9NA 3MG9A 4WCVA 2R0QC 2YBEA 1QF7A 3V46A 1IVNA 1DO0A 2FLKA 2YMLA 1GYPA 3EEIA 3QX7A 2WUEA 1J70A 1S1MA 2VUTA 5F51A 1QHHB 3I83A 1FNSA 1UP6A 1X7YB 1TIBA 4D98A 2QM7A 3D3WA 3GO4A 1G63A 5AW6A 5L3QA 1H66A 2F55A 3JRWA 2REQB 3BC1A 4KXWA 2EZTA 3QX9A 4PV7A 3GF4A 1KOGA 1OV4A 2CDNA 3JALB 4LWPA 2QRGA 3MINA 3OPVA 4M54A 1ULZA 3TLAA 3MSXA 4DCCA 4UEQA 4RMGA 5TJ9A 2QTWB 3GFOA 2Q6KA 3OY2A 4JH0A 4II3A 3WNQA 1E2PA 4K9SA 4L57A 1ZINA 4RD2A 2POQX 5LQAA 2OGZA 1GO2A 2YN4A 2YNMC 4WCFA 2G08A 4WZBE 4GDMA 3RYIA 3ST7A 4BMSA 4TTVA 1BHJA 3LBAA 2ZJ8A 3SBXA 1Y4SA 3BBPA 1J8VA 3WLFA 1P9LA 3AUFA 3H4TA 1JEOA 2PVCA 2ZRHA 2XCSB 1D8TA 1C9EA 2EF1A 1ANKA 1VJRA 1UMBA 1P74A 2KHZA 2WM9B 4RC9A 5E2AA 1VPVA 1K0FA 3FFBA 5H02A 2QMQA 3U1TA 1C8KA 1RLIA 2GN1A 4KDEA 2BZSA 2YWHA 1EWYA 1Y33E 2XJ4A 4L3WA 3VKUA 2A58A 5DRYA 1XNQB 2WVHA 4YQZA 2ZBDA 1H4TA 2IC5A 2OQ2A 4MKZA 5E4TA 2OYSA 3SPXA 4UTPA 1ZKMA 1B7GO 2VZ8A 1FMFA 4CN8A 3FOAA 3P9SA 1A72A 4JUFA 3SHOA 4AJ1A 2B8WA 1G5IA 4RZIA 5IVDA 5ESDA 2BGIA 4EB8A 2IE8A 5FBRB 3HM9A 4PHHA 3U4DA 5CDTA 1ACJA 2E6KA 2V6JA 1WQ1R 3A1CA 3AY3A 3DLIA 1ZH2A 3H5NA 2H08A 4K6KA 4RXMA 2W42A 3K6SA 5JI3E 3Q10A 3NC4A 4O3MA 2B5OA 1T5TA 1WBBA 1NW7A 1N0IA 2Z8YM 3RC9A 4Z51A 4QXPA 4BFYA 1DBQA 1R4ZA 4MW4A 4A8HA 1U2SA 2DT8A 3OTQA 5EG5A 1XIVA 5C1IA 3ZTWA 2H8KA 4MA5A 5AI5A 4QDOA 7YASA 4EL5A 1BUZA 2D8AA 9LDBA 3DMHA 1H0KA 2XNDD 4YAOA 5J4YA 4Q93A 5AW9A 4ENUA 5DTRA 1NVDA 5FOUA 2XNCA 1R9GA 4TL7A 2AN9A 2D74A 2O2CA 4PX9A 5DM4A 2WF8A 1NRIA 3MMZA 3OLCX 2NUTA 2F8LA 5L51A 3CR8A 3PNMA 1PJCA 3H1BA 2Q5FA 1KKLA 3ZHRA 1CLUA 1CUBA 4DXAA 4PZZA 2DF8A 4KRFA 3WQBA 3K0AB 1XE3A 5CVEA 4ZQFA 3AR6A 2FPIA 3JASB 4P81A 3OZIA 2XRMA 2GGSA 1T3HA 2QY6A 3O1HB 4X63A 4YT5A 4H77A 4I4LA 1N78A 2R8XA 5BVGA 1KWGA 3NT2A 4GI5A 3R9IA 1PQUA 4J8PA 1D6JA 3SDBA 4QOSA 5CTJA 1OFGA 4RPHA 1QQ7A 2W0MA 3Q6IA 1GUAA 3LBYA 4I5FA 4L15A 3ND9A 1OX4A 4Q34A 5K0CA 4RGQA 2NG1A 1YZFA 3A1NA 1GPUA 4GGMX 4GRDA 3V4VB 1IFXA 3GRUA 4DPKA 1AV6A 1U65A 3WJ7A 2WOJA 2EP7A 3HVRA 3OPYB 4M3NA 2R6R1 3F5MA 4Y2YA 1AXGA 5H80A 1WMSA 4F1WA 2ZM6B 3C6MA 4KZPA 4M0UA 1M1XB 2A3RA 1Y8CA 3ZKWA 1A82A 3FFXA 3DKIA 5K4HA 3I2GA 2DQKA 2O8DB 1IG0A 4UUPA 2G0AA 4DB2A 3LVBA 1JBQA 3VYTB 4RJLA 3IPLA 1OROA 2VSQA 4MNTA 3O83A 1W36D 2C4KA 4ZOAA 3T9AA 2G77B 1GR0A 4LEIA 4YCMA 1OXKB 4UUMA 2PKYX 4KQ6A 4LXQA 2RRLA 4D44A 5AM0A 2WDZA 4UXIA 4FIDA 3AR3A 3LLCA 2JHGA 5IBRA 2R96A 5BV2P 4F1JA 3JVEA 5BUCA 2O8FA 4XYEA 2YV1A 1WCIB 4PGAA 2ERCA 1SKYE 1UMCA 1E1QA 1ES9A 1NJ8A 4QQKA 3H17A 4ZCPA 5J4HA 2V7XA 3LQYA 1G21E 1G6OA 4B6JA 2Y9PB 1JEJA 3P2OA 3N53A 4IDPA 1Y9ZA 3UNXA 1O03A 3IQDB 1AK2A 4GI7A 4CTMA 2P9YA 4W7HA 4UUAA 4WXRA 4AMGA 1PWEA 4QUJA 1V0JA 1ML4A 4C07A 1WXXA 1KPIA 4FR5A 1R9NA 2YRXA 3TSYA 3N8NA 4JIGA 3ZQUA 2XKJE 3KP1A 5HS4A 2DBYA 1DUVG 4MS3A 3PYMA 4M6WA 2PO7A 2ZE5A 1G1AA 4IUYA 4X65B 1TK3A 2YCBA 1ODSA 3B6ZA 3H2SA 3QMPA 3P1JA 4BTEA 1P77A 2O06A 4MQBA 4PW0A 1JG1A 2VJPA 5CYOA 1EQAA 3IL2A 4QDTA 3RRJA 1EXWA 1JILA 1ZU5A 1V5FA 1WS6A 2R1UA 4YV7A 2C9OA 3EUEA 3G8YA 3ZCUA 4U63A 3G2KA 4HXFB 4JZKA 3GLTA 4G5QA 1VCIA 1OWMA 3K2BA 4J0JA 2JASA 1EAMA 2QI9F 4DA8A 3IP9A 3SN6A 1RYYA 1XEWX 3TLBA 4LJ6A 2WJZB 3JU4A 3QNWA 3QEMB 4Q1AA 1TZMA 2J7KA 2Y0DA 1SXJE 3NBFA 1LVUA 4HGPA 4KE8A 5JJ5A 1RYFA 3NAZA 4Y9RA 4LDJA 3STHA 4PEVA 4ZYTA 2E2WA 2PS3A 3P27A 1EINA 1GUYA 4CIDA 3ZZ0A 3ODPA 2O52A 1A8SA 2NXJA 5AJHA 2Q2OA 1G2IA 1U99A 4IRXA 4L76A 1U80A 3L6UA 4DLAA 4EG3A 3DXZA 3KEQA 3BA6A 1E3WB 2WTNA 1DRKA 3WNZA 3T61A 1B42A 4KWTA 1XNHA 3F8TA 2VN8A 1OAOA 1G38A 4JUDX 1OT5A 4GLLA 4DSUA 4FGJA 4DY6A 5K6TA 2UUPA 2WVGA 3VPHA 2IOFK 3RTDA 1E1YA 1D6MA 2A7XA 1B0AA 1KYYA 1IHUA 2QROA 5I3ZA 4ARCA 4IIYA 4WK4B 3AETB 1NYRA 2V7EA 4BO6A 3S6JA 5M34A 4IP0A 2C5EA 4G2NA 5T4FA 4R2JA 621PA 1PTJA 5SYNA 3ZCSA 1KK3A 1TC2A 1YQUA 2GDZA 3N0WA 1C14A 3BE5A 3MJEA 3OH8A 1G41A 4FKMA 4KR0A 4S0ZA 3EYAA 4L28A 4Y1FA 5F2EA 1VIVA 3D6FA 3JQFA 1WY5A 4AMYA 1V7ZA 3QVTA 4R2LA 2C2WA 4C14A 4GC9A 4WXEA 1W2WB 3EBOA 4GZ5A 1KY3A 2G70A 3H5WA 4FSHA 5CAEB 3ZWXA 4M7OA 3ZHVA 5I8WA 5JCPA 1WU7A 3DKKA 4F86A 5A04A 2J48A 5JU6A 3MINB 1K6EA 5EUCA 5ESRA 5B3AA 3A4LA 1R0SA 4KREA 4DQLA 1C3JA 2BFBA 3IAXA 4KYUA 1XCJA 1GAXA 1CETA 1EVIA 2TMGA 5I7VA 1NW6A 1NUAA 2HU8A 1S3IA 3L6BA 5B1HA 1ZVMA 5HKAA 1M5UA 9LDTA 1YMUA 1T1EA 4K6MA 3TMAA 3IEVA 1U8FO 3QEBZ 1EFAA 4IG9A 1TEZA 3OT1B 4D8XA 3FWHA 1OXSC 1ESNA 1QIMA 3BIJA 4XVHA 4YP5A 5DNEA 1R10A 4TZKA 2ZJAA 2O8VA 1BKYA 4MRVA 2HW8A 1W36B 1QIGA 1DRJA 1AGXA 2XB4A 2DWOA 2NU7B 2ZAGA 3LX5A 5DBOA 3LLUA 3EAQA 1DC3A 5D6NA 3HTXA 1NFRA 1JHZA 1QLJA 3U3XA 1E61A 1H2WA 3DUPA 3S81A 4LRUA 3I92A 2P9EA 3ZR4B 4Z0PA 2EU8A 1IOZA 4YK7A 2G88A 5BQXA 2IYQA 2WE8A 5LLDA 3R3SA 4UCQA 4PFJA 1DIHA 3SQMA 3GARA 3ET4A 2AI3A 2GZAA 3I5AA 1DCMA 3MJ4A 3W5AA 1ZBOA 3KX2A 5HUJA 1ETUA 1JI0A 1H6DA 1P3JA 1UK8A 3EQ2A 3MMPA 2FQXA 4FGZA 2YL2A 2ROQA 3THWB 4WK0B 4DLKA 1W7AA 1O3YA 1TEXA 4E32A 2H8GA 3KXLA 1NY6A 7GPBA 4DGHA 3E9NA 4LRTB 3OI7A 3UMMA 5HILA 1T6NA 1IOLA 4WY8A 3BG5A 3BFJA 4UTXA 5K3CA 6REQA 5F64A 2HSWA 1J00A 3E4DA 4JU8A 4MV5A 1DG3A 2DR3A 3UZUA 1U3CA 4YRIA 3WS7A 2QGZA 3A4NA 1C50A 4GVXA 4Q4AB 3C16C 4MS3B 3ACDA 1IOWA 2OK7A 2J9FB 2YXPX 4CKBB 1CVLA 4MW1A 5BPHA 2W58A 4L72A 3CUVA 1XF1A 5E1DA 4CMGA 1NP6A 1N6IA 4DR4B 3V3TA 1N7JA 2LKCA 4NXNB 4GMFA 5DF1A 3PFCA 2VH5R 3QUCA 3FBWA 3OMWA 4KXNA 2CC2A 1Q3HA 3VC1A 2H18A 2YC2C 1RM4A 3L6CA 4WGGA 4N5HX 4OXYA 5EPEA 3O21A 1ZS9A 2X9GA 4YJ2F 2VQEB 3HPRA 3QU2A 3JYOA 2XCIA 4BY9E 2XX3A 3Q5GA 3WRYA 2YHUA 4DMCA 5CG1A 4OBEA 2C5LA 3HEBA 1B8UA 1IHOA 1X8LA 1VL0A 3CJTA 2DTDA 5JDCA 3PHHA 4RX1A 3PFKA 4BFTA 2NW6A 4BECA 1DL5A 2GYYA 5JOQA 1EFCA 1F2DA 4LV8B 4C20A 1U63A 2ZPUA 3E2PA 5JI2E 2IPXA 2W83A 4CI9A 2YZ7A 3OCWA 2IH4A 4YRTA 5J4LA 4U5XA 3L1IA 2NU6A 4F56A 4HDSA 4BCCA 1SUCA 1X9IA 2RB4A 3O84A 3PRKE 3QPBA 4O08A 3SZGA 1TU3A 3CO5A 1VE7A 5EMNA 3DR3A 1FY2A 3GMDA 2EGUA 3M5PA 3O4HA 1S6YA 4HUQA 4IVPA 2FN9A 3UFXB 4C2AA 4PZ0A 3K92A 4JB8A 1XTJA 3SMQA 1PQWA 2BEUB 2G0NA 2NUPB 2XUKA 3U3JA 1ISJA 1MABB 3RVPA 4BVBA 3R4CA 3RUEA 4F45A 4DDWA 2C7BA 4BRUA 3F73A 1EUDB 3T5DA 1NKTA 1EX1A 1MQ8B 2DBZA 2DZDA 4GSLA 5IDWA 4KAFA 4E5PA 2HT6A 1SBOA 5JTUA 3O2SB 3GUZA 6NULA 3QKRA 5T6MA 4GOOD 1YTLA 1SXGA 4A8JB 2K6GA 2DULA 4ZO4A 4GQBA 2M32A 3RADC 1D4OA 1YV9A 4MV4A 4WN3A 2AXQA 1C4WA 4R6WA 2PL9A 2A84A 4Q9AA 1E89A 1JDBC 1RI1A 3I53A 2BTEA 1BHSA 2JH3A 1JHXA 4OJNA 2OQRA 3G2HA 4L02A 4WJZA 2CZGA 4KPFC 4QTTB 3O7WA 3ZWNA 1WOYA 2J0UB 5F7XA 2B4KA 2YJGA 4CEIA 4Y9SA 1N2SA 4CIXA 4I3FA 3EIWA 1LV7A 2MSEB 1E1LA 4EPTA 1U0RA 2PUHA 1JAHA 3HCDA 4I99A 3RSQA 3W3ZB 5A4JA 2PPVA 3FOFC 3OOHA 2AG6A 4G1EB 2YWRA 1SHZA 1NT4A 4IGEA 3D7RA 5I7WA 1AO3A 1Z15A 2C0CA 1PUIA 2O8NA 4Q0MA 5F3RA 3K05A 5DYWA 4I2VA 2OV2A 1UM9A 3G7UA 1SFRA 1WW2A 3VYUB 3ZNQA 3RS0A 2XF2A 5FFNA 4YPOA 5C81A 1XD8A 5IKMA 3DLHA 2O1XA 4DQDA 2WPDD 2QY9A 1DIRA 5C7OO 1L1EA 2VVTA 2J6CA 3D2CA 3ZV0C 3DOHA 3A9UA 3GAAA 2ZJ2A 1KE2A 2RBGA 3P26A 1T2UA 2QDKA 2B7BA 2Y1WA 3INNA 1SXPA 2EQ5A 4MQEA 4MRSA 1I9CA 2GJ9A 3W2HA 3AHJA 5EUWA 4BFZA 4IKEA 5JO0A 5K0FA 4XTCS 3HJYA 5KOYA 2WG2A 2EJTA 3QY9A 3V1YA 3K0CC 4LPKA 3C5HA 4HUTA 2NWQA 4C29A 4CBVA 5IF9A 4ARUA 4TV8F 2GEJA 3D4NA 2BR4A 2XZTA 2QZ4A 4CU5A 4MPTA 5EP4A 5EJAA 5FJJA 1UDBA 2GNPA 2ZYVX 1ZH4A 3QV1A 2IZZA 1LPMA 2IBTA 2PSJA 2ZYWX 1XKQA 3FLEA 1IN6A 3ILVA 4I50F 1NMQA 1FFGA 4JJFA 4U2BA 4TQAA 1SOVA 4K9OA 5HQTA 2VSOA 5C53B 3CZAA 4KDFA 2QN2A 3DW3X 5AM4A 2ZWVA 1IH8A 4FFOA 1W48A 3O31A 2UVPB 1WXEA 4L5YA 4MH0R 4IQ0A 4MLZA 4U4AA 3THSA 2UYYA 3O8OA 2VZLA 3DNMA 4L95C 1S8OA 1U04A 3ZV5A 1RI5A 2F00A 1J8QA 4KFUA 1ZD3A 1JR3E 4KK3A 4WUVA 5ALOA 1X1CA 4H6WA 4NFHA 3LMKA 3LUCA 1BHQ1 2JFXA 2DG2A 4R54A 5FADA 3ZY2A 2B4TO 5IUNC 2Q7OE 3MTIA 3FFWA 3OOWA 1I0LA 4HADA 3N2EA 3WHLA 4EF4A 5L7TA 2CFOA 4A8JA 2BCEA 1MPXA 4N6OA 5L3QB 2W0SA 3F78A 4J0KA 4EQZA 3VAZA 1Y8RB 1M0TA 3GZ4A 4BGIA 1ZDMA 2VDMB 1Q1GA 4UEWA 3G0IA 5IVIA 5CB4F 4E03A 2NYRA 5KNBA 1DQPA 1PFGA 2OO5A 3W9YA 4G0VA 4UHEA 3EZYA 1R4AA 5G1OA 2F1OA 2AL7A 4N65A 4RQAA 4P1ZA 3RH0A 4LCBA 2J5VA 1SCKA 4DY4A 3VR3A 4MVXA 4BWFB 1QGUA 1N32B 1PG0A 4XOUA 3E7PA 1OFUX 2JA1A 3OZXA 2WTBA 3F3SA 4F9GA 1NIPA 4TLBA 4AKIA 3OCYA 3OMXA 1IRXA 2AV6A 1CNEA 3HSKA 3H2JA 5C1OA 3LDHA 5HRAA 3KSDO 1RPNA 1AURA 1XHLA 3NATA 3LUBA 1IHPA 3OOJA 1WDTA 1LW7A 2QV7A 5HIIA 4QDXA 4CIVA 1G7SA 5K6AA 3TK1A 2WJIA 2IDMA 1SWVA 2EKZA 4QT0A 4AZ0B 5CEEA 1MJNA 2QI9C 3VXKA 3CNEA 1P1RA 2GLTA 4PFSA 5D1HA 1GFSA 2H1IA 3GHFA 4ASUD 2EWWA 1ZVKA 3O9VA 3LQ1A 5L53A 4HNRA 3PUIA 2AG1A 2VUHB 4GR9A 1V11B 1F0NA 1GGEA 3NIDB 4G09A 4L27A 3E8SA 4WKPA 5B1SA 4NE7A 1L8LA 2I4MA 2IFTA 1HFJA 2KQUA 2OMEA 3F2VA 2HUNA 3HLYA 4PYQA 1QH8A 1PDVA 1SMKA 4O2RA 4QRDA 3GN1A 3HJBA 3VSBA 1ICEA 5D1NA 1RAIA 4RPKA 1PJBA 1QVRA 1SK9A 2AJ8A 3IHWA 2ZBQA 4YHBA 2CUKA 3RIHA 2AE2A 3DHVA 4HLQB 4ICIA 2OHFA 4WZBB 2XMCA 3QUBA 1MGPA 4K6OA 4EHNA 3U7FB 3CGWA 4H1VA 4OI2A 4B6PA 4BJ5A 5J1SB 3W8RA 3ZD9A 5C4IA 3PTLA 1JLLB 4NU5A 1YQTA 5B30A 4FMDB 4A6EA 4EHAA 4FGUA 1KEEA 3PIRA 3R5HA 1Z2CA 2PGJA 2RDMA 2XV1A 5J2TA 4CMIB 1KH1A 2JCSA 1U0OC 4PO9A 2XE4A 4HTAA 5SZIA 3IELA 5IJ9B 2RK3A 2EHDA 1LSJA 4AIIA 2IH2A 4IJQA 2ZYUX 4R51A 5AM3A 2PMBA 3EXAA 2GJ4A 1ZC3A 2ZS7A 1J39A 1FYEA 4ZYUA 3F4KA 3JPYA 2A33A 1MO4A 3N6VA 5EZYA 2C7QA 5H4GA 3IT1A 5AH0A 1JQKA 1JXOA 1N6DA 2GD6A 5BSRA 4ZYZA 3EX7C 2X5NA 2RD2A 2YN0A 4RF4A 1QVWA 2APOA 1QSGA 2GEVA 2ZUWA 3DFZA 3PXUA 3BPSA 3SBDA 4EMUA 1DHTA 1E2NA 2D1TA 4OQYA 2DPYA 2IHZA 3JQ7A 1MRNA 3PX2A 1C3OB 1FMJA 3JV7A 4P9NA 2JIMA 3PSAA 4U9UA 5CJ2A 3I32A 5CT6A 4KRGA 5BQPA 3G8CA 3ZDQA 4EENA 5B1EA 3G49A 3H8JA 1UKZA 1XALA 2B1QA 4RULA 4MW0A 1M67A 1DJNA 3BJZA 3R74A 3VPDA 4BBPA 1YVDA 3GLFE 4TROA 1REQB 4HSGA 3JVUA 4WSOA 4YDSA 3SKYA 5GMOA 5IAJA 1KP3A 1O1YA 2LBPA 2SKDA 3P32A 1YOVA 3O8QA 2I33A 2RH5A 2WSSD 2V3CC 1UBHS 1W5EA 4MV1A 4BO8A 3WIBA 4Z0HO 3TVTA 2YIVX 1HFWA 2FE4A 4WOJA 3D1VA 4Y6LA 4EMTA 1I4OA 4ZEOA 1V7CA 1N77A 2HJHA 3BUSA 4C3ZA 5IG2A 1E7MA 3E9YA 4XARA 1M3SA 3VOSA 4BJ3A 3T5BA 2BN4A 1RJGA 3QBVA 1PS8A 4XKJA 4EBFA 3NVAA 4D8VA 4CRWB 3BMNB 1UIMA 1PV4A 4OB6A 4H27A 3DLCA 4GUAA 2R68A 1L1RA 3R3YA 2IYYA 4DJTA 1X8XA 2X14A 1Q1AA 3A0RB 4PPQA 3TNLA 2BSQA 3N3BC 2OTCA 1UOQA 4LHZA 5BV7A 2CXQA 2IBSA 4OY3A 3MK31 4Q1CA 1KSGA 1H23A 5CDYA 5IM4A 5ER6A 4U2GA 5TEWA 4OBXA 3DLTA 4UFNA 3IQEA 3CUSA 2PUBA 4ZGGA 3PA6A 2HCFA 1X0VA 2IYLD 4OQMA 1S04A 3SXPA 1GTG1 2OORA 5ALJA 1L8AA 3UAWA 1UKYA 4F9EA 4C0JA 1MOSA 2YFHA 2AYXA 4HATA 3L3BA 1RZVA 4GICA 3IHLA 1ZCFA 1F06A 4L9SA 4ESVA 1XLVA 5EUXA 1R0CA 3V8PA 2OHJA 3UAYA 3AM1A 2R7NA 5DHSA 4XB6B 5ALZA 2YINC 3S44A 3TXAA 3DZGA 3GLVA 4Q4HB 2ESRA 2IYEA 3H5VA 5CB4B 2H65A 4NABA 1BGWA 3D8BA 1CUIA 2BP7B 5DO9A 3FCSB 3U3RA 4F85A 2R7LA 3ENZA 2B36A 2BM0A 5EE5B 2O6HA 4FGWA 2CK3D 4DC9A 1YQWA 2YXEA 2HIHA 3RV4A 3W7VA 4AY6A 5J4KA 1JAXA 4K3VA 2NPFA 3W8DA 3IMGA 4OYHA 4S12A 3MWYW 3H75A 2BFFB 1A1VA 2NSJA 4H1UA 3GZNA 3MOSA 4DPLA 5JISA 1T4DA 5A4DA 3KWLA 3HKEB 4L8KA 3BF8A 1JHMA 1HXHA 5AKGA 1R0RE 4C06A 4MDYA 3DDWA 1QNFA 4DA4A 1AUOA 1Y1PA 4AZSA 3HCBA 4Y1RA 4Z0TA 2R48A 2YY5A 3M4NA 2WJJA 3M49A 1LK0A 1QIHA 1TI7A 2QRQA 3G9ZA 3QHQA 4HLNA 4NICA 3ZQJA 2V59A 5DMHA 4IRUB 2BFMA 4Y1RB 1GAJA 1KJJA 4KXXA 5J5CA 1XTUA 3RVMA 1WKCA 2D2XA 4JDPA 1HETA 1PT6A 2ZUDA 4C78A 4EI2A 3V8RA 3GIDA 1XDDA 5K3FB 1R4NB 4LOAA 4CTJA 3DP7A 2GVDC 2ZIGA 4YJFB 4EKIA 4MW9A 1EM6A 3LQRA 1I0IA 4KXMA 4DL9A 2BFFA 5ETJA 2AN3A 3VHRA 1MP0A 3RI3A 2BEKA 2BEVA 4CG3A 1KTIA 3VZPA 4ZMRA 2OCGA 4UNPA 1E2MA 4YJHB 1N6OA 3FNQA 3KG2A 4K0RA 1P6UA 4JJIA 4LJSA 4D3SA 3T0FA 3KLMX 5IYZA 1DOAA 2XB6A 2LWIA 1Z22A 4G0NA 2H2WA 4K9KA 2DE0X 1PNOA 2VCHA 3RTGA 5I4IA 1YU9A 3I6BA 1ZE1A 3O90A 1COZA 1TVEA 3W4KA 4I4TA 2WWRA 3R7DA 4P7GA 5BN1A 1NBAA 1IEWA 3R8CA 4BKUA 1C1XB 4W9RA 2CJWA 5CA1A 1AUPA 1R3DA 3B38A 1GD1O 3CEJA 1P1CA 5THXA 2ZEJA 4Z2AA 1QR2A 1JIVA 3PC8C 2WYHA 4QLAA 3X1KA 4FB4A 1KC1A 1YGPA 4WNAA 3USZA 4RDHA 3ZY4A 5D7BA 1B0ZA 3AK4A 1GL9B 2WD9A 2PMCA 1TTHA 1Z2AA 1ESZA 2FV8A 3M70A 2X1MA 3O92A 1BOOA 3KSRA 4CZ2A 2YVKA 4D5GA 2JAHA 1JDUA 3JASA 3LL4A 3GMSA 3MA0A 4YC7A 3CKKA 8ATCA 3K0AA 3QM1A 4G9EA 3M4JA 3GLIB 1AB6A 2PLNA 3S1AA 5HIJA 1TM7E 4Q1EA 4IAOA 1HKHA 1M5TA 2I6XA 5C8DA 2YDYA 1LLCA 3NOOA 2GYWA 4X94A 3U4AA 4FD3A 2FWMX 1XKTA 5KS2A 2KLNA 5IM5A 2R97A 3AHFA 1G8GA 1F0YA 1KFCB 3COSA 3LT5A 4XQGA 5ADUS 1KPGA 1TMYA 4GS5A 5K4GA 1RYDA 2VP3A 4P3OA 1OH7A 1TTPB 3FCAA 3AZOA 2HBZA 1RIIA 5ALNA 4DLXA 5BR4A 5JV5A 4AQDA 1CEXA 4G97A 4MCJA 5K1ZA 1FSSA 1CLEA 3TUIC 1RU3A 2DTEA 2RI6A 4DZZA 1TGVA 3DH0A 3R0VA 4XDZA 4LOLA 5IBQA 1KS2A 1DKPA 2I7VA 2BD0A 3FYUB 4GAEA 5A0FA 2CJFA 1PJRA 1CKEA 1RACA 2BC9A 1J8MF 1BW9B 1KYXA 2ZJ7A 1BH2A 4BKMA 2JLXA 3QMWA 3UW1A 4L6CA 3S7ZA 5AP9A 5GTDA 4QTUB 3MYYA 2HREA 4M0MA 1DFIA 4MUNA 1PEKE 4LC1A 5DTQA 2WHEA 2ANEA 3G0OA 4BNMA 4DNQA 4LNHA 1G291 3BULA 4N0EA 5HSGA 4BQSA 1NQVA 4GNRA 5FWYB 1KI6B 1JKIA 4ENWA 4F8JA 2GZ1A 1NATA 1F4PA 3RGWS 1GPJA 5ERGB 5CW1A 1H2BA 4AULA 5BVHB 1RBZA 3D6UA 3HLTA 2ECQA 2VJMA 1DC6A 2XOKA 3RU9A 4KPEC 2XWPA 4JEMA 4MS1B 3SSAA 3MTDA 1ORWA 1R3UA 5KYKA 3ZC3A 2CBXA 4V1CB 2WAXA 3F67A 3NANA 3WSVA 4BNIA 2RHCA 5I45A 3IVGA 2C4UA 4B0PA 2JEOA 2FW1A 2RB5A 3DBOB 3IAEA 3QUTA 4DIBA 1VDMA 2CMKA 2GKOA 2VXCA 5KTRA 1H4QA 1SEPA 1T9KA 3BJMA 1UKEA 3GCXA 4ZAZA 1JVBA 1T3ZA 2JHPA 2YCLA 1O77A 3Q40A 3DC7A 3OE7D 1ZD1A 3VHXA 3M4YA 4HNVA 3D02A 2WG1A 3LX6A 1WTAA 8ABPA 1XXLA 4B7XA 2D4AA 5DBGA 2QX4A 4OHKA 5DZSA 1GXSB 4RDIA 3EC1A 3ZYZA 4NBKA 4QA9A 2E18A 4Q9JA 4ZVTA 5ADHA 4CYMA 1Y6GA 1P2DA 4LZPA 3K0SA 2Q1XA 3PC4A 2KM1A 3QW2A 2C2KA 3E3OA 4DJAA 3URMA 1S2IA 4UCFA 1I36A 1JNXX 2FWPA 3W5CA 3EZLA 4H6PA 1KQGA 2TMYA 3CX7A 5GPBA 1KJ9A 2Q9AA 3ORRA 1AKNA 3AUYA 1YOBA 3IIKA 221PA 1A9QA 3PFHA 5BSTA 3EQ7A 1VHJA 2RJOA 1PVDA 5JQGF 1E62A 721PA 3OQ6A 4E12A 1QU3A 1C7QA 3CRQA 2A0KA 4M8LA 4GGPA 4YTEA 3VYWA 6Q21A 1XAIA 1QP0A 3KZMA 4QFMA 3VC2A 4XWGA 3T7KA 3QWIA 1FX0A 1TM4E 3IALA 1ZVVA 3QVGB 1Y6FA 4JJ8A 3ZHTA 1KAHA 1Z39A 5BSEA 2I54A 4OGGA 3K3PA 4NOKA 1THNB 2RKBA 3MTAA 3QNUA 1OOEA 4XCVA 1G3MA 2AG8A 2CUZA 2QYOA 3B13B 3B6MA 4G24A 4IHKA 1OW3B 4OIMA 4YP1A 3T5AA 3CLTD 5BW4A 2ATCA 1QIIA 2WD7B 4I2NA 2G0TA 4KH0A 4QATA 5FL7D 1D2EA 2FUNB 1QH1A 1XF9A 1GM5A 2D2VA 1T1JA 2IUFA 3K20A 2EIXA 4KAJA 3PITA 5M04A 4HH0A 4IYRA 2R751 4YRQA 5IAAA 3U19A 1R3FA 3WBBA 3GJ6A 3PCTA 5JATA 3QXSA 4HI0E 3RRYA 3GMFA 2PZLA 4PRZA 1H3EA 2JGLA 3MNFA 4DG5A 3RQSA 2X0RA 2ZT6A 2GPSA 1E6MA 1CJVC 3RG8A 1NXSA 1QS0B 1Z35A 3IVMA 1XYGA 2V0NA 4JJ7A 4F7WA 3LP5A 3L06A 4WEOA 4P38A 3TWOA 4I19A 5ALEA 5IM4F 1P19A 2F90A 1XTRA 4U0JA 4C0KA 2CK3A 1Q3KA 3KSMA 3KQQA 4MS1A 3W05A 5CTAA 1MJ5A 5FLYA 3L43A 3FYDA 4IIXA 2YWCA 3UT5B 1F4VA 1FXWA 3P2EA 1E3TA 1F12A 1WUJS 2HL6A 3CM0A 5EXEA 4ZI7F 2JEYA 2NPOA 2VJDA 4KO3S 4R1LA 4RA9B 1AKWA 2LKDA 1AHPA 1XZGA 3DMDA 1A2KC 1EGAA 1NN0A 4AQYB 1E66A 4QXMA 1Y8AA 2EFEB 5AYVA 5JS1A 2AN4A 2V54A 3HRKA 9ATCA 2FW6A 5DX0A 4ZARA 2MMGA 1R6AA 1U8EA 4WKOA 4URYR 4TMKA 3CCFA 2Y2VA 1L5RA 1JNYA 1X7WA 2AI1A 1DQRA 2ZRQA 1FNCA 3UMGA 1ZHFA 2H5EA 2PKWA 3PDWA 5BMVA 1XQ6A 2CV2A 1BVYF 3CG0A 3OP4A 5JRDS 1H2EA 5D3ZA 2WWGA 2HWWA 4Y2XA 2C4MA 1DZ3A 2Q9CA 3CZMA 5BMOA 1WXFA 4Q39A 2Z1MA 3WGZA 3KPWA 1DGQA 1CRQA 1GZ7A 2C8KA 1HBJA 4JUCA 2G28A 1VDZA 2HV9A 1V45E 2PWAA 1JIXA 3PS9A 1DEXA 4A92A 4CM3A 1DEAA 1P7PA 4LKOA 3AWDA 4ZOCA 2DERA 3GJYA 4H0CA 3ZJTA 4MUYA 2EEZA 2QMYA 4WADA 1O8BA 3KYDA 2XTMA 1CNFA 2DH5A 3AI7A 3C4VA 1PK8A 3NHZA 3VMMA 1OSNA 1EJ0A 2EX1A 4BBAA 1CUEA 1U1IA 1ZK4A 4PIMA 4WINA 3PXGA 5TGTA 5F5LA 4JL6A 4HKTA 2FPPB 1KL7A 5AW1A 3V4OA 3CLKA 3CPHA 1NJ2A 1UFOA 2B2CA 3ZGYA 2HO5A 2ZKIA 2X7JA 5G3ZA 3KXDA 3G5UA 5E8JA 2XIQA 4EL0A 5F52A 1L3CA 2LE0A 4IDEA 5JWRA 1N92A 2CXRA 4WZZA 3QXXA 3RDPA 4ILEA 4UXJA 4HZUB 1WXHA 2QG4A 3QUSA 4WXYB 1NM5A 1WLSA 2ZOAA 3G5AA 4FHEA 5EJ4A 4P98A 2JFZA 4C30A 3NXKA 3PG5A 5DNCA 1LD3A 1YQ9A 1VHQA 3BYZA 3FJOA 3RVDA 5D5PA 1SBNE 3B53X 1PU2A 5F98A 5J2TF 4D4IA 4L2IB 4GWKA 4N8DA 3SF8A 2XNJA 1R12A 1AOXA 1Y3HA 2JDIA 3W4JA 3GP8A 1YHYA 3QVLA 1SGVA 1WB6A 3WLRA 1SC9A 1YKGA 3C8DA 5ILGA 2P6PA 1GZDA 2HXSA 2ENWA 4LXTA 2WKWA 4DLSA 3O93A 3NEJA 4Q15A 2X0DA 2IOHA 4R31A 3R9XB 5B58C 2HV8A 3I45A 4DT1A 2YHIB 1Z6XA 1RBQA 2VPPA 2X8AA 1NKVA 2ZTVA 3GEHA 1AQIA 3VKVA 5KO2A 1C1HA 1HZJA 4W1RA 4A7PA 2OHVA 4CV0A 1GUDA 2A88A 3AJ9A 1YJQA 3L8ZA 4PSKA 5U9CA 2BCJQ 5F77A 4G67A 4D2IA 5G0VA 2HIGA 3UYLA 4HH4A 3LHFA 3WGTA 4E31A 2Q5OA 4JDUA 3WQHA 3IKTA 3CBQA 4D4HA 3ROZA 1RYBA 1SUWA 2YFKA 3OCJA 1XDSA 1QK5A 1TTTA 4OHWA 4ZO6A 2ZQZA 1ZG3A 3I09A 5KMGA 1L4MA 3GYBA 1ZJZA 3IAAA 3QPWA 1XCBA 1Z4QA 3AHHA 3O82A 4ZYWA 3NDRA 5KU1A 1O4VA 5EE1A 2H1VA 3W34A 3QKTA 2PHZA 4M1OA 2ONJA 3I2JA 2AC7A 3AQ4A 1BYIA 2W22A 4L73A 1YB5A 3T5GA 1JJ7A 1T4GA 2FUG1 3HKEA 4X62B 3IQIX 1IPEA 4X44A 1FVXA 4ED9A 2D7DA 5CP8A 2IYRA 3DA8A 4JENA 2O3QA 4JX9A 5EWMA 1K5DA 3SQLA 2E4XA 2XVMA 3B9PA 2XGOA 4P4GA 1GZ6A 1M8KA 1EFKA 1N7GA 2OAP1 2BOVA 3HCNA 1EA5A 1L5HA 1E2JA 3S28A 4R5MA 5UKDA 3OCXA 4L74A 1M6YA 1RBMA 1VP9A 4MVJH 2CY0A 3AUKA 2B78A 4LDPA 4UAUA 3O8RA 1RPZA 1U7PA 3ZY5A 3DDSA 1ZUD1 2PZAA 4CTOA 3CISA 2OAQ1 2XDQB 4U8GA 4O4IA 3AUSA 3KKNA 4JGIA 2LCIA 5CLJA 4CQMA 1QHYA 5E1BA 5KTNA 1WPXA 1AKQA 3AVPA 5IC4A 2QD4A 2CXSA 5IT4A 4D9NA 3GAFA 1T2VA 1YFZA 1SRRA 3CEHA 1BGVA 4F97A 3MGGA 5JAIA 1FUKA 2NAFA 2N46A 2VJBA 3LQQA 3TZBA 3UIEA 4K26A 4WH0A 4CG2A 1BN7A 2NADA 4MW6A 1S2NA 3I2HA 1MAWA 1YE8A 2IDKA 4E5YA 2H1HA 1ZFNA 4ESOA 2J3KA 4P7FA 4XRGA 3C1TA 2XBLA 2C9BA 5CIWA 5DGHA 2H1WA 1YJBA 2H51A 4AKEA 2FF5A 2GPBA 5IXJA 4DMHA 3VVMA 1LLFA 1OC2A 1UC5B 4R1UA 3LYLA 2ZRMA 2CYBA 4IBOA 3KKZA 1U3DA 5CM8B 1P6QA 2WKQA 1A97A 4NCAA 3ZDCA 2B3TA 4N0DA 4CFZA 2ERXA 3O9ZA 3E9CA 1Y82A 1YS4A 1PJTA 1YVUA 3HWRA 4GC5A 3V00A 2Z58A 4EI8A 3H05A 1E8NA 2P41A 4G0PA 5F4ZA 5K8UA 2A5FA 4YMUA 1GCAA 5AKLA 2M2IA 3T9DA 4DMGA 1YZ3A 2CHEA 2XE7A 3L9WA 4B09A 5LJIA 2EKPA 3FM9A 3Q7EA 4NZPA 1NONA 2CVHA 4EG1A 1W96A 3KPUA 3LQ2A 3RRNA 4I3GA 3IMEA 3NT5A 1HE1C 4WOPA 1IHDA 4DA7A 1BX1A 2M98A 2FVYA 2VP2A 3BMCB 1IPHA 2J85A 3GT7A 4QYSA 4IHJA 4XUEA 1VKHA 3C1AA 3HP7A 4NR0A 3UHFA 3DEZA 1NUTA 4BZZA 4S1NA 2BUBA 1EP9A 2VY9A 2IU0A 2RONA 1GTL1 1PZXA 3UGJA 2X8LA 2NIPA 2Z8YA 1ZGJA 3QOXA 4CGYA 3Q8MA 4HDKB 3MBOA 4L8GA 1HTBA 5H70A 1TF5A 1MX3A 1GY8A 1YZQA 3EG9A 5K0GA 2CNBA 3B48A 2PTHA 3I6ZA 1YF3A 3B85A 4EHBA 5DPMA 3TOZA 1CRWG 1JA0A 2G67A 2ENUA 2ZYHA 4D42A 5L8VA 1RQXA 2EX0A 2MMCA 1K3FA 2NZVG 3DE2X 2XODA 2CFIA 1CTQA 1D4ZA 2HWUA 1KF0A 1Z29A 4NBWA 3G2OA 4IJ6A 3LYAA 4O59O 2ZYRA 4TMYA 4PC3A 4DDVA 4FC6A 4NMXB 4LZWA 3OLWA 1M1NB 2FP4A 5F2NA 5CD1A 3MD9A 3IAS1 3DVSX 2C83A 2HJRA 4O0LA 3V2UA 4IJMA 5TE9A 1V39A 3SFZA 5JZMA 4CCYA 1VTKA 4QKQA 4P92A 3KB8A 3T7TA 2VPXA 3Q3JB 1XTQA 1CIPA 3KOWA 4HDCA 2DWUA 1ZOOA 3RTAA 2GTHA 1OIXA 1JLLA 3FFTA 4QARA 4OB7A 2VP9A 3DDNA 2EJBA 3EXEB 2IPLA 1YL6A 5BT8A 3OHSX 4ZVPA 1J2UA 5F73A 3OKPA 4NAHA 4X66B 1QFXA 4JBLA 2R1VA 1ISMA 1IQRA 3QI2A 1X38A 4MITA 1IY8A 1H2XA 4NYMQ 4AY5A 5EKTA 5BN5B 4HD8A 1CUHA 3Q9UA 2VT7A 3GMIA 4MUHA 4RADA 1E1CB 4I1SA 1GL7A 2XQIA 2FFJA 3RD5A 2I6QA 1BS2A 1A7UA 3CNLA 1R64A 2JKVA 5JASA 1AXEA 4RJKA 4IV5A 3A4YA 2YZGA 2ZUCA 4HJRA 2X22A 2PNJA 1Q92A 5LYJB 1JEQB 1SU8A 5D87A 4FWBA 5BRNA 1VECA 1W4LA 4HVAA 2ZBPA 1P91A 5AK5A 5CNIA 3P9YA 4AZ0A 3FI9A 5AVRA 1KH3A 3ANXA 3KK0A 1K8XB 5JUWA 5KC8A 3FNIA 2ZJZA 3AFMA 4MCHA 1TK9A 4FVTA 4Q00A 5GWXA 4FZ5A 1I2MA 1M74A 2XITA 3FOWA 1MB0A 3LF1A 4MOWA 4MWEA 3IP1A 1GAQA 4G0YA 1WNFA 3V9PA 1SZPA 3F4BA 2R25B 4V39A 1VLHA 4RHFA 3UOWA 4M7PA 2AWNA 4WBNF 2FW9A 1JEYB 3I04M 2YUTA 4RDCA 4AJOA 4B73A 4XGRA 2ZJ1A 4M55A 3G85A 1EP2B 4Y2UA 2JGDA 4ALMA 1K3TA 2DETA 4JJGA 1Y8RA 1LA2A 3I5MA 3WYCA 4C6RA 4TWJA 1JJIA 1GTVA 1SHKA 2WFLA 3WAKA 3WAJA 3H2HA 1S89A 5BR1A 2G1AA 3IAS6 4PR0A 3WICA 4HAZA 1CJCA 1JUDA 2YZNA 1JPNA 3DP9A 4NARA 4OREX 1URPA 2A0YA 4RNDB 2G07A 3SM9A 1WY7A 1WA5A 2W5UA 1M6HA 2IYAA 3EF1A 3H5TA 3QU9A 4MIYA 1A77A 2HWYA 3RHZA 1ZU4A 4AROA 3ETDA 2ZTHA 2WIBA 4PTLA 1G42A 1H4SA 3HN7A 2L42A 3JQAA 3UJCA 3L18A 4PG8A 5MGBA 1DT5A 3O38A 2O0MA 4LYFA 4YJ3A 1O95A 1RWNA 3HBAA 2B2NA 1G98A 1E3IA 2OQIA 4M9XA 4IDGA 4N49A 1E7RA 3CN7A 5LCXA 2HTEA 2VG8A 1T35A 4PICA 4D3FA 4V0NA 2XXBA 4AXXA 1ZZGA 1OZGA 3FYCA 1KEVA 3JD0A 2BMWA 4FBLA 4K05A 1Q6ZA 2GBLA 1FSFA 2K2WA 4DBLC 1U5BA 5KPJA 4ZCRA 4MV7A 2K5UA 1D6NA 2F3RA 1C0KA 4A5OA 3L4JA 1AE1A 2IYFA 3AV3A 3Q7RA 3MWDB 2P68A 4L6AA 1STOA 4NE9A 3UJAA 5AKHA 1KDPA 1MAVA 4DC0A 3V97A 1L5SA 1EFRD 4MPJA 3A6PC 2GZHA 1MO5A 3EUFA 2DPHA 3WL4A 1XA3A 4M0LA 4OUKX 4MKHA 2P5SA 4M1QA 5SZHB 3KPJA 5DWDA 5HKLA 3RIGA 3R5JA 2YW2A 4B84A 2Q0HA 3S99A 3GELA 1R7RA 3EXHB 2FP3A 3KEGA 2D5AA 4CR7A 1JHRA 1V9CA 2SCUA 4Q24A 1GRVA 3WX0A 1N7HA 2XZDA 3N87A 4JT2A 4KWHA 3EWNA 1XMSA 4DCUA 1NV8A 4KIGA 1T5HX 2QRMA 4MCAA 4TV8B 1W44A 5JNVA 2G80A 2G7MC 5C8VA 3E8XA 3B60A 2OC9A 4AJEA 1Z06A 1E2DA 1DBRA 4BDTA 2Y0CA 3MTGA 4BKRA 4EX6A 4A73A 1PBNA 2Q1SA 2FFHA 4LTMA 4WN9A 3W1WA 2ZRNA 4LWOA 1OPXA 2YWFA 3LGSA 5T41A 4B8WA 3OZAA 4AY3A 3MHPA 4KVZA 4FFLA 3RJ5A 4WKGA 3AHDA 4ARZB 4U3JA 1GA1A 4GOMD 1S2OA 2WT9A 1Z5PA 1A88A 3EIHA 3KPVA 4DA0A 5CYGA 4C7BA 3HR7A 1XZ8A 2PS9A 3TRHA 5IUJC 5EIBC 1NN1A 4YUZA 1GPBA 2OCYC 3E9EA 3EVDA 4FCVA 2C98A 4UM8B 1B8OA 2IY7A 3I04A 3UWMA 4P34A 2AKEA 4FS8A 1KJYA 3BAFA 4J2HA 4MKXA 3BL8A 3LKLA 2AS0A 3THRA 4EF6A 3GLFB 3THYB 2Q6LA 2JHAA 4GLBA 3TIIA 2E0IA 2FN4A 3LLSA 4COKA 4CFSA 4R1PA 3DEJA 4FXPA 5TQ2A 1LK7A 4NZZA 2QRHA 2WSYB 4Q9NA 3ZOZA 2C9YA 2XVYA 1NZDA 2YNMA 3WLAA 2W2KB 2AOXA 1XZHA 1JALA 5TR9A 1D1PA 2F1RA 4D0GA 2GHIA 4YIHA 3TTWA 3ZGXA 2DBRA 1OXTA 3FSEA 3RFUA 5KSZA 2QL9A 3N8GA 2JLQA 2QLNA 1V4VA 2ZUFA 3KNZA 2XCTB 1R74A 1UK9A 3INTA 3RC3A 4U6QA 1BWRA 2FFRA 4DYDA 3E70C 5EWLB 1OT3A 1ZESA 2XUZA 1EFTA 2YOFA 1CP3A 4IV8A 3TMKA 1E4VA 4FSDA 2FOXA 1F48A 2QU7A 3JTMA 1A71A 3OETA 1YUBA 3PC8A 5FNVF 4DR6B 2C4NA 3TPFA 5DW0A 1K08A 1W1UA 2HRDA 4UULA 2GF2A 1FRVA 3UFBA 1O95D 3GAZA 2OCXA 2ZPAA 2NN3C 4Y2QA 4RHYA 3UCXA 3I0NA 4XSVA 1HTTA 2J3JA 2WB4A 1Y3FE 2RBEA 1GDTA 2VAWA 4ABYA 1IN1A 4AZVA 2PRZA 3JARA 5AJUA 3LWNA 5CB8A 5G4LA 4M0CA 4BRWA 4MRNA 2FW0A 1XQ1A 3H9UA 1XNEA 3OICA 2UXBB 1D2RA 2GA9A 1IB6A 3OE4A 4WOBA 1EUCB 4WHMA 1JQJC 2AB4A 3SYRA 2HIMA 3G82C 3I9MA 5CD9A 1AKUA 1WPGA 5C4GB 2WU0A 3AW9A 3CNBA 3Q3HA 2ZM5A 3AUJB 1WUYA 4L16A 3SDZA 4BV3A 1X74A 1V5IA 2DPLA 5JWHA 1G8PA 3FJ1A 4DF3A 4HAWA 5JSYA 2FR8A 3VAYA 1N6LA 4J4HA 3GLSA 1G2PA 3FZNA 5LB2A 3CONA 3KZ1E 2DLDA 4FQ8A 1WVIA 1TGYA 5CCEA 4XLLA 2PZFA 1W6RA 1PGPA 3PGXA 3AKEA 3JWPA 3T3NA 3KQUA 2PMWB 4IXTA 3VJRA 1F8FA 3OUUA 4TX1A 4JVLA 1DWUA 1ZWLA 2BFCA 2QE6A 2QL6A 2SNIE 2O2ZA 2FZLA 4RA6B 2ZJ3A 3L7MA 5J1TB 4NAVA 3OZWA 3EH7A 5E6UB 5A4FS 2WUWE 5EP1A 5GV8A 3OJWA 4XVQA 3UMYA 2C54A 2OT3B 1O5IA 4GXRA 4PAQA 4BYGA 3PCXA 4KHPB 4QU5A 4JS0A 1H42A 1KJQA 3PXCX 1GGHA 1MFPA 2ORWA 3O03A 3AERB 3QITA 4GR4A 4PAMA 1GPNA 3TLXA 5HW0A 4KMRA 3EGVA 1DLIA 4P3YA 4A0SA 2CW5A 3LK6A 3HVUA 3RS8A 4TMXA 1YDGA 2OBBA 4AXBA 3IXMA 4RLQA 3F43A 2RH4A 1NUUA 4V0RA 1C29B 1QE5A 1UPBA 3AT1A 3WBKA 2IHJA 3OX4A 4NJOA 4HBGA 1FFEA 1J5PA 2GK7A 2B34A 1AVTA 4GYKA 1FNNA 4MO9A 4ILKA 4FOLA 4I55A 4BNWA 5IARA 4LMPA 1CR0A 1VMEA 1UUFA 1EVZA 4FFBA 5FJIA 1TU4A 3SJUA 3T9CA 3TZ6A 2VDQB 4KX5A 4NDNE 3ZZNA 4F84A 4RD3A 4ZALA 5TT1A 2Y1GA 3WKEA 1JKXA 4B75A 3RC1A 1SHLA 3ZE2B 2JKYA 4RIHA 1IK6A 3HHEA 5CVJA 1UXIA 1YVEI 3KQMA 4ZI2A 3S3TA 1ULBA 4QQFA 1T0JB 2O2HA 3GRRA 2WU1A 2XUOA 3D3NA 1P9OA 3C24A 1JMKC 3AF0A 4E70A 2MR6A 2SHKA 4EX7A 1HDGO 5A7FA 2I3ZA 3NM5A 1C30A 1UZNA 3EIQA 1FA9A 4Q1DA 1WKVA 1PGQA 5B6PA 1S3GA 4H2DA 4IIJB 2V5UA 4EW2A 2XVAA 1XCPA 3AETA 3HVHA 4GQIA 5CFMA 2MU1A 1XRNA 3SVTA 1ZD9A 2IEAA 2GSDA 3NYRA 4Z99A 1CS0B 2BMFA 3DZDA 1P5HA 3PUKA 2DJIA 4JWTA 3TTVA 4OKSA 2JIRA 3U0VA 4C21A 1JR6A 3F6RA 2NZJA 2H4XA 4X3PA 1FP6A 2D3WA 1PUXA 1L7NA 5E7JA 3M34A 1DTEA 2PWZA 3NVMB 4ADSG 1JG4A 3OE5A 4INJA 1EXDA 1DAKA 5EQTA 1SU6A 2RHHA 2UAGA 4LJ9A 1OVMA 4R9NA 3RFCA 5BSKA 4D0LB 5JNTA 2VPQA 4IICA 4RK1A 3PNBA 1G5FA 1XYYA 1X3SA 1E94E 1ZUHA 3DFMA 1M7HA 2ZIXA 2GESA 4KE6A 3NJ4A 4LYDA 1LNSA 1XTVA 1SQSA 1KI8A 1SCUB 1ONBA 1WHTB 4LZZA 4WKNA 2AW5A 4QELA 1CY7A 1DAMA 2CF5A 2ETVA 1X13A 2R8EA 4KITB 3TZQA 4IVNA 3EJWA 3H2BA 4EJ6A 1DC4A 2QVBA 1GGVA 2PY6A 2QYSA 2GVNA 2W2KA 1D2AA 2W8ZA 4HCJA 4EHFA 2EDAA 3KR2A 3QBTA 5JJKA 3ZI7A 2HJGA 1FZQA 3T06B 4OFBA 2Q3MA 1FOEB 5FA5A 1RHMA 4ENSA 1ODTC 3GLGE 2G71A 3P71T 3GLFA 2O5CA 2MSWA 1WZUA 1YI1A 5CVDA 3ZKAA 2HLDD 5B7GA 4E5DA 1KPHA 1QJ4A 1YS9A 3LCRA 1I4DD 3DQZA 1JR3D 3HCCA 4DPMA 5JCOA 2YMMA 1RADA 2X9QA 1FS5A 3E1SA 4GSYA 1SRQA 3RBZA 4CPDA 4DYVA 2WQ6A 4H16A 4OJQA 2D1FA 2UU9B 1GP2A 3IR7A 2WJWA 3FDXA 3H97A 1SY7A 4GZ3A 5KQLA 5AUQA 4GLJA 4OOEA 2WUVA 1OXBB 4FN5A 1UXGA 1MT0A 3RODA 4XJVA 3IOMA 3M3DA 4N8SA 4FMCB 5LLSA 1MOPA 4QM7A 2VK8A 4LA4A 2ODWA 3IIJA 4NK5A 1DCFA 3IEXA 3E48A 2VKQA 1SQ0A 1USKA 2XUHA 3FPCA 3H19A 1K98A 3LPCA 3QF7A 5GGXA 3UHJA 4F5EA 4R71A 1GAEO 1C0EA 3SU8A 1Z0JA 3LWDA 1OI3A 2BJWA 2P0AA 1WRBA 4HAOA 5JH7B 2J0QA 1TJ4A 4Y6OA 1VJDA 2KLHA 3CMMA 4IVRA 4W8GA 3M9WA 5F5NA 3ORYA 3GJ5A 1DAOA 4N4AA 2P5TB 3P9PA 2JFGA 4EFNA 2ZREA 4N6NA 2V3WA 1Z4IA 1P33A 5JVDA 3CT6A 4XGKA 3DT9A 1NBMD 2VDKB 4ALJA 1JQBA 4UPDA 4BJ6A 3U6KA 2O5EA 4TSFA 1LQTA 2OGSA 2PJZA 1OI2A 2PA3A 4AECA 4D7AA 1TB4A 3BWEA 1F17A 1QLWA 3C3YA 2R8BA 3NHPA 3V4LA 5K05A 4TYNA 2VYCA 1SCBA 3DBHA 1DTWB 2WU3A 3OZBA 3T3DA 3LC7O 4A6DA 3A6FA 1G8AA 1CQWA 3DM5A 2P6NA 3BGWA 4MARA 5FYQA 2BMJA 3TF5A 4YCNA 4JXKA 4KQXA 2CYCA 2EW8A 4BWYA 4MR8B 3VGPA 4ZT5A 3SC2B 1QG0A 3V4ZA 3I72A 2O05A 2IGBA 1P4AA 1GGJA 2QUKA 4B4WA 4DIMA 4QVGA 1U0TA 3ZY6A 2L2QA 4RPJA 1VHLA 3LUDA 3RVJA 3AEZA 2HI0A 2FPIB 1G66A 4HFRA 4K86A 4C08A 5LWQA 1Y89A 4WKCA 4PY2A 1GUZA 4FSXA 2HOQA 1QONA 3CIFA 4JR2A 1NV9A 4O4HA 3EPKA 1JMVA 1QV6A 3NM4A 5ALKA 1U4OA 1EWRA 4Q19A 3ZJUA 1SXJA 2JBAA 3DFIA 1CR6A 1RXEA 3G88A 2JW5A 3TSOA 2A4KA 5HF5A 1Q20A 3RUAA