3C0KA

Crystal structure of a ribosomal rna methyltranferase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
395
structure length
395
Chain Sequence
SVRLVLAKGREKSLLRRHPWVFSGAVARMEGKASLGETIDIVDHQGKWLARGAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGLPGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQGPVTGELPPALLPIEEHGMKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTYRDRGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLFQKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UPF0064 protein yccW
publication title Crystal structure of the Escherichia coli 23S rRNA:m5C methyltransferase RlmI (YccW) reveals evolutionary links between RNA modification enzymes
pubmed doi rcsb
source organism Escherichia coli k12
total genus 124
structure length 395
sequence length 395
chains with identical sequence B
ec nomenclature ec 2.1.1.191: 23S rRNA (cytosine(1962)-C(5))-methyltransferase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase
A PF17785 PUA_3 PUA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 3c0kA01
3.30.750.80 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA RNA methyltransferase domain (HRMD) like 3c0kA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c0kA03
5HOQA 1WZNA 3ELYA 1Y8CA 5EMMA 1X1AA 5EEHA 5GM1A 3FUTA 1JG1A 3P8ZA 1D2CA 1JQDA 4OQEA 5LSAA 4RTOA 2ZIGA 2PSSA 4C03A 3MCZA 4EKIA 1X1CA 5K01A 4KRGA 1ZKDA 2HR1A 4R8SA 3EVGA 2GS9A 3LGAA 5G02A 5K09A 5FQNA 4WXHA 2Q41A 3OZTA 2B25A 3ER8A 3M6VA 1VQ1A 4GF5A 3ELDA 5GP1A 1ZQ9A 4YV0A 2WA2A 3P71T 4RVDA 3FUUA 2P3QA 3PFHA 4B17A 3VSEA 2FHPA 2B78A 4RWZA 4R6WA 1JSZA 2P41A 1SQFA 3JWIA 3CJQA 5D1NA 3B5IA 3GCZA 2I6GA 1ZG3A 3FRIA 5FTWA 4YV1A 5DM4A 3DH0A 4Q1TA 3SGLA 2IFTA 4FP9A 4IV8A 2OY0A 2WK1A 2YXDA 4AZTA 1IY9A 1JTFA 2QE6A 3GXOA 4AZSA 3KR1A 5DSTA 3LCUA 3PTAA 1F38A 2J5TA 3PFGA 1R8YA 5K05A 1NV8A 2J5VA 1RJEA 3UJ8A 4QTTB 1TPYA 3P9IA 4BLVA 5HIKA 3P9CA 3HA3A 2AN3A 3M6UA 5C0OE 3BGVA 2GH1A 3OFKA 5P8WA 3GJYA 4C08A 4G56A 4PYMA 4E33A 5EHIA 2HNKA 2JG3A 1Q0SA 2OB1A 3FYDA 4XUCA 5K03A 2QM3A 3DP7A 5KYGA 5EVJA 3HCBA 3PVCA 3KHKA 2OB2A 4V0QA 5JUWA 3KQYA 3EVBA 3HVJA 1YFLA 2GAFA 1G8AA 2QRVA 2ERCA 3T7TA 3UBTA 3Q7EA 3GRUA 3HVHA 4CTJA 4FT4A 3DXZA 1QAQA 4FGZA 4RTKA 3DULA 4PYNA 1V39A 1G8SA 2EG5A 1O9HA 2PWYA 3TPZA 5FHRA 3MERA 4MWZA 1VLMA 2B2CA 3EGIA 3MGGA 5DLYA 1T5YA 1RI1A 5K8VA 3FUXA 5GINE 1UWVA 5CCBA 2KW5A 5LQUA 2O07A 2AVDA 3LKZA 3IHTA 3GRVA 3G7UA 3L8DA 4XUDA 2GPYA 3A26A 3EVFA 1NW8A 3TR6A 1SUSA 2ZBRA 3GRYA 3KQVA 3LCCA 1INLA 3O4FA 5JR3A 3IV6A 3ID6C 4PONA 5DPMA 2AOWA 3GRRA 2BZGA 3FPHA 3BGIA 4LWPA 5DTRA 3UJAA 4RTJA 3I64A 3F4KA 2ZIFA 5DM0A 2LD4A 2PWPA 5DSXA 1JG3A 2F8LA 3LHDA 2YXEA 2I9KA 5LQKA 3LDFA 2VDUE 3FUVA 3SM3A 3TLJA 5FWDA 3ELWA 4PNEA 5ICEA 2ZULA 3EPPA 3G88A 4DCGA 4GUAA 1XCJA 2ZTHA 3UJ7A 2AS0A 1WY7A 3NVMB 4X60A 4Y30A 2GB4A 4RTSA 3R24A 4HH4A 3ORHA 4FSDA 3K0BA 4LECA 1JG4A 4X1OA 3HM2A 3FTCA 2VDWA 4QVKA 2EJTA 3M4XA 2OYRA 4P7JA 2PXCA 2PT6A 3HVIA 4OBXA 4R8RA 3S68A 4YUYA 3VC2A 1PJZA 3UA4A 2YQZA 4RTLA 4YV2A 3ER9A 2G71A 1WXXA 3NWEA 2P7IA 4QPNA 4O29A 4QDJA 3T7RA 1I1NA 3FPFA 3NDIA 4LG1A 4DF3A 5C9ZA 5C1IA 2AZTA 3RW9A 4E2ZA 5E9WA 5GWXA 3EMDA 3EEOA 3NWBA 4A6EA 2JHCA 4E70A 1KR5A 2QYOA 3DLIA 4RV9A 4AUKA 3NW9A 2NXEA 2PKWA 4QVGA 2IBSA 1QZZA 2XYQA 5LQCA 2V7EA 3BXOA 5EEGA 1MHTA 3LPMA 2IH4A 3AXSA 2AOTB 3SSMA 4AZVA 3CJRA 3DR5A 4MQ4A 5E1OA 1ZS7A 1TW3A 5CUQA 3EVEA 4M7RA 3HA5A 1FP1D 1N7IA 2P1DA 4EKGA 2HWKA 1D2GA 5FWAA 3NMUF 2XYVA 2IH2A 2JH9A 3UFBA 4ER5A 3GU3A 2PX5A 3HA7A 1XDZA 4HRAA 5DT2A 3TOSA 4E2YA 1KYZA 2O06A 4E32A 4P58A 1YZHA 2H1RA 2YVLA 3KKZA 4GOOD 2BR3A 4BY9E 2IPXA 4XUEA 3ME5A 1N7JA 4ER7A 3QV2A 1MJFA 5D1HA 4DMGA 2OXTA 5M5BA 2P3OA 4GQBA 4WVLA 3HCAA 5FA5A 3KR9A 4PYJA 5ERGB 5DXJA 1JTEA 1ORHA 1X1DA 1O9GA 3TFWA 3EGEA 1RJDA 3M6WA 3R3HA 4RYLA 2ZFUA 5E1BA 3WSTA 3PS9A 1YFJA 1VP9A 1R3EA 3MQ2A 3OPNA 4M37A 4YUZA 5CIYA 2P38A 3NJRA 5EMKA 3UJBA 1NW5A 2XVAA 3KPUA 1AV6A 3DMFA 5FQOA 1NT2A 1ZE1A 3AXTA 5GOZA 4LWOA 4PYLA 4YUWA 1IT7A 2AOTA 2DULA 2IDJA 4FZVA 5DRYA 5E9QA 3TKYA 5E9JA 3GDHA 1KP9A 2EFJA 2OO3A 5LR6A 2HV9A 3A7EA 5DRTA 2ZBPA 1XTPA 3P9KA 4QTUB 4DKJA 1R00A 3DOUA 3G2PA 2CWWA 5EPEA 3BWYA 4HSGA 1RI2A 1YZ3A 1ZHFA 3P9NA 3BUSA 3G89A 3KPYA 5BXYA 2YX1A 8MHTA 4HGYA 5DM1A 5DTMA 2A14A 4OX9Y 3FTDA 3REOA 3G2OA 1J2BA 4UOEA 4ZTBA 4Y2HA 3G5LA 2Y1WA 1X19A 1JSXA 2B9EA 5FUBA 2E5WA 2ZIEA 3LKDA 5T67A 1BOOA 3GGDA 3CCFA 3C3PA 5ICFA 3LBYA 2VP3A 2PLWA 2YTZA 4AX8A 1L3IA 2I7CA 2NXCA 2XBMA 2AR0A 5CVJA 2Y1XA 5EMJA 5E8JA 1SQWA 5EG5A 3FPJA 1XXLA 2FRXA 2PX8A 5HFJA 4ATNA 5FCDA 3JWJA 2ZZKA 3BGDA 1G6Q1 4XCXA 2NP6A 2IH5A 1SQGA 1H1DA 5LQJA 2B3TA 3TMAA 1XDSA 3DMHA 3R0QA 3G8AA 1QAOA 2NNWB 5K0GA 4OA8A 3CKKA 2AOVA 2PY6A 3LDUA 3MTEA 2CMGA 2G70A 5BW4A 3PT9A 1KPHA 1XVAA 4F86A 3B7PA 4BP1A 3PB3A 5F2KA 2HTEA 5K0CA 4RTMA 3MHTA 2ZW9A 1YUBA 3PLAE 3BWBA 4CKCA 1L9KA 4HTFB 3BWCA 3KQMA 1I9GA 3PX3A 3T0IA 4YUVA 1VIDA 1R3FA 3IYLW 3KR0A 3SVZA 2G1PA 3H2BA 5EQJB 5CD1A 1XDUA 4OQDA 1PRYA 2Q07A 3ERCA 2AB4A 5LQAA 10MHA 1RI3A 2NXJA 3FYCA 3UA3A 1EAMA 3UAIA 1EG2A 4RTNA 3DMGA 2AOUB 3OCJA 2IGTA 1DCTA 2PXAA 1VPTA 4KIFA 2G8NA 3KQPA 3C3YA 2FK8A 3B89A 3G2QA 5E1DA 1KHHA 3PX2A 4L7VA 4E30A 1AF7A 3FTEA 1XJ5A 4U7PB 5EIFA 3GIWA 1VL5A 3OE4A 1D2HA 1U2ZA 3B3FA 1KXZA 3KQTA 2NXNA 2R6ZA 4X61A 2BM8A 3FZGA 5GM2A 4E2XA 5HZMA 4FT2A 1AQJA 4P7KA 2ORED 2OPBA 1X1BA 4RVGA 3TRKA 4OA5A 3E7PA 2N47A 4PIMA 4X41A 4C04A 4C07A 2IDKA 5EZSA 3KU1A 4CXMA 3D79A 4YUXA 4JXJA 4FS8A 1JQ3A 4H0NA 3VYWA 3OU6A 5KVAA 5DM2A 3P97A 2PVCA 1O54A 1ZGJA 2HMYB 2CMHA 3P2KA 3A7DA 2WA1A 1QYRA 1NW3A 2PJDA 4E2WA 1IXKA 1Z3CA 2XVMA 5LQNA 2ADMA 4P7FA 4P7GA 3KQOA 5K0LA 2CX1A 4ER3A 1SGVA 1RJGA 4GEKA 2QY6A 5EMLA 4HG2A 3B3JA 4DCMA 4PINA 4CKEA 2BM9A 4M38A 3A27A 3SX0A 2PBFA 1M6EX 2Z6UA 9MHTA 3FUWA 4C05A 3BZBA 2OZVA 5CM2Z 3THSA 1IQ8A 2UYHA 4YMGA 1R6AA 1NBHA 3HCDA 3MTIA 3A25A 4BP3A 5MHTA 3UJDA 2ZZMA 3DXYA 4MIKA 4PWYA 4FSXA 3P2IA 5B1SA 3AJDA 1YF3A 1KIAA 3EEYA 4RTRA 5E8RA 3G8BA 2JJQA 2H00A 1EJ6A 4IV0A 5EKXA 4DA4A 4KVZA 2JHPA 3OU2A 3LDGA 4F84A 4KIGA 3BKXA 2Z6QA 3FRHA 5DX0A 3CBGA 2IP2A 5DXAA 1BC5A 3KQQA 5HILA 4A6DA 3FTFA 4CKBA 4BLWA 2AN5A 1M0EA 5KS2A 1I4WA 3UWPA 1Q0TA 1R18A 4GBED 1NW6A 1RI4A 2ZVJA 3HP7A 3LX6A 4KDCA 4PYIA 1R8XA 5CVVA 5EOVA 3SR4A 4RTPA 2ZSUA 2VS1A 3C0KA 3HCEA 1EIZA 1ZGAA 1L3CA 4EK9A 2GA9A 3P2EA 3KPWA 3LL7A 2ZWAA 5HIJA 3DTNA 3TM4A 2ONYA 3HNRA 2P8JA 4DZRA 3I9FA 3V97A 3OZRA 3UJ9A 4BLUA 2ZLBA 1AQIA 4QQKA 2YR0A 3HCFA 3Q87B 2PX4A 2ZBQA 1T43A 2C7QA 2C7OA 3DXXA 4GOMD 4PYOA 2IBTA 2QRVB 4MHTA 1VP3A 2VDVE 1M6YA 3EVCA 1Q7HA 4KDRA 1DL5A 4NECA 4PCLA 4C4AA 4K6MA 3NVKI 3LBFA 1SG9A 5H02A 2EJUA 5IKMA 3CJTA 2UYQA 1YB2A 4EMSA 2AN4A 1P39A 2FYTA 5F2OA 2C7RA 5KQSA 1FJXA 2P40A 2H11A 2BR5A 4POOA 5CVEA 3M6XA 1NW7A 1N2XA 4EQZA 3IEIA 5EGSA 3VC1A 5K0JA 3E23A 5HIMA 5K0NA 4PYKA 3MAGA 5FADA 1SVUA 1KPIA 4QQNA 2BH2A 2NP7A 4CWAA 3BT7A 3GO4A 3OE5A 2YUIA 3E8SA 4M36A 5ICCA 1BHJA 4KW7A 1FP2A 4ISCA 4R05A 2FK7A 4IKPA 2CX0A 2BR4A 3DLCA 3QOWA 4HGZA 4PYQA 2OBFA 4U7TB 3K6RA 3R6TA 5GIPE 5E1MA 2V74B 3SSNA 3BKWA 4IWNA 1KYWA 3NDJA 3UJ6A 3MB5A 2IIPA 3FPGA 5CVUA 5EHGA 2FCAA 5HEKA 3I53A 5CCXA 1IM8A 5DX8A 3EVZA 1JG2A 7MHTA 4QDKA 1B42A 1P91A 2AOXA 3U81A 5FA8A 1UIRA 3I5UA 3KPJA 3OU7A 1R74A 2ZCJA 1HNNA 5E2BA 1NV9A 5F2NA 4MTLA 4PIPA 1TW2A 4EVIA 2P7HA 5IH3A 1UFKA 3C6KA 3JWGA 3NTVA 4KWCA 4OBWA 4Z2YA 5EC8A 1G60A 1EJ0A 3OFJA 3M33A 3V8VA 4GC5A 4V0RA 3GNLA 3EVAA 2PX2A 4X63A 1HMYA 1OR8A 3ANXA 4GOLD 2K4MA 4QPPA 4RVFA 3EMBA 3R9XB 1EQAA 3KPVA 5ICGA 3AWIA 4RSRA 1JR4A 3TM5A 5K0EA 4GOND 1ZL3A 1FBNA 2UZ4A 5K0BA 4CTKA 5GIOE 3TKAA 5FHQA 1NE2A 2O57A 2OKCA 4RX1A 2PGXA 1RJFA 5U4XA 2DPMA 4PGHA 3O7WA 3FPEA 3EVDA 3B3GA 1XCLA 3THRA 3DUWA 5EKUA 5K0FA 3QOXA 5KQRA 2ESRA 2UYCA 4FR0A 3SMQA 3TQSA 3LSTA 2EX4A 4YMHA 5BP7A 4ER6A 2C7PA 1G38A 2ZWVA 1L1EA 2O05A 2AVNA 3OZSA 1SKMA 1DUSA 2JH8A 3G5TA 4RVHA 3E05A 1FPQA 1VE3A 2P3LA 5CVDA 3CGGA 3SXJA 2P35A 2YXLA 3GWZA 3LECA 2PXXA 3MCTA 5BW5A 1G55A 3G2MA 3JWHA 3KR2A 1NKVA 3I58A 1KPGA 3EGVA 1ORIA 2G72A 1SUIA 4HTFA 1L3BA 4C06A 2Z6AA 1RI5A 1WG8A 5FULA 4ER0A 5DTQA 4R6XA 5T64A 4HC4A 2R3SA 4DQ0A 3A4TA 2VZ9A 3M70A 3KQSA 4PGGA 3GRZA 5E2AA 3SSOA 3X0DA 4F85A 3HEMA 2ONZA 2AOUA 2UYOA 3RIEA 3D2LA 3HCCA 3T7SA 1IT8A 3CVOA 2GLUA 1K8WA 2FPOA 5EZQA 1F3LA 5LQRA 3BWMA 2PV0A 2XYRA 4GC9A 4PCAA 2O0LA 3HTXA 2I62A 1ZE2A 4E31A 3AY0A 5DX1A 5DWQA 1JQEA 2CKDA 4DM3A 2NYUA 1WS6A 1BKYA 3CC8A 5EIWA 3UZUA 3RODA 2CL5A 3KQWA 4RTQA 3HVKA 1P1BA 3C6MA 1QAMA 3O31A 3ELUA 1P1CA 5T6BA 3UJCA 1QANA 1NBIA 1WXWA 1VBFA 2PT9A 3LCVB 2ZZNA 2JHAA 5HIIA 4AZWA
chains in the Genus database with same CATH superfamily
1M6WA 1TK3A 2H08A 1P2SA 2ZYHA 4R2XA 4A3SA 3WY9A 2I91A 4YHHB 2QVGA 4FDTA 3GT0A 1JB9A 3HO6A 4UPDA 3TTWA 4DJFC 1IY8A 2I6FA 3INRA 4HSEA 1CZKA 3K2QA 4JFAA 1XV5A 5TF0A 4JX8A 4PZLA 3N5KA 4B47A 3LGAA 4BMDA 1QPBA 2ZIWB 1P4AA 4EMUA 2Q41A 4ZVOA 5AD1A 4CQLB 1RAAA 2HPHA 4Q6BA 3IQFA 1JG6A 5G53C 1XRNA 3R44A 1F4VA 5KC9A 4RK1A 4KB5A 4YAWA 1QG0A 1VC1A 3F7NA 4OK5A 4YQYA 3VSEA 2OD2A 5K8TA 3ZDFA 5L53A 4EFDA 1SA0A 4DV3B 4IG9A 4B80A 3CKMA 1WMSA 4X95A 3FRIA 1I6WA 1G3IA 1A4IA 1U2DC 1OU0A 1RXSA 3DH0A 1H4QA 5A9RA 2YWGA 2PL1A 2OY0A 5ALWA 1RWWA 4HDNB 1JTFA 4TN5A 1QJ4A 1NHWA 1W73A 3GXOA 4MR7B 3KQNA 3PKZA 1J7XA 2J59A 3LX5A 3RRMA 3FPAA 1HNZB 3L0IB 5FI3A 3SQDA 3ZCTA 1E6UA 1C0PA 1EQUA 1TKCA 2QG4A 3R3XA 4MVJF 2D1QA 2H0QA 5EUBA 4MHSA 3TOXA 1V9CA 3R5KA 3A6GA 3DZFA 4NQZA 1A2KC 1R0CA 3NM4A 1D6JA 3DB2A 4FLEA 4WXMA 2RGGA 5AW5A 2WAOA 4NBLA 3TRDA 4C08A 1DAEA 4RJKA 4B3IA 5BSEA 3RS8A 3LLOA 2B8EA 1OPRA 3D1JA 2L17A 3OJXA 4QXPA 4XA8A 1T9GR 2R96A 1ST3A 5JSFA 2R6DA 2WT4A 1IHXA 1UH5A 1DT5A 1JEOA 4H08A 4MWEA 1XZQA 2P2GA 1PJAA 3AW9A 5G4KA 3S7TA 3GPLA 3K5IA 1OI3A 4N3GA 1FNSA 1N2CB 1Q20A 2C07A 1GRVA 1L0BA 4BIIA 2OCGA 2OPHA 2FVYA 5E7MA 3H99A 2FZGA 2VTEA 4PYRA 1XCMA 2JLAA 3MNFA 1CS4C 3MS2A 3RT1A 5DLYA 1JZQA 3GDWA 2QMOA 3OF3A 4N0PA 3ZTTA 4C6TA 4IDQA 1PG5A 3QRWA 1AUVA 4L73A 5H7XA 3ZVRA 5HCUA 4ERXA 1N8KA 4M55A 4RZ3A 3CSDA 3O4JA 3TWOA 1QHGA 4F2PA 5CDSA 1CQWA 1QZUA 4C4ZA 2X7JA 4NCXA 2A5DA 2O8DB 2REQB 1ATZA 1SCIA 2FEPA 2C58A 4DMRA 1LDBA 1GLNA 1YQXA 2VNKA 2W0SA 3IJPA 2H31A 5H80A 3ANLA 1MH9A 3QXHA 4ZGWA 2ZIFA 2LD4A 3ROQA 3TVTA 1XRMA 2Z2KA 4J4BA 1HURA 4ZO8A 4GBMA 2YYSA 4GHWA 3F5QA 5FTMA 1EUDB 4LYYA 1AKQA 4JXZA 5BURA 1YB7A 5IVPA 3BJEA 4QJ3A 4OO3A 5JH7A 2ZULA 4DDUA 3JQAD 1XQ6A 1M5UA 2OENG 3TX6A 2GERA 5IN5A 4DTCA 4Y2GA 1V5GA 2XR1A 1XQWA 4UEQA 4BTEA 3MQKA 3GQBB 4BNFA 1CZOA 1KEVA 3F3MA 5IEBA 2OYRA 5B7QA 1YQQA 1AGNA 4BVBA 3IUQA 4RQAA 4IJ5A 1QIKA 3H87A 3LVRE 1GTSA 4LJRA 4X1IB 2ZATA 1M5RA 4G1UC 4KQWA 1PLKA 2EEZA 4DCUA 4R7ZA 1TMYA 5C1IA 1KDOA 4H16A 4J0GA 1Y98A 4MWSA 5E9WA 3RPEA 1SBQA 2RSLA 1NASA 2V59A 2X0EA 3MGCA 1I6KA 3H7IA 3FBTA 1MOQA 1S2GA 4WZBE 2HVYA 2ZR0A 4WTOA 1A9RA 1CEEA 1NX9A 1T8UA 1TLTA 1UAGA 2OSVA 2ODWA 1UT6A 2XADA 1KNXA 3BRWA 4M8NE 4QVGA 1RPZA 2AUNA 3T3NA 1UJMA 5C1BA 4CTMA 1LCIA 3HWWA 2OCYC 1QUEA 2R4QA 4GI7A 5KWVA 4MR9A 2DCMA 2W6MA 4FS3A 4AM8A 4DR2B 1EE2A 1KYQA 4REQA 3NS7A 3ZHUA 1LBTA 4OXQA 3GU3A 3H9JA 2F9MA 4MXDA 3W2FA 4XM0A 2C3PA 4Q4DA 4NI5A 2O8EB 4JT4A 3S8EA 2O06A 1X3LA 4NDAA 4O4HA 1TJ3A 2JVJA 2VTKA 3GVXA 4TZTA 3ZI7A 5JZOA 2YVLA 2YVAA 3PYLA 2WC1A 1U94A 4OIMA 3KJHA 1RWPA 3HVUA 2BBWA 4II7A 1RM5A 1JHMA 1T3TA 2BSAA 2CF5A 1U2GC 2GCIA 4LCBA 4NBNA 1NF3A 5IBPA 3D3QA 2ATVA 2WIDA 1EU1A 1FP7A 1II9A 2HJ9A 3KR9A 1KDZA 3RRJA 4PYJA 1EVIA 1Q7CA 4F5EA 2C4VA 1M1NB 1SIOA 3EE6A 1CUIA 1TU4A 3GZNA 4J7XA 2HPVA 4TM7A 1OW3B 3VSDA 2R68A 4IXDA 5JMTA 3NGXA 1KQOA 4MI9A 5KOHA 1SQ6A 4BNDA 4UQLA 1NSYA 3AM4A 3D43A 1K5PA 1BE0A 4RIIA 1TJNA 1R4MA 1B4DA 1JEAA 1JNYA 1W85A 4UULA 1G8FA 5CYGA 2V0GA 4F3CA 1RPAA 4DMFA 4PPNA 3EIXA 1IT7A 2H2GA 5L3QA 3O75A 2CHEA 3GDHA 5AHOA 1ZX1A 5JD4A 1FTGA 3ZGZA 1ZHHA 4E21A 1JXMA 1ZVKA 3AU9A 3UG7A 1T5IA 3WIVA 3ZCQA 3GJ3A 4QTUB 2HDHA 3VGPA 4AYXA 1HQYE 4X7PA 2X8AA 1EP2B 5HVNA 2CWWA 3ESRA 3UGQA 3GFRA 1FU8A 3E9YA 4IJ6A 2B7CA 1Z12A 3CXUA 3AUKA 3LX8A 4HT3B 8MHTA 3QVGA 3Q3IA 1ZMOA 3OT4A 4AJNA 4D9CA 1M0WA 1WV1A 2ZRBA 3ESZA 3F1LA 3HJRA 5DTJA 5T57A 5HF9A 4ARSA 3G5LA 5ALLA 3AHJA 1LS6A 3ET4A 1B6GA 4QOFA 4RSHA 4LF7B 3LLVA 4CPDA 4EUSA 2G6TA 2AUMA 2AXPA 3QM1A 2QLBA 1HFKA 3M65A 2FW9A 4YCCA 1A7KA 1Y1TA 1PD1A 1VLJA 3ITNA 4JJEA 5HF5A 2NAPA 2WTEA 1YNSA 3G2LA 3C8HA 3D2CA 1C9JA 4UVEA 3Q3VA 1JU4A 2B3TA 1U7DA 2EQ5A 3UMSA 5A06A 5K0ZA 3FR8A 1B0PA 2Q50A 3LDUA 3CFYA 1E5TA 3AVUA 3BJMA 1UDCA 4JP3A 5ER9A 4B3FX 4YT8A 1JLLA 2W2LD 4F86A 4A5SA 1Z7GA 2E87A 2EAUA 1NQAO 2YWJA 3KT3A 1JT2A 1YUBA 2XOEA 3PNSA 4O33A 2ZYTX 3LGXA 1L7BA 4HTFB 4F5ZA 1B1CA 3ROXA 3BWCA 1YC5A 1RWBA 4BNHA 3H4MA 1R0ZA 1SELA 2XUKA 3H2BA 4JOSA 3UUGA 1MAVA 2C2YA 4IGFA 2OORC 1I36A 3E1GA 1M6HA 2XB8A 4KQ1A 4QPZA 3VR2A 2P9YA 4A92A 1W7AA 2XNDD 10MHA 4YAOA 2IY9A 4JLPA 1Y82A 2A9KA 2PMKA 4X20A 4RTNA 3I5YA 1Z38A 1TQ6A 1JJBA 1SXIA 1YT5A 4UPEA 4MUNA 2WFLB 2JFZA 3VYTB 4PHFA 1T36A 2PXAA 3KQPA 1GNLA 2EKDA 3IULA 4UHBA 3W2HA 1ZK1A 4ZU3A 2VCEA 4PSKA 4C0BA 2FWJA 2RRLA 2R6ZA 3GY0A 3RSLA 2H59A 3W2GA 2OTCA 2ORED 3ITEA 1WPRA 4J8PA 1ZNXA 1N92A 1X1BA 2XZDA 2Z57A 4V0NA 4UVGA 2XB9A 4O4JA 4JLJA 2EU8A 1K9VF 3D7MA 4M87A 1NC1A 4FNGA 5IXYA 4MWBA 2CLKB 4FZJA 1WW3A 5FPHA 3UY4A 5DNWA 5GGYA 1L1RA 3W8FA 4BO6A 3RHSA 5C8DA 4WK0B 3THWA 2QN1A 4DNFA 5BNWA 3G23A 3OM8A 3K6SB 1ZJ6A 3UN1A 4EGSA 2DVMA 3FLMA 1M7GA 3WKDA 3PXAA 4XRGA 5JI2E 1Z0FA 1BZYA 4QYMA 1D9XA 3ECAA 2FRVA 3CPEA 1SGVA 1XB2A 2JFOA 4GEKA 3VSBA 4EG8A 3QE9Y 2GZ2A 4RU1A 3PJDA 4P92A 2P9HA 3C4JA 3QENA 2H1CA 1YFZA 3TXYA 4HNVA 4V0SA 5ICSA 2D4HA 2FA9A 3B1ZA 4I3GA 3RASA 3RRZA 2J3HA 4G0PA 4OP2A 4JKOA 1IRXA 1NVBA 1OWNA 1TJYA 3I9V1 1D1PA 1KSFX 3NKVA 1VLHA 2LVBA 4I7EA 1IWBB 4ES6A 4BFTA 1XRRA 3OP1A 1MABA 1Q0LA 1UBCA 2VAVA 4NV1A 2JJQA 3MUOA 1AZTA 4TZKA 5JD5A 2XUOA 3AQIA 2GTHA 5FUXA 1X15A 4JYBA 3L4BC 1TCAA 1TI7A 2CLSA 2RAUA 5HKKD 1MOSA 2VF8A 1XNRB 3KQQA 4NY1A 2B8WA 2BEVB 3UAZA 4CKBA 3Q3HA 3NYQA 1HYGA 2AJBA 2DX7A 3SYKA 4D98A 4F3YA 4KFTA 2J5BA 3MG9A 3VDQA 4JVSB 4AF6A 4QUHA 2VP6A 1JHQA 1NURA 4C0QC 1V6SA 4MGYR 4BO9A 2KYRA 3FHJA 1ZGAA 3H4IA 4HGPA 5HIAA 3KPWA 3LL7A 1OTXA 3QIVA 4DDKA 2ONYA 1QV9A 4X6YA 3I9FA 4K8OA 1ZIOA 3E4CA 2DKOA 1VKOA 3FFTA 2ZBFA 3HCFA 3Q87B 3IMFA 3L0BA 1QE0A 3NJ8A 5DHFA 5A71A 4F3NA 5HYVA 2QTTA 3DV2A 1SG9A 1NG1A 3JRXA 4NEQA 4XM2A 2VQFB 1H2AS 1HE2A 2QR3A 2AN4A 2QPOA 1Z0AA 5DP1A 1UANA 4Y7DA 3T38A 1T29A 1BRMA 1HQCA 5A6SA 2O8CB 3RSFA 4UBMA 3S1AA 2Q21A 1CERA 1CVIA 2A33A 2A6PA 3UW1A 1BA2A 1UT5A 2ECFA 1O6FA 3BMNB 4RWEA 4JR0A 3I1YA 1KSJA 1NW7A 1R4NB 1RJWA 2GO1A 3HXPA 4YGYA 1FP4A 1MVLA 5LLDA 4EAAA 1R5NA 1B23P 3V7WA 1JDVA 2JKZA 4GE0A 2ZJ4A 5TGTA 4EA9A 5CDHA 5BR7A 5IF9A 2JD1A 2ZJZA 1BHJA 4M9CA 1UZAA 5TQJA 2HIHA 4FDUA 3ZXNA 1ZI8A 2B8TA 3HBLA 4Q12A 1W88A 4YRFA 5KBYA 3TNJA 1H2ZA 4NJEB 4ZAFA 1LK0A 3AHEA 1PHPA 3BJZA 3G82C 3I23A 4FFVA 4MKHA 4UXIA 4ZOBA 5D3MB 5E1MA 5I4KA 3HJFA 4AI6A 4E08A 2NU6A 2NZVG 4EKYA 3I53A 5AO9A 2YMQA 5EAIA 2O8FA 1UKEA 1RXEA 5A7GA 1B42A 4W5QA 2VBIA 3MWLA 2H9IA 3IVMA 4HJRA 1FW8A 5EESA 2XHZA 1F7VA 3V1MA 1U81A 1IG0A 2P9FA 2VYFA 4W8HA 4P36A 4UZEA 4M9ZA 2VJMB 2Y1LA 2AQHA 3D31A 4MX8A 1PUIA 5IH3A 2CCJA 5L3RA 3G9QA 3K0EA 1UP7A 2QUAA 3WHKA 4LPKA 3N0XA 4DLPA 4CM8A 1K3FA 3FDFA 3U5ZB 1IWPB 2HQOA 1YBFA 1MT3A 3E3LA 4MRMA 1KH3A 1U8UA 1DKNA 1JR4A 3O73A 3WZLA 1KI7A 2QF7A 3ULKA 2FFBA 3NHUA 1TVKB 4LKOA 4Y2XA 5BSRA 4ED9A 3RLIA 5K0BA 5ILOA 2HRCA 1VJ0A 3FF4A 3IT0A 4RX1A 4RK4A 3ZKWA 3MHPA 4FXPA 3AU8A 3EASA 4C6HA 4EAQA 4EYOA 1PZNA 3EVDA 3RVNA 3VNVA 2BFCB 1P18A 2J3LA 4EENA 2WWHA 1XMJA 4FR0A 3TQSA 4CV2A 3DPIA 2EX4A 5ABPA 4M1SA 4QOEA 4RLFA 3BD9A 2B2NA 3JU3A 2IF2A 1M67A 4MPPA 1BN7A 3DV0B 4J4HA 1O95D 2WFAA 1DAGA 2YXLA 2C2GA 2H9YA 3ZW9A 5JC8A 1L5SA 4RK7A 1DE0A 4CLEA 3D8TA 5LZ8A 3QF4A 4G89A 1JYSA 1PO7A 4DMLA 2NUPB 4R84A 5C80A 5AVUA 4E88A 3AGQA 3FAZA 4PHHA 3RYIB 4ZK2A 2YNMA 4JVMA 2YMLA 3FWZA 2ACEA 4H7PA 4C2AA 5K8JB 1Z0JA 1JJ7A 1T13A 4U2GA 1OX4B 2WICA 1I0LA 1ZU4A 3UCFA 4F85A 4F9EA 1K7CA 1WKBA 3FYUA 3SSOA 2PZKA 4RPCA 4H3VA 4X3OA 5JZ9A 4PPYA 1V2GA 1PGNA 4IH1A 2AG5A 2AOUA 4W5WA 1EXDA 1U80A 4GMXA 4FR2A 1L8XA 1G4HA 4Z9BA 2A35A 1VSQA 2C77A 4G0YA 4YACA 1KMHB 1TEHA 1YJXA 4F45A 4WACA 1E0KA 3TZCA 5CB4A 3ECCA 1J23A 2PV0A 1BAPA 2XYRA 4G4SO 2AFIB 4KE7A 1EWRA 5G0VA 4S1VA 4JUCA 3N9IA 3NUZA 2AJ8A 4WV3A 4DW8A 3UHFA 4E09A 2YWDA 1Z34A 4J0QA 2ZT6A 1SHJA 2NYVA 4RTQA 3WWCA 5CDTA 1FNMA 1L5KA 3LZCA 2I2BA 3UT6A 3VYRB 5HW0A 3WYFA 1XF9A 1H2RS 2LZ0A 1ZN2A 3PKIA 4LRQA 2CWDA 3T9BA 5BWBA 1Y8CA 2BFEB 4M6WB 1SZPA 1DFIA 2TECE 3P8ZA 3GLUA 2B1JA 2A0WA 2VWPA 1OJLA 4NNJA 4W9NC 4FFNA 3F5SA 1KZHA 3JQ9C 2R97A 4RJLA 3QELA 2KQUA 4O1HA 4AT1A 5BSHA 1MD9A 2HFKA 1LQ2A 4XW2A 1C9DB 3FWKA 3M5WA 4MOWA 4WOPA 4EABA 3N86A 2BELA 3AG6A 3GYBA 5SYMA 3TVDA 3ACBA 4CT0A 2LV8A 4DJTA 2PCJA 2HSWA 1S0UA 4UZFA 4Y1RA 3DMYA 3FVTA 4RPIA 4FMBB 1J5XA 1V45E 3K70D 4HGOA 4ZI5A 2MINA 1GQSA 3MMZA 3QLVA 3WJ2A 1SBZA 3K20A 4DCTA 5FEUA 5JECA 2Y0PA 2AH5A 2HWUA 3KQHA 3E35A 3OOWA 3L4JA 5C53B 2HSZA 5FI0B 4HRYA 4EY3A 3CNEA 3HYCA 1RDFA 1V3VA 3ND6A 1A50B 5DBGA 1RKXA 1DQRA 2FEKA 2F64A 3F90A 1EVJA 4YCJA 1QHHB 2GYYA 3SJAA 3I34X 1HX7A 4B8WA 3TQCA 4KACA 5CXUA 1SXJC 2HHAA 1JBKA 4CHTA 3P9CA 4UM7A 9ATCA 3F5MA 3QYFA 1TYAE 2OHVA 2ZVPX 4UBIA 3GJYA 1E9FA 2QN8A 3F3YA 4A7PA 3PC4A 3FTQA 1G21B 4AL4A 1T26A 3I2KA 4LTDA 1P0IA 3RT9A 3RBZA 4HQLA 4DNXA 3TTUA 1NUUA 1QNFA 1P7PA 1K8ZB 3WMRA 3X43A 3ZCXA 4CT5A 5BT8A 5KYGA 1L5QA 2DYKA 4WN3A 3FCXA 5LC1A 3VMMA 3M5CA 3FI9A 2QRVA 5HRAA 3EYAA 5ARBA 1G3UA 4ESEA 5JNVA 3JQ8B 1YTLA 4RZHA 3VH2A 4QDTA 1PR3A 5GJVC 4RAOA 4WKCA 2IHZA 2IYFA 3LY9A 2QVZX 4OSPA 4QFMA 1W2WB 2GJAA 2IY7A 3MERA 2ZRQA 1ZD8A 4J7UA 4PFKA 2V8BA 1IJEA 2G82A 3L0SA 3MGGA 4JROA 3VPBA 4ARUA 3FB4A 1XKXA 1WX1A 3BULA 4RVCA 3QYAA 2L2QA 2H2HA 2O3SA 4AY5A 4C4OA 5JCOC 1K98A 1SU6A 1BD3A 1QE3A 4JJ4A 3X1KA 2OZEA 3D02A 3AEXA 5K8LA 2OVFA 2VA8A 4BMVA 3F46A 1DU4A 3EXFB 4XDGA 5F7ZA 2BZGA 2AG1A 5BQFA 4ARBA 1QWOA 3QLJA 2PVSA 4PSUA 2IWHA 3RK0A 4E3WA 1W36C 2UUBB 1KMIY 2CFIA 4Q9NA 3ZN2A 3HEBA 1ZGBA 2AWOA 2RHBA 4QHYA 3SM3A 4DT1A 5EJMA 2H2IA 1IDN1 1P72A 4EG7A 1ZGGA 4FD3A 1PR6A 4YR7A 4QUGA 4UUMA 1E4YA 4Q3EA 2GB4A 5KJCA 5KOYA 5FBZA 1J70A 2QS9A 1E5VA 3HUTA 2PK3A 4G8DA 3DZBA 4WESA 4XWAA 2P4EA 3AVTA 2Q28A 1O08A 2FPPB 2OEPA 3HVIA 5TVKA 4YUYA 4H17A 3FMGA 4Y1FA 2NACA 3WBJA 4I4LA 3ZHZA 4X93A 3AL0C 3IKVA 2PE5A 4UKDA 2GHRA 5BNTA 5ARDA 3HU3A 3QHAA 4E2ZA 5KWJA 4DGHA 5MN6A 1K8RA 2HT6A 4JOQA 2N75A 1P7YA 2FDCA 3D7NA 3IA7A 2QYOA 4F2GA 1F60A 5LP6A 3RRBA 2JIOA 1PTKA 3N6XA 2ROQA 3UHOA 5ALPA 1CUGA 2Q3MA 2APJA 2X2PA 2YRFA 2IH4A 1C9YA 3VAAA 1P75A 4CIYA 3T1HB 2AJTA 1IOVA 3HKCB 4DB4A 3T1YB 4M7RA 1XZ8A 2Y8EA 2JB9A 4ZQFA 4M0DA 5K3FB 4EY8A 3SVLA 4PZZA 1OFVA 4F8YA 2OAGA 4YY3B 3ED5A 3JVDA 4F1KA 2YNMD 2IH2A 7REQA 4N3CA 3ZE1B 1N0UA 4HRVA 3MPUA 5CMLA 1E4EA 5EJGA 2IX9A 2ZJBA 2GARA 4RZIA 4EGQA 4N9WA 5IABA 1Y5RA 4MW2A 1BJKA 2J5RA 3D59A 2UVPA 4XUEA 3FPLA 4AROA 2QL6A 1AE1A 5TX7A 3RK4A 2HREA 4B7AA 4GQBA 4IDFA 3WL6A 3RCBA 4YYZA 3U19A 1Q21A 4YI5A 3V4OA 1K4YA 2IU6A 1E92A 2H48A 3QW4B 1RRMA 1U2SA 1GSAA 3M6WA 2AX3A 4YRQA 7AT1A 5D3ZA 4WZAA 5KNBA 1T9GS 4CEIA 1N6RA 1ZLYA 4D8VA 1OUMA 5ES3A 3JD3A 3OPNA 4RZUA 4FR5A 5DOVA 2CV1A 2OL4A 3OOHA 1FOEB 1UJCA 1RXVA 3GFQA 4UVHA 4N03A 1LLCA 5A4KA 2B0CA 2VXBA 4DQLA 1E62A 4LQ4A 2QRJA 2B2XA 3AUAA 3FB1A 5EE3A 4PE5B 3PXGA 3W78A 1A76A 3H05A 4NVRA 1IHYA 1RWMA 1YRHA 1TQ2A 1VCHA 1NVMB 2HV9A 2OP1A 1AOXA 3FVWA 5J47A 3LQRA 1YUMA 3HU1A 4HSGA 5CLQA 2J33A 4DGQA 5EJ9A 3P9NA 5IMSA 2H1HA 3G89A 1XDBA 4L2IB 4UNNA 1N0HA 1UFVA 3VR6D 5BPFA 5JNRA 2BGMA 2IITA 2P8SA 3BGOS 5I7EA 1J2BA 4UOEA 2GF2A 2BDUA 4Q9AA 5LU9A 3NRJA 2JARA 2B9EA 3OHSX 1KKMA 4TXHA 3VDNB 3VPDA 2F8MA 4F1JA 5CM8B 1BOOA 2Y6VA 1JAYA 2YV3A 5KSZA 2WD7A 2YTZA 2XBMA 1LK5A 4JK3A 2XQGA 5CVJA 5EMJA 4YB8A 1SQWA 1XNJA 4LJ5A 5BPHA 5CAEA 5IKEA 4XJSA 4LZJA 3UPDA 3L1JA 4C7OA 1DBRA 4PXYA 1WHTA 3E0QA 4AKSA 3CEHA 4NG5A 1H1DA 2XW6A 3EQ7A 3FNHA 1COZA 4D5EA 2W2PA 1MUUA 4XGIA 3TMAA 1F2UB 4DMMA 2DTDA 3FETA 1Z74A 2YIJA 3PR1A 4PQGA 4YTEA 1C4KA 4OA8A 5DASA 4AJJA 4YQFA 4AMVA 5KYWB 4JYAB 4L95C 5D6OA 4EG3A 3KWMA 2YV1A 3TLAA 2G5CA 1NLUA 2NT3A 3DQZA 2DZDA 4FFLA 3WLFA 4B7XA 4A8TA 1OLXA 1UOYA 1LY1A 5DI3B 5CITA 3PX3A 2AB0A 4YJFA 3LTNC 1R3FA 4GNKA 4RMIA 3D03A 4A73A 3D3KA 1E9VA 4K3UA 1KQ3A 2RI1A 3GT7A 1FFGA 4JBGA 5KDLA 2YOFA 2O0KA 2J3QA 2OSBA 3ESCA 1K8YB 1QIHA 2FDRA 1EX6A 3TLGA 1P6XA 4O4LF 3NDRA 4WXEA 3K72B 3OCJA 2B4AA 4Q9DA 1QX4A 3K8QA 3OJCA 3WVNA 4TKVB 4PV7A 1WNFA 1DAPA 3R4CA 1TGVA 1KZ7B 1V4NA 2IZ6A 1SVKA 3L1VA 1BMQA 1T3LA 3PX2A 3WLRA 1L6IA 2OBXA 4JZKA 2QMHA 1U2ZA 3B3FA 4NL4H 4EELA 3DKRA 4TQAA 2PWBA 2X8WA 1CLEA 2BFAA 2NNLD 2J6CA 4R8LA 2D1SA 3V9PA 5CLLA 1JQJC 4NU5A 5EHQA 2A0YA 1MOZA 2A4MA 4ZZ2A 4DEVA 4MAAA 5ALVA 4RE6A 5BWMA 3DBHA 4AIIA 1I2AA 2V7UA 3C48A 1Z15A 3E9MA 4MKGA 2XQIA 1NF2A 4JXJA 4FTWA 4MS1A 1KJ8A 4LMAA 1O58A 4G63A 1QSGA 1X7DA 4GXNA 1RQRA 3QWBA 2CN1A 4JR2A 3PQDA 5DCUA 5DB4A 4B6JA 4N5DA 2AXEA 1JW9B 3RROA 5JXGA 2P2CA 3KQOA 3IAUA 3L7YA 5E9AA 4FGSA 4EA6A 5AICA 1AG9A 3O8QB 3RYCA 2NO1A 2BISA 2A3NA 1H0KA 3PQ7A 3Q8WA 2RARA 1ZQ1A 1FTQA 3FUWA 3TE7A 2ILTA 5FOUA 4F9TA 3N7UA 1B6RA 3ZZTA 3CH4B 2Y0DA 3H2ZA 1YI0A 2R5NA 1DAFA 2X8BA 1ONBA 1GL9B 1R0WA 2XUIA 5CFPA 1DFHA 1VI5A 1KRHA 3ZIAD 2Q8QA 4NZ9A 5AIAA 2NO9A 2EFYA 5EE5B 3FHTA 4DVJA 5I7RA 5B7NA 1B93A 2DF8A 2RGNC 4A8JC 4E94A 1FCJA 3VNQA 4ABTA 1XIVA 4B73A 1II8A 4KWHA 4M9UA 4PX9A 3AP1A 3TUJC 2Z58A 2C82A 5DXAA 3OD5A 1KDVA 3O0DA 3QBDA 2BKXA 4XCQA 3SR0A 2WWRA 5ECWA 1GCIA 1M0EA 3I2JA 3OIUA 4QT0A 1EGAA 4CQNA 3HP7A 3WZ2A 4BWFB 3I05A 2CDBA 3JQDA 4NAVA 1P2FA 3UAGA 1R16A 1O5TA 1QH8A 2JD0A 4TYQA 3A3PA 1T3HA 1FC7A 1JVNA 5AOBA 1CZHA 1L7RA 3DE1X 3O92A 5ECDA 4BNGA 4EK9A 2RHLA 2KSQA 5EFZA 1JQKA 1KFKB 1U2TA 2IYPA 4UUQA 3S29A 4AJHA 3OQBA 3BD6A 2CDCA 2NT4A 2HHJA 3CG0A 2WI8A 1Q50A 3V97A 4Y0AA 4QLBA 1M2JA 3REQB 1ST2A 1XA3A 4QQKA 4AP6A 4FIZA 3P2YA 5CB0A 1T6BY 4ZZIA 4IIVA 3I5XA 4P1ZA 4MHTA 1T6ZA 2I2XB 2QR2A 3AFOA 3TEMA 1Q7HA 2C1XA 1G3MA 3GFSA 4TRJA 5CHYA 4E5DA 3NBMA 2VJYA 4PRYA 1GEEA 1E6KA 3C74A 2IZZA 1MZVA 2P1RA 4BRSA 3EGWA 1I4DD 3Q7IA 1NBWB 4N5MA 5F73A 5CT5A 3VDXA 3SF8B 1NF9A 1AMOA 1J24A 1XLWA 5IJWA 1KY3A 3SJBA 1JQAA 1QKKA 1RCUA 1YJCA 1TA9A 3TF5A 1SIBE 2RKWA 5KNBD 4N82A 5I9LA 1JDBC 3N6VA 2P67A 2WKPA 3V3TA 1I01A 3I2IA 3UK7A 3NAZA 1D6MA 2Q9CA 4D8YA 4CWAA 2CLDX 1KOJA 2O3UA 3SVTA 2AUTA 1HV8A 4J6FA 1ZJZA 2IOYA 3C6QA 4IIHA 3BXFA 1MJ5A 3QXXA 1E1NA 2NLOA 3L79A 4LDRA 4OHMA 4TL9A 5CFNA 3R6TA 4CCWA 3SSNA 1K3UB 4LJLA 1R9JA 3OJOA 3UMRA 5BR4A 5C18A 2Z3VA 2IIPA 3O4VA 4K28A 1N1DA 1I51A 1VMIA 1XG5A 1EPUA 2CMKA 4RCZA 1L7VC 3DMTA 2BGNA 4ZO4A 5DX8A 4GQIA 3AV0B 2C31A 5D01A 4O8CA 2WLTA 4BVFA 3O38A 3DTVD 3S40A 2F9FA 1NSFA 1R74A 2DKNA 3ZD6A 5CU7A 2RH9B 5IM5A 5JMWA 1EGMB 4MYDA 1I8TA 1X14A 5SY9A 2OQVA 3HFGA 1G60A 2Y77A 3GJ4A 4IGEA 3V8VA 4GT1A 5K1ZA 1KXJA 2FMIA 4DIFA 3C8UA 3BFKA 3GDFA 1OR8A 1Z9BA 4YRNA 3MWYW 2AQ8A 3LXRA 4KGVA 3HAXA 4YQZA 3R76A 4UTZA 1X8JA 1GGJA 1X7YB 2Z9DA 7ADHA 3S28A 1YONA 4AZ3B 1SC4A 4XVCA 1CYDA 3EC7A 3I8OA 5HTOA 1R5OA 1CF4A 1PK9A 5ALFA 2O52A 5EHXA 3SWWA 1H05A 2VJAA 5A3RA 4A0QA 4CYMA 2FW7A 3SQMA 5BR1A 1Y6JA 1M6VB 4NOLA 3QOFA 1BXKA 3UANA 2Q46A 4NDNE 4YREA 3WK7A 1WKVA 3MGBA 1HZJA 3R7FA 4ZQCB 3T5MA 4EYEA 4ER6A 2FSVA 3WTCA 1ZM7A 2C9DA 4KN9S 1CR2A 2H4JA 3JQ7B 2DU8A 5JDCC 4EB6A 2HLNA 1DJPA 4RVHA 1IRIA 4WK6A 1VE3A 1MF7A 2JAHA 5JBIA 3A6LA 3QI7A 4WLFA 1Q44A 4CG1A 4DV6B 1H0RA 1RTTA 2C92A 3ANYB 3D7SA 4UDOA 2NV6A 1ZRNA 2ZITA 3KB2A 1LSOA 2YY6A 3ZGLA 2AG0A 1VA4A 2VNJA 3UGTA 4RD6A 1DC3A 4W6ZA 4BP9A 3SZ3A 1K92A 1JBEA 3CPHA 3R6WA 1Z45A 5KKAA 4BFLA 1B73A 3U0BA 4DQ0A 4U7GA 2G1KA 621PA 1E8NA 2J3KA 1JHAA 3K1JA 4QIHA 3CB4A 1X38A 3TBKA 4BRUA 5K0TA 2BZ0A 4JU8A 4BFXA 3WIEA 4C4PA 3PHBE 2C7GA 4BMNA 1PEAA 2IOFK 3AHHA 3V7UA 2J0UA 1HH4A 3C3MA 1F3LA 2W2KA 4NYIR 1SC6A 3RYHA 4BNTA 5KYYA 3TGWA 4WOBA 4JLAA 3UOAB 3GC6A 1CJSA 2FSFA 3CSSA 4JLNA 5CGZA 5DWQA 1LTHR 4K46A 5JHGB 4LC9A 5CK4A 1Q77A 2W2OA 2ZJ0A 4L22A 1RU3A 3HVKA 5AKZA 3C6MA 1AKNA 1I1OA 1MNQA 3QEOA 1QVAA 3O8OB 1BHSA 2YC4C 5DOZA 1TM1E 3Q98A 3I8SA 3JYHA 3MGAA 4M46A 1DX9A 3EODA 4XQEA 3TYXA 5BYAA 3MWEA 1OZFA 4HD8A 2Y4NA 2QL9A 3DJYA 4JJGA 5IZCA 2BGUA 4L07A 4IIUA 1GGFA 3SHFA 4B6QA 1XZBA 4L4SA 4LW8A 4RTOA 1DKRA 2O23A 5H0IA 3D3UA 2FWRA 1TZMA 1FX0A 4YP1A 4TYMA 1QC5A 2DJIA 2IEGA 3L7BA 4H15A 5FFFA 4HEQA 4HK4A 1ZOSA 1X74A 4I1YA 1VJTA 4ND3A 3M9LA 2RKOA 2PZGA 4UUBA 4CUJA 1USUA 1UC5B 2JFYA 3D7KA 2JLRA 5EJAA 2O1WA 2IYUA 3SJCA 1JSZA 1PVVA 2BJWA 3CU5A 5FFNA 4RS4A 3PNVA 3L0CA 5FTWA 3QI2A 3T3EA 3UYKA 4IQGA 4BNUA 1PR4A 5F5XA 5CBPB 4DGSA 4U7JA 3P26A 5CDYA 4B3XA 4DSTA 2X3FA 3Q88A 2W7TA 3B3AA 3HJGA 4HUTA 1CVRA 1P2VA 1E7MA 3AKDA 5FWYB 4CR8A 2C2WA 4XGKA 1HDYA 1PS9A 2I0FA 3H9UA 2JRCA 5AVTA 4OHBA 1G6OA 1W0CA 3RLFA 3LW7A 5ANRB 4B6PA 1LK7A 2AEFA 3A1VA 3D4BA 3PUZA 3IEKA 2WHYA 3K1TA 4OFZA 1FQKA 1KMQA 3IODA 3PC8C 3ON5A 3EH2A 2GJKA 4R83A 1Q19A 2GD0A 2VNHA 4ZQGA 2QROA 2JG3A 2FAXA 5KNBH 3DE3X 5IBRA 4NV3A 4R1QA 5KTRA 4TV9F 3WDLA 1BWRA 1LTKA 1VIMA 2CMDA 5GV7A 3IAFA 4HF7A 3IQGX 5EP3A 1GTMA 1P1JA 2JBAA 1XK7A 2GBLC 2PJRA 3DEIA 2XVXA 2J0EA 4QU9A 1KE2A 3DEJA 4NENB 1U65A 3HU2A 2B4QA 3MWFA 4LNAA 4OKSA 4ZKDA 3Q2IA 4BGDA 3THXB 1N6IA 5DM70 1AN9A 3EIOA 3KXKA 1PWEA 2E49A 3T5BA 1VMDA 3FUXA 2O0JA 4QYXA 3AO0B 4FW9A 4O2RA 4HDMB 5ETJA 1TDJA 2ZI6A 3A4IA 3WAGA 1X7GA 5L7YA 3JARA 1YIAA 3EVFA 1B74A 3EGDB 3GRYA 2IEDA 4ZP1A 4D43A 3RAEC 2WUVA 4AG3A 1EGQA 1HO3A 5HKLA 5BYKA 1MIOB 3DTTA 4Z5XA 3BGIA 2CLMB 4JUBA 4JHLA 1KI6B 4OXIA 5DTRA 5I9NA 4GWKA 1WOMA 3RUAA 1CDZA 2QI9F 2BP7B 4MPDA 2DXIA 2OXFA 4YMLA 3PTZA 4H7IA 1TVMA 3JAWA 1RSZA 2WSLA 4KBYA 4NBKA 4J4TA 2YDYA 5AVSA 3G88A 3MK31 3QIAA 3T7AA 2ZAIA 2QKYA 1DC6A 2XUDA 3CISA 1CUXA 4X60A 5GONF 1P3Y1 1P2BA 5ENZA 4EJSA 3L8FA 3B1YA 3H2KA 4HNHA 1XEWX 1Y8RB 3PHCA 3FTCA 2RK3A 3PCRB 2HLDA 3PNPA 3PRJA 3F6RA 2J31A 4P3PA 2SNIE 1H6DA 2J3JA 5CRIA 3PPXA 2P7IA 4U2FA 1M1UA 1OZHA 3QUBA 1IQUA 1QIDA 1R4ZA 1U3CA 3T7RA 2WU4A 2CEAA 3DOFA 4KQKA 2VBGA 1PJBA 3ICQB 3EIUA 4A6EA 1PW5A 4TTAA 1P62B 3P9PA 2IXFA 1MO5A 4EJMA 3VO8A 1E61A 3PDJA 4HB0A 1VI2A 2ZRKA 3CVXA 4XVQA 3B78A 1HUQA 2WUFA 4WSOA 4NYMR 2PMEA 1QR2A 1KGSA 3DVAB 4NH4A 2I6QA 1TQ4A 4ZOLA 1H8HD 4XASA 2ORYA 2PR2A 3M81A 3DO5A 1WUHS 4IP0A 5BQOA 4GI5A 1RIFA 2DR2A 1EBFA 3UK0A 1UPUA 5IXSA 3BWXA 2CL6X 5AI6A 5ALMA 4HY3A 1N2OA 3EPRA 2EJCA 4ZALA 2FR1A 3DBLA 4CEJB 4E32A 4FFMA 3U0VA 3UT5B 4CCSA 5I6DA 2WYHA 1P7ZA 2X8JA 2A1UB 3V8QA 2GN1A 1JS1X 4QPCA 1P6QA 3EW9A 3ZYZA 3BL8A 2W6ZA 2B61A 1I4LD 3X1ZA 3G2JA 3HV0A 2ZCUA 3OUZA 3MB8A 4GRDA 3KFVA 4P2BA 1TE7A 4Q66C 5ERGB 4C20A 3N2GB 1C7QA 3Q9LA 4UFNA 5JDIC 4DSAA 2OESA 2IYRA 3OZDA 4D3SA 2Z0MA 1AQ6A 3NGLA 3WSTA 4HNTA 2ZRPA 1UBEA 3U3OA 1ZIXA 3EOZA 4FFDA 4TSFD 4U2KA 2WTUA 2P38A 2YH2A 3C3KA 2E1RA 2A84A 1C30A 2V7TA 2QMZA 1HEYA 1RZVA 2OAEA 3C6BA 2HB6A 3Q72A 2JZOA 1L5GB 4P4SA 4Q9KA 4Q9LA 3TIIA 4Y6OA 5ALSA 4R4JA 2IDJA 4H7DA 4KGXA 4CCYB 2WTBA 1NR1A 4XOIA 2VDMB 1BDHA 3DM9B 1PEDA 1KO4A 1KBQA 4OAOA 3JQCA 4CTNA 4M1OA 3QKRA 4GVPA 5T4HA 4Z6KA 1TM2A 3JQAB 4XS5A 3JZAA 4UQPA 5JI3E 2ZSDA 4QXRA 5DK4A 1ILWA 2ENUA 4CKWA 4XIYA 4I9NA 2PZAA 1XZAA 4LPSA 4AJKA 2C99A 2E5WA 2QYHA 1U0HC 1K7EB 4KGZA 1P9RA 4WX2B 5F1YA 1Z18A 1Z5PA 2KBFA 1FXWF 3JYQA 3LY8A 3R0IA 5TB5A 4LNHA 1GU1A 4W1PA 1T2DA 4MW5A 1HNWB 1E0SA 4LFCB 3F3SA 3W77A 5JS1A 2FF5A 3FPJA 4OQ4A 2EYUA 4IHJA 4LOHA 4R3NA 4RY2A 1W59A 3JWJA 4M49A 3I04A 2VF7A 4O2BF 1U11A 2VZLA 2OBYA 2WKRA 3AKYA 3V5NA 3K9HA 3U3KA 1XCGB 3WLOA 1EFHA 4LCJA 4R9NA 5E6RA 5HS6A 4LMPA 3MILA 3VVBA 2MSKA 1G8GA 4OMDA 1RLTA 1VDZA 1XSEA 4JVOA 4AMBA 3PG5A 1KPHA 1V11B 2X19A 2GF9A 1JPUA 3I83A 3B7PA 3B82A 3NOVA 4L76A 1M2OA 1EWKA 3A1EA 3MJEA 4PZCA 4RC9A 2IS4A 4CKCA 2E5FA 1WABA 1QWSA 4R7TA 3DE4X 3DBVO 3VZRA 4YUVA 2IBMA 3Q2OA 3KQLA 3EWSA 3NX4A 1RQPA 3BYZA 3C6ZA 3U48A 1KAMA 4DY6A 1T9KA 1YVEI 1U8TA 2C7BA 2FLVA 5KKCA 3ISJA 2G04A 2AC7A 4OHRA 4EX7A 4J7CA 1ZM9A 2ZU0C 2XT6A 3TN7A 1U0TA 3IKJA 4JH0A 5FOVA 2REOA 4YP9A 2YHUA 3AP3A 3PE4A 2FSSA 1CVLA 1B8PA 5K4HA 5E1DA 4E30A 4DQXA 2XMPA 1QQ7A 3BB3A 5JVDB 1QVZA 2FU5C 2V6JA 3PUXA 1D2HA 5F64A 4HQFA 4E7PA 2XDQB 1ZM3A 2NXNA 2BM8A 1AZLA 2PX6A 4HDKB 1P1KA 3EUEA 4LE2A 3ICVA 4OBEA 3KVRA 1JJVA 3TRKA 3TRFA 2QZSA 5DHTA 1WCV1 4X41A 4TYNA 3H5LA 2AZ4A 4DL9A 1E9CA 3KYJB 1IYZA 1WXHA 2PKEA 3QITA 3VYWA 1VE7A 3RDPA 4RMHA 3COJA 3EXHC 2D5IA 4Q03A 3OCZA 2HF2A 3OZFA 1IMOA 4JBHA 4RCVA 4X8MA 3WIBA 3P2KA 3AKZA 5IJ0A 5LQNA 1LI5A 2LKCA 2EWVA 2BEUB 4PR0A 1G41A 1M34A 1XCBA 1CE8A 2VK2A 2Z4SA 3PRHA 2WMOB 4N3NA 3SX0A 3SC6A 2WB2A 3RU9A 1K3TA 1GZDA 1VDMA 2Y1CA 3O4IA 3Q15C 4PRKA 5EKTA 2BGIA 2I80A 4G9GA 4W8OA 4YA6A 4RV5A 4HAZA 4PSVA 3MTIA 4AKEA 2XOKA 2HLDD 3A6KA 3DM5A 4J75A 3BXHA 3T9CA 3ZCUA 4D0GA 1Y9ZA 1BH2A 3KBBA 1SA0B 3MOIA 4PZPA 1M66A 1PGPA 1KIAA 4G1FA 4Q4AB 2JAOA 5LB2A 3CZCA 3RVRA 2FKNA 2H00A 3AJ9A 5EKXA 3TH5A 4FU0A 4DGFA 4KVZA 3TI7A 1J42A 3VJLA 3F6PA 3W04A 2EFEB 2CNLA 1T0UA 1HC7A 3FCUB 3PGVA 4KRYA 3JZIA 4PIVA 1BC5A 1XWIA 4A6DA 1TADA 1F8FA 3Q40A 3EIHA 3F6CA 4MV8A 1R18A 3REFA 3EPKA 2XBUA 4DSZA 1YZUA 5KDOA 4DVGA 5LDHA 3CZAA 3QE2A 1YS2X 2R5WA 3C0KA 4MEBA 3TW0A 1EFDN 3II6X 4OFBA 4Q4CA 3HXMA 2REXB 5DBIA 3P27A 4DY4A 2CKMA 2Z1MA 3HO1A 1GTG1 5HIJA 3DTNA 3TM4A 3GUVA 5FR1A 3H19A 2ZM5A 2BF7A 2CUNA 2OFPA 2XCLA 2CNBA 2G4LA 4HZUB 1JFFA 3RARA 1VLQA 3DXXA 2IYVA 4PG6A 4EF6A 1GZ4A 2HIAA 2PWZA 4XE5A 4DBLE 3B85A 4H7HA 1DRKA 4C4AA 2VPXA 2ZJ8A 2WYWA 3TLXA 4P2GA 3R7DA 5AM3A 4ZVKA 4C7BA 1LBEA 4NE7A 4KLZA 3CONA 3W5DA 1SU4A 2QTBA 5F2OA 4X85A 3R7BA 4ENSA 1OHHD 5LD2C 3FHCB 5KCMA 4C6TB 4D45A 3A4YA 4ALIA 2NO7A 1XPRA 3UWDA 4CBVA 1WBDA 3T3OA 4E14A 3OKCA 5FADA 1CUDA 3AUYA 3NM6B 2NYAA 1REQA 1S8FA 2RHCA 3CW2A 1VCMA 1RMTA 3EA4A 1KDTA 1ID1A 3GA7A 1V37A 3IAS1 3RC8A 2HK6A 3ZHOA 3FOBA 4HLUA 5WRFA 1EDZA 1OC4A 4G4GA 1F6DA 2BC9A 4HLDA 1RE1A 1RADA 1YMQA 2JNWA 5GJBA 5B7GA 2DWPA 3ZV3A 1IM8A 5JH7B 5FF9A 3D8SA 2XCSB 3IIMA 4B9EA 1JALA 4FD2A 3CMCO 3DZDA 2XT0A 3W5VA 1TMOA 3VU8A 4INOA 2FWNA 1GADO 3EZ7A 4IPTA 5C4MA 2H4FA 3H0EA 4RFSA 4S12A 3BFXA 3I0NA 4G0ZA 2YN0A 2ZRIA 1BWQA 1DLIA 1WU8A 1MOPA 1A96A 1WCWA 2GJ8A 2UZ3A 3CF6R 1SUEA 3K3PA 4IRMA 4LBWA 3WXMA 3W5BA 1PL6A 2UXBB 4O6VA 4YC7A 4A0FA 3GLIB 3QDQA 3DFMA 2D59A 4RSRA 2C5SA 2PU7A 1PQ4A 3URKA 1KK2A 3EXG2 4Q16A 4EATA 3M4YA 1EVKA 1C9EA 4HVAA 2A94A 2B36A 2FZEA 1XNGA 4BXOA 1YR9A 1PIWA 2PMFA 1GZ5A 3JXEA 3N7AA 2Y66A 1P1FA 2IIBA 3B3GA 4YO7A 4R68A 1Y7IA 1YASA 2EKLA 4UXJA 1IFXA 3VOSA 3GDGA 1UXJA 4F0JA 4XB6B 4Q3LA 1U7HA 1NL3A 2K87A 3L82B 3O93A 4REQB 1TMKA 3SCZA 4JP2A 3VC7A 5I48A 1PZHA 2R8BA 4IYJA 5CT4A 3STYA 2OGTA 4OL9A 1PR9A 1JHXA 4MS4A 3IDAA 3LECA 1Q1BA 3G3EA 1VSBA 4V0OA 1FNDA 5DTIA 1XE3A 3E9RA 1VZ3A 3N53A 4O4HB 3TD2A 4GQAA 4YRRA 3OIZA 3ZVLA 1U8YA 5C1PA 4FWBA 3V80A 2GILA 3DQQA 1PFQA 1I3NA 4HB3A 1U99A 4IVNA 4ZO7A 4L85A 2GGSA 2Q2NA 3AEKB 2Z6AA 4ER0A 3H4TA 5BO5A 1EI9A 5TSDA 3F6YA 2V1XA 4GI3A 2EFDB 3ZQUA 2EX1A 1AUXA 1TLLA 4RPKA 1W25A 1GL7A 3LRTA 3GZNB 3GMFA 3BE6A 1WHSA 1DUIA 1MBZA 1YIDA 5CT8A 2YQ4A 1JSRA 1R6DA 3G17A 3GAZA 1MTZA 2FTKE 2VL7A 4LZLA 5AJYA 5KOHB 1WR8A 1TM4E 4NX2A 1PWHA 3ZOZA 4F11A 3JYNA 3SXPA 1KYYA 2R87A 3O4RA 4WA8A 2QVXX 5EZQA 4D4KA 4OBBA 1SCUA 1R4MB 3IV7A 1M2KA 1D5CA 1HRDA 1DQSA 4X8LA 4DUYB 1E2PA 4G81A 3QLUC 4B87A 4BTVA 4UXHA 4QDZA 5IH7A 3OCYA 4RANA 1I4EB 3KE9A 5SZKB 3WK5A 1BXRA 1K2WA 3JAKA 1P1BA 3LW8A 1H5QA 4D4GA 5HJEA 2VUTA 4IKEA 4URFA 2JHAA 3EIQA 2G3YA 2YMPA 5ILQA 2BRUA 2YS6A 3ZWNA 4N6NA 3ISTA 1XA0A 3LHKA 3KK0A 2A9FA 5BSUA 1J0CA 2VT3A 3ZWOA 4Z86A 1WQ4A 3QLTA 4UTOA 5GZ1A 1XAGA 2E0IA 5LPNA 2XOKD 2W43A 2HPZA 4GH5A 4KE6A 1QQ6A 4G0XA 4R1MA 1DKOA 1K75A 1DDOA 2FMFA 4MV3A 5T4BA 3D0RA 3WLKX 2C95A 2J6HA 3B8HA 4F8JA 6PFKA 3E7WA 2C2OA 4RNCA 3OZTA 5G0SA 4MQ6A 3K9NA 4WCDA 5IBQA 1TA0A 4F6LA 1I7LA 1FFDA 3K50A 2Z30A 4KDFA 5M04A 4DIDA 3PJRA 3HACA 4G09A 4EPVA 1RYDA 1VPVA 4NWIA 4Y2VA 1F5SA 3L1HA 3FKSD 4RORA 1TF7A 4ASUD 2FHPA 1OAOA 3QVJA 4DUGA 1BD4A 2X58A 5FPYA 1SQFA 3LY7A 4PN3A 5JARA 1Z5VA 2R86A 1HA3A 4JGIA 1XZEA 2C78A 4PVDA 2ZXFA 4DYDA 2W2TA 4IV8A 5DYNA 1JLLB 2OV8A 4CLRB 5IT4A 3TG2A 1L4MA 1PNRA 1ZA1A 1JL3A 2C57A 1Z8FA 3T52A 3IR7A 3HPRA 3UFXA 4Q1AA 4QOIA 1QHIA 5DSTA 1PVDA 3K53A 5C5DA 4CV0A 2QMUA 4I8IA 5AW0A 4FMCF 2WF7A 5DISB 1I7SB 1TT5A 4B4DA 2AFVA 2PRIA 2E55A 3QBVA 1GTVA 4H1TA 4NRDA 4QELA 4TS4A 5F2EA 1L5MA 4F4DA 3C5CA 5K6AC 2SECE 5MN4A 2P9CA 3NY7A 4GIBA 4X20B 1PQUA 2AN3A 3ZHSA 1UFOA 4FYIA 3B8EA 4B8YA 1X13A 2EG9A 5CTAA 4DBVO 4TLEA 1D09A 2BZSA 5I9SA 1O6BA 4GOXA 4G36A 1GKUB 3HI4A 4ZVPA 5KJFA 3FYDA 3VHXA 2QTFA 4J94A 5LA6F 4XUCA 3L46A 3H17A 4L0CA 3DAGA 5JUWA 1RAEA 4RHCA 1T9BA 1SM4A 1UINA 1W5TA 1F1BA 1WDLA 3GEBA 2L0XA 2XUAA 3LV8A 3NETA 4QAJA 1N1EA 4Q24A 2ERCA 5F78A 3BD8A 1ZSNA 2JCXA 1C8VB 2CUKA 4ZYXA 3HN7A 3H9CA 4O4JB 1MFZA 4HAUA 1CJUC 3BMQA 4GGOA 3HBNA 3ROTA 4FOTA 1AHIA 1SAYA 4KQFA 2MMCA 5JO9A 2OGZA 1EDOA 3TDMA 3WGIA 4I1PA 1UJ2A 2AJDA 1R9MA 2BWJA 1M75A 3CPSA 2VJOA 1QK3A 2DFKB 2R60A 1IBRA 4WOJA 1A27A 2D2EA 2HTFA 1U8CB 1O8BA 4DC1A 2YZMA 2X13A 4CU5A 3CTMA 3D4IA 3OF5A 1DQNA 1QGDA 4UNRA 1G5TA 2XUJA 1P4GA 2D1TA 2XQFA 3V00A 4B2IA 2PX0A 3NC1C 2FF7A 5JR3A 1JHDA 1C29B 1C80A 3GRRA 3Q0EA 3NHPA 3QUAA 3OIDA 1FDVA 3CM0A 3KUXA 1GGNA 5H70A 2YJ3A 4A0HA 1GPKA 2F8LA 3KYDA 5CLFA 4G3XA 1S96A 3FUVA 1E1YA 3O2QB 4R1TA 1OFTA 1DQPA 2YZNA 3KJFA 3LG2A 5FWNA 1LGYA 3D8NA 1FBTA 1MABB 1UUFA 2CXXA 2ZI7A 1F0KA 1M1YE 2GXQA 2ZTHA 4UJ3A 1CF2O 3JQBC 3AYZB 4KKVA 3JTEA 4HH4A 4UBKA 3AOGA 1Z56C 4WUVA 1IVNA 4NEGA 3ZHTA 1PQPA 1QIMA 2JI9A 4NAHA 4EUHA 2EV9A 2QJOA 2QP3A 4Q18A 4FILA 4JBLA 1PTJC 4KO3S 1V5EA 3H9GA 3RS2A 3BQMB 4OBXA 3T9FA 1CRZA 2DSNA 2Q45A 1PJZA 4Q3CA 4CKBB 4XOUA 3ER9A 1IOLA 3K70B 2ZPTX 3A3OA 2BRUC 2GRAA 1NZFA 3FFXA 4C4RA 4D8WA 1X7WA 1XTVA 2HV8A 1E99A 1E4VA 4H3SA 5C3MA 4BYMA 3VR3D 3RAJA 4K26A 2V8OA 4KJZA 5GZ3A 4ZOCA 2HBZA 4CFZA 2Q2QA 2PDAA 4PZDA 2JGLA 5LQCA 2XVZA 3BXOA 1FUKA 3AXSA 4AZVA 4Q7LA 3FAKA 3H6GA 4MQ4A 4QEKA 1C4OA 4BU0A 3DF7A 2GN0A 3LPCA 1N25A 1BDBA 2XE7A 4IHQA 5AVVA 4E5MA 3TBFA 3TEFA 5L3VA 2ANCA 2W58A 1YHNA 4PC2A 3R74A 2VYQA 3N28A 3STXA 3KAPA 3B20A 5A6SB 2PX5A 1T4DA 2IZ1A 3H7AA 2J9FA 2PA0A 1DJNA 4ZOAA 1KYZA 1O7JA 1QZ3A 4DLZA 4O8ZA 1E0DA 2OHXA 2O7NA 3IDQA 2O8BB 1CIVA 4H9GA 4YCLA 1FP4B 3WKAA 1RHRA 3IOBA 4YBZA 2DJ5A 1KORA 4QXAA 2NZXA 3PEWA 1G7RA 2FX3A 2R8EA 1NE7A 2JAUA 2VPIA 3U7IA 5AKEA 2HWXA 4XWKA 2PIAA 4IDOA 5EN4A 1Y1SA 1MO6A 1VG1A 3PWZA 2J4FA 3S5UA 3HADA 4ZWNA 2P6PA 4KO8A 4ENWA 1MB2A 4IWYA 1W88B 1X1DA 1PDWA 2HK7A 3G8DA 4X7BA 4ZAWA 1V0FA 2FN3A 4D9KA 4EI7A 5EUSA 4XTCS 4UD6A 2AZDA 2NU6B 4M60A 1P1RA 1YR2A 3E84A 3KT8A 4HQNA 2YJTD 4F06A 5ULLA 4NZYA 2O8FB 3SY8A 4KQXA 3CF2A 3IB6A 1UEJA 4RV4A 4CM5A 1MXHA 5AVOA 4TQUS 3VH4A 4EI2A 1XRSB 3IAAA 3NHWA 4W82A 1PW7A 1NZJA 4IUBS 1T8SA 3AXTA 3EARA 1GTZA 2XUPA 5EVCA 2JCBA 2VAXA 3DJAA 2YC2C 3BXGA 1MA0A 4BEJA 3F49S 1TYDE 3H2YA 1NJ6A 4XKJA 1XDDA 2XGJA 4RK5A 1R00A 3PGMA 4CM8B 1VXRA 3CCCA 1C1DA 1U0FA 3BWYA 4JJKA 3VNSA 3JASA 2RJ3A 1XEWY 4JC0A 2R66A 3NHJA 4NULA 4S1OA 4QZVA 5IYZA 4MRMB 5LKAA 3T3DA 2RAPA 2A14A 3AONB 1MT0A 3L93A 4I9HA 3VPXA 2QRUA 2AV6A 5T3YA 2XTNA 1VSVA 4EB8A 1JSXA 4EPRA 5K8UA 4RETA 4BLPA 3ZKWB 3JX9A 4GI2A 1Z5UA 1GSHA 1NLYA 5FUMA 1XGKA 4ZVNA 2ZB4A 3UV7A 1HZZA 4K7JA 1MFPA 2Y1XA 4WLEA 5TIIA 1V8FA 4EKEA 3EPHA 4XLZA 2YS7A 3LUAA 4CODB 2FRXA 2V55B 5I45A 2NP6A 4B6GA 3IP1A 1BKSB 1XRLA 2H7YA 3QKTA 4TWJA 3WKCA 1Y6QA 4JN6B 2CLLB 3DMHA 1W47A 2XKAA 3AUFA 3OPVA 4A15A 5D86A 1V5WA 3RIMA 1ETHA 3WNQA 3ZBQA 4MI6A 1LDEA 1KE1A 4WLOA 4FYKA 1QDLB 1UC8A 1YWGO 4ZXPA 2VWHA 3QH4A 5K0CA 3MHTA 2WWGA 2VF4X 1BFKA 3M3DA 3WB2A 5DLQC 1RAGA 3QF4B 4UAUA 5K3BA 5F7OA 2WYUA 3LJKA 1Q95A 3JVIA 3SBXA 1FFBA 3LUJA 4BVAA 4PCUA 3L8GA 2M2IA 1ZM2A 3HP4A 3NASA 4BWYA 5HDQA 1XDGA 4D9FA 3ERCA 5K3SA 2WP0A 3FYUB 1IUKA 1KZYC 1HWYA 4V2IA 1TL7C 3RAFC 1XXHB 3G1TA 2J9GA 1RMYA 2AOUB 4CIBA 3ISVA 5AUQA 2WY2D 4FINA 4TGLA 2NQ8A 4N76A 3H0CA 4JBNA 5BMVB 3GMIA 5THXA 2FK8A 1S2IA 3E9NA 5SYAA 4CI0B 2PUVA 1KK1A 4DRYA 4FGKA 2MYUA 4EUFA 1MAHA 4L9WA 5F4BA 5CB4B 1H9CA 2WT8A 4LWZA 1SUPA 3KWJA 4HWPA 5A9TA 2B5OA 2TMYA 4UBLA 1CR0A 2C0QA 4CETA 4RVGA 1DRJA 1Y5LA 1JR2A 2O8VA 3OM0A 3ONNA 5EJEA 5AM1A 2VUUA 4BLRA 1BHO1 4YK7A 4EKDA 3N0VA 1QXSA 5A1TA 4B2YA 3D79A 2JGNA 4OSEA 2VTBA 1I0IA 1M7BA 3QFSA 1D1QA 1PI3A 3GCDA 1GGMA 3N59A 3KUDA 4KYUA 5JJBA 5ALDA 2W2QA 4MV4A 4LOJA 1QKJA 2PVCA 4MZXA 4C5AA 3M49A 5T4FA 1NW3A 2VTDA 3DP9A 5DMHA 1XR3A 3BERA 1UKYA 2G0TA 5IZ4A 3GJXC 1Q3HA 3QELB 3N2KA 4X0EA 4ER3A 1SVLA 1RJGA 1AGRA 3CHYA 2DEUA 3DEKA 2NO5A 3KAJA 1MGPA 3BHIA 4JP1A 5FKJA 3WMWA 4DJ5X 4XTRA 3U39A 2FOIA 1FF9A 4YCAA 4MHOA 1L4KA 2HA4A 2OZVA 4QA9A 4QKQA 3UWOA 2AWNA 1KO8A 1NBHA 1RQ2A 2YWXA 3H97A 5AW7A 1ZSVA 1IOWA 4I0WB 3B7WA 2PQ2A 3DXYA 1OIWA 2WMYA 3LFTA 3QP9A 4UHCA 3U31A 2CJWB 3I1JA 3K1YA 1LV8A 2QJWA 1F3OA 1DJOA 3EEYA 2OXEA 1M33A 2MINB 3ASUA 4N0MA 1N5KA 3QE3A 3SICE 4CF6A 1WUTA 2H7XA 4CM3A 1XMQB 2JHPA 1YUNA 1JXAA 2YCBA 3CKYA 5KX5A 4OKIA 1GNRA 1Z4QA 2V7QA 3R0XA 2Z6QA 4G0MA 3P96A 1EP3B 1D1SA 3G0DA 5TQVA 4DIEA 5HILA 3SHOA 1YQTA 3L0OA 3MA0A 4JCCA 1DAHA 1XD2B 3LC1O 4NZOA 4D81A 3W5IA 1THZA 3ZVMA 1QCYA 1NXWA 3CUKA 4LV5B 4RXTA 3LWVA 5IG2A 1ULHA 1L7EA 1DNPA 1Z37A 1Q7TA 1GU7A 2RBKA 3KLMX 4LDZA 4LOKA 4P4NA 4RY8A 4CMJA 1HYEA 4BBPA 3T3IA 1L3CA 5KC8A 1BYIA 1PUJA 2FP4A 2P5SA 4UE3S 3WGTA 2Y9PB 4BPBA 4P5EA 3FMVA 4B7UA 3GLFE 2O2ZA 2NAFA 2UVDA 1QTNA 3BGSA 3SIRA 1HZZC 2B1RA 2Q6KA 1C3EA 3V1YA 3WRXA 2QRVB 4I55A 2B5WA 2BI7A 1F9EA 1H1TA 1E3EA 1VJ1A 4INZA 4LDQA 4EYKA 1DKQA 4FQ7A 3IO3A 4K6MA 3D6NB 5G4LA 5H02A 5TPZA 3TNDA 4R1LA 4EY7A 1OTHA 1B0UA 5CGQB 3ETCA 4UNPA 2BTQB 3VGJA 1GYQA 3WWDA 1HDRA 3MMSA 4HADA 1Q57A 2QORA 2ALJA 3VHQA 4B3RB 1FNBA 3IEIA 1N32B 1QCDA 3BHMA 3MJFA 2I8AA 5EGSA 3E23A 5ECYA 5JHHB 2PKRA 1RZRD 2DWOA 1IC6A 1KBZA 3K16A 1E2HA 3NHYA 2WILA 4TN1A 4ZYUA 1AA6A 4RJTA 4EITA 2B7LA 1UL1X 2E6UX 5IC6A 4UAVA 1Q12A 1FUEA 2G7MC 3H1FA 1R8JA 2W6IA 3C3AA 3ZTYA 1PLLA 4YDHB 4JKYA 3VSCA 1J9EA 4NONA 4YCMA 4M88A 2V74B 3IH9A 2OCLA 3AJAA 1F0YA 2E2WA 3UJ6A 4DT1B 1P9WA 3HGQA 3M9XA 2CHFA 4GPEA 2IPOA 3LT2A 5HS4A 2A86A 4Q1BA 1Q0QA 4IZ6A 2AJCA 4DWWA 1AO3A 1U2PA 2XZTA 3H8VA 2C2BA 3KPJA 1QHFA 4ND5A 5EUUA 1HE4A 4YCDA 4Y6SA 5F2NA 4CI1B 3NIFB 1ZONA 1TW2A 1D2RA 2P7HA 1JDPA 4Y7CA 1GN8A 1O94A 1XZJA 2VJNA 3S68A 2J3DA 1LPBB 1K5HA 4RVNA 1XQYA 1WUKS 1YZNA 2DQ4A 1EXNA 2ERYA 1C81A 2JVIA 3DKPA 3NP9A 3ZNOA 4DR4B 2A0KA 2CZQA 2R7AA 5C7OO 1XRJA 3QKSA 1NI3A 4TL7A 3EGCA 1NBAA 3ZGOA 3M1IA 3LT0A 3A9TA 3ZWWA 1ADFA 1SXJD 1RXYA 5DDIP 4YMIA 2E4ZA 2RI6A 1EP1B 5LP6B 1F8UA 3KETA 4S05A 5H83A 3G5UA 4RJIA 4XD7A 1WXEA 3DYVA 4C6RA 4FLFA 1JEDA 3IOMA 2JPDA 1UC4B 1VMEA 2IW1A 5HF6A 2ESRA 1KFBB 5C31A 1XZIA 2UZAA 1NULA 3L0YA 4YLEA 4ZYTA 4OGFA 1RKBA 7REQB 1FMCA 2PGOA 4J91A 4KV9A 1DV1A 1BVYF 3KSMA 1YL7A 1P6UA 3LSYA 1E4EB 4MW1A 3L04A 3NHFA 2I03A 3ROPA 1DPFA 1NKVA 3CWQA 1XQVA 3QEBZ 3EGVA 1QR6A 4L8WB 4BN0A 1UXHA 4DUZB 3P5BA 3E8MA 3WJAA 3BSYA 1L3BA 2UVPB 3GR6A 4HXYA 3AKEA 1RI5A 4GEGA 4TKZA 3GVJA 1QKIA 1FFWA 4M0CA 4B6SA 1XTJA 2R3SA 2R5FA 4XVRA 2A9OA 4U7WA 1YJBA 2JGEA 1CUZA 4W5TA 1R0RE 2DFPA 3H3XA 4G0QA 2ZI4A 4AC9A 4WZAB 4CNQA 5BSFA 4OEHA 4AO7A 2C8VA 1C0LA 4CQMA 4EYQA 1QHXA 2GFQA 1W36D 1Y3BE 4CEIB 4F7WA 1YDEA 1NQTA 5AKGA 4CG0A 4GI1A 4RGYA 2WNHA 4Q19A 4BNXA 4NFHA 2X9VA 3ICWA 5ISMA 5DX1A 1JQEA 3AIKA 3IGFA 5IJZA 3EY9A 3IRUA 3KZVA 3WYEA 2OCDA 1T8PA 3FCCA 5A5FA 4A5OA 1GVNB 5DW0A 5CH8A 2DB3A 4IGKA 2PHZA 3PC2A 2PANA 4WD3A 3KUCA 3WLNA 5BW8A 5E2IA 2RG1A 5BSTA 2MHCA 5HFAA 4AYTA 5JFTA 3RS4A 4UVDA 2HD4A 1O6ZA 3CX4A 5JNTA 4MW4A 1OA1A 2DQKA 1U7WA 5J5CA 1YA6A 3Q10A 3BG5A 2HIGA 3C45A 4DLNA 1D2CA 2DPLA 1E94E 2DBYA 3TSZA 5EXXA 2A9QA 3KB6A 1I4TD 1H8EA 1OIXA 2YIDA 2IYTA 1ZK0A 2FR0A 2HIMA 3SLKA 4C03A 4EKIA 1Y81A 4G5GA 2JI6A 1OZAA 3TL3A 2FG5A 3I2GA 3W2IA 4FB5A 2DH6A 1FK8A 3W06A 2QGFA 1WB5A 3KDAA 2XE8A 5AWFC 3FNRA 2GPTA 5CAEB 4GX1A 4C7OB 1WEKA 1WHTB 3PFHA 5I8ZA 4NSNA 3MRXA 3RFVA 2B78A 2Q5IA 2XGOA 4Z7OB 5FUYA 3GCZA 2Z3WA 1GU0A 1CY6A 3ZC3A 4I4TF 3GLTA 1QU3A 2VN8A 1UKBA 1VLLA 3K0AA 1U98A 1T5HX 3UMCA 1MTOA 3COPA 2HDWA 4ZI2A 1NVEA 2AC4A 4MITA 2XWJI 4DV2B 3ILSA 1LX6A 4LISA 3OZBA 4HFRA 2JAPA 4YJFB 3YASA 1ZJWA 4FGWA 1R8YA 3S55A 3VQTA 2QRLA 3O26A 4OVKA 4CV3A 2C8KA 2FQYA 5L95A 1KDPA 3LUKA 1TPYA 2YMMA 3P9IA 3QW2A 4MI3A 1ZNQO 2JCGA 2X0NA 3OFKA 2LNDA 4EUEA 3OTWA 4U6QA 1OH6A 3I01A 1Q15A 3JQFA 3K9WA 3DEAA 1G20A 3AFIA 2FEMA 3TVYA 1K68A 1PG2A 4KAFA 4RFLA 3A1TA 4Z8XA 4XYEA 1B0AA 3GWGA 1P7VA 4FX2A 5JNLA 3DBHB 2IOHA 5JNSA 5KUTA 3S6JA 3F78A 1QAQA 3EDMA 1K6MA 2XQVA 1Z7WA 2OHGA 3N8NA 4PW0A 2SICE 2HK8A 3ZE8A 2EHDA 2HEIA 1WTCA 4LY9A 2HJVA 3RRYA 4MS1B 1EUZA 1KAHA 4KTVE 4Q9JA 4MWZA 3VR5A 3EGIA 1AIPA 5CCBA 3PNLA 2QTWB 1YBAA 2W6ID 4LHEA 2GRJA 1FFXA 5EWJA 2YCLA 2E89A 3ZV6A 3LKZA 3DB1A 2WHEA 2QGZA 3N1UA 3LY5A 3LUPA 4MR7A 4ND1A 3TLYA 2I7VA 4MLZA 4BNVA 2FRDA 2QE7A 4X45A 1UR5A 2OXRA 5LWHA 3GOQA 1ZMBA 1W5EA 3A3NA 1T1GA 1ZISA 2Z56A 3E61A 5A4IS 1NAIA 2AFHB 4ETNA 4NU8X 1JHRA 5BORA 1Q7GA 5DM0A 3TXAA 3CYFA 5FOQA 4RCYA 5DMXA 4ITRC 3U4AA 5LQKA 4OF4A 1X1SA 1LVGA 2HBQA 3QHQA 2X8LA 1NJ5A 1H42A 2WPDA 3CLTC 4FXOA 2OGUA 4RELA 2WHRA 3ZU3A 2D5BA 4CUZA 5BVGA 2QM0A 3NVMB 4IFBA 4RSMA 6LDHA 1E1KA 1QYWA 4K3VA 1R6XA 2B8JA 4WN9A 5CFLA 2MWMA 4KAXA 2A67A 1R0KA 1BEUB 1CY8A 4MPJA 3ZDYB 4FM9A 4CDGA 1CC1S 1II8B 2NIPA 2YZ7A 3DE2X 3ZD9A 1H93A 3ENNA 3Q6IA 1N2CA 2WAMA 1RWOA 2W37A 4TV8A 5L8VA 5AXBA 3G0GA 2PL3A 1XC7A 1VGQA 4LXIA 2HYIC 2IHNA 4MUFA 3VNRA 3IQIX 4POAA 4F5DA 3Q0TA 2W71A 4QDJA 3SJZA 2AK3A 4JMLA 5TLSA 4JEUA 4F1WA 2Q1XA 2I66A 3QUTA 4GKAA 3A1WA 5LZ7A 2I2DA 1YH3A 4Y2YA 4E70A 3DLIA 2JCYA 3V4LA 3WQQA 2IYEA 1VSTA 3A9RA 2DFLA 3KZMA 3N70A 4NZPA 2BTOA 1FDUA 4RV9A 3U62A 3CVWA 2ZRLA 2PUGA 3A3KA 2O8DA 3O8CA 2VUHB 2REQA 1KOGA