3C0KA

Crystal structure of a ribosomal rna methyltranferase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
395
structure length
395
Chain Sequence
SVRLVLAKGREKSLLRRHPWVFSGAVARMEGKASLGETIDIVDHQGKWLARGAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGLPGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQGPVTGELPPALLPIEEHGMKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTYRDRGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLFQKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0064 protein yccW
publication title Crystal structure of the Escherichia coli 23S rRNA:m5C methyltransferase RlmI (YccW) reveals evolutionary links between RNA modification enzymes
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 124
structure length 395
sequence length 395
chains with identical sequence B
ec nomenclature ec 2.1.1.191: 23S rRNA (cytosine(1962)-C(5))-methyltransferase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase
A PF17785 PUA_3 PUA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 3c0kA01
3.30.750.80 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA RNA methyltransferase domain (HRMD) like 3c0kA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c0kA03
3UA4A 1INLA 1ZQ9A 5LQKA 4PCLA 3MTIA 3JWIA 1FPQA 4GC9A 3B89A 2WK1A 5P8WA 4IWNA 1XDZA 3R6TA 2BH2A 3OPNA 1SQFA 3UJCA 5K8VA 2AN5A 2ZULA 5HIJA 5ICCA 4RTPA 1G60A 3GXOA 1UFKA 1MHTA 3OU7A 3CVOA 3EVBA 2I9KA 4MIKA 3HCFA 3QOXA 4CTJA 4DA4A 1N2XA 4O29A 3SR4A 2O06A 4E2WA 4IKPA 3R0QA 1P1CA 3MB5A 3TRKA 3UAIA 3GRVA 3LDFA 3OZRA 1R74A 2CMHA 1F3LA 1VPTA 1O9HA 4CKEA 3GDHA 1NW3A 2P7HA 3GNLA 4HTFB 4OBXA 3FYCA 4YMHA 4PINA 4FSDA 2EJUA 3BXOA 4QTUB 4QVKA 3MCZA 4RV9A 5DTRA 2AVNA 1D2GA 5HIKA 3KQVA 1RJEA 1ZG3A 1VE3A 1KYZA 3ELWA 3LBYA 4RVFA 2PSSA 1R3EA 2G72A 2NP6A 2YXLA 5BXYA 1G6Q1 2OZVA 3LDGA 1NW7A 2N47A 4RVHA 3SXJA 4PYMA 5ICEA 4IV0A 5KQRA 2YTZA 3CKKA 2IH2A 3KQOA 1QAOA 4RTOA 4P7JA 1R3FA 5BW4A 2HMYB 3QV2A 2GH1A 4RTSA 3LKZA 5KS2A 5JR3A 1RI4A 1D2CA 1XCJA 3KQYA 3BKXA 3TM4A 4PYJA 5DM2A 4IV8A 3P9IA 1VP9A 3JWHA 5CIYA 3SX0A 5E2AA 5LR6A 4RTQA 4NECA 3TOSA 3HTXA 5K0CA 3KQTA 3D2LA 2AN4A 3MTEA 3M6VA 4YUZA 3NTVA 5LSAA 3KPUA 3AY0A 2QRVA 3B7PA 3KQPA 4FT2A 3FPEA 2ZCJA 3FPFA 5FCDA 1NV9A 4ER6A 5C1IA 2BM9A 5EQJB 3P2IA 2H1RA 4LECA 4LWPA 2XVAA 2PXXA 1ZGAA 3A26A 2J5TA 4QQNA 1G55A 3ELDA 1L3IA 2PLWA 2R6ZA 5DM4A 3KQMA 3SGLA 5EMJA 4PGGA 5GM2A 1IT7A 1N7JA 2OBFA 4RSRA 3EMBA 4AZVA 4DM3A 5DT2A 2O57A 5E2BA 3KPWA 4YUYA 1SUIA 3ER8A 3T7SA 3P2KA 5CVVA 3UJ7A 1HNNA 3BGVA 4P7GA 5EKUA 3HP7A 4CTKA 4KW7A 2ZVJA 2VZ9A 3OFJA 5DWQA 3DLCA 5HOQA 3R3HA 5GIOE 3E23A 5FULA 4L7VA 3DMGA 2Z6AA 3FPGA 5FWAA 3V8VA 2HV9A 2JHPA 3NMUF 4BLWA 4HTFA 4OQDA 1VLMA 3HEMA 1SQWA 3P8ZA 4FZVA 1QAMA 1UWVA 4KRGA 2PKWA 1K8WA 1X1DA 4HGYA 5H02A 4E31A 2P8JA 4GEKA 1L1EA 3EVCA 2DPMA 4R8RA 3CC8A 3THSA 4E33A 1QANA 1BHJA 1KR5A 1RI1A 5DRYA 4ER5A 2ESRA 3U81A 2ZBPA 3VC1A 2P7IA 3UZUA 1VBFA 4B17A 2HTEA 5KYGA 3I64A 1O54A 3G89A 4MQ4A 2PWYA 4YV1A 2OYRA 5DX0A 3BWBA 2OB2A 2GAFA 3GGDA 3EVGA 3KHKA 5T64A 1X1AA 2XBMA 1I4WA 1T5YA 1VP3A 3P97A 3G2QA 4GOOD 3NVKI 1XVAA 4RWZA 1BKYA 3KQQA 2YQZA 4KWCA 2C7QA 3ORHA 3VC2A 4EMSA 5F2NA 5BP7A 3DTNA 2BR3A 2NYUA 5GIPE 5GINE 3UJAA 2UYHA 4KIFA 2HR1A 4M38A 1MJFA 3DULA 2PX8A 2ZTHA 1X1BA 1AQJA 1BOOA 1KPHA 4QTTB 1JG3A 3FTDA 5DPMA 3TLJA 4DMGA 1SQGA 3EPPA 3SSNA 1OR8A 4JXJA 1BC5A 4YMGA 1JTEA 3HCDA 3HVKA 3CJRA 3OZSA 4RTLA 3G8AA 4A6EA 8MHTA 1AV6A 3BGIA 2AOXA 1M6YA 1V39A 5B1SA 2ADMA 1ZS7A 2O07A 4RVGA 4GF5A 4XUEA 4GOLD 3EVFA 5EZQA 3TQSA 1Q7HA 1YFJA 4C08A 5D1NA 2AOUB 4F85A 3X0DA 1IY9A 3RIEA 1X1CA 1FP1D 2VDVE 3TMAA 3FRHA 3MGGA 4PNEA 3E8SA 3FYDA 3ID6C 3EEYA 4PYLA 1R6AA 2OPBA 4BLVA 4E32A 4QPNA 5CM2Z 2OY0A 4QDJA 3FUWA 4EQZA 2PXCA 5FADA 3THRA 2ZIGA 2P3OA 1T43A 2AOWA 1JQ3A 3GRYA 3GWZA 5CVEA 4YUXA 3IYLW 1NKVA 4M36A 5EOVA 3FRIA 4P58A 2YXDA 5LQNA 3GRRA 2JHAA 2ZBQA 1WXWA 1NBIA 4PGHA 3NWBA 4Y30A 3CGGA 5EHGA 4FGZA 4DF3A 2PXAA 3EMDA 3G8BA 4K6MA 4PONA 5CVDA 2WA1A 5FUBA 3I58A 1SUSA 2IDJA 2OKCA 3DP7A 1P91A 3BWCA 3KR1A 2XYQA 3T7TA 3TR6A 2J5VA 1WG8A 1G8AA 4HSGA 2VS1A 5CVJA 4OQEA 3P9NA 3PTAA 1EAMA 5D1HA 10MHA 3IEIA 3KPYA 3BGDA 3GCZA 4Q1TA 3AJDA 4GUAA 1VIDA 2QE6A 2NNWB 2ORED 2R3SA 3DMFA 5F2OA 5FQNA 4YV0A 5GOZA 1SKMA 3HCAA 1XDUA 3ER9A 4XUCA 3SVZA 4XCXA 2OXTA 2FYTA 2OO3A 1DUSA 2PX4A 3EGVA 3NVMB 5DRTA 1KPGA 5HEKA 3HVHA 3PT9A 5DSXA 1G38A 2XYVA 2YXEA 3P2EA 5GP1A 2LD4A 3I5UA 1ZHFA 2AB4A 1I9GA 4PYKA 5EZSA 5K0JA 3UBTA 3M70A 4C05A 2ERCA 5FHRA 2B9EA 2AOVA 5K03A 2EFJA 4RTRA 1DCTA 2CWWA 2BR5A 4BP3A 5EMKA 4E2YA 3A25A 1J2BA 5DXJA 3A4TA 3EEOA 3ERCA 1KPIA 2HNKA 2NXNA 2ZWVA 3CJQA 5HIMA 1P1BA 4QVGA 4RYLA 5EIWA 4AZSA 2AOUA 2NP7A 1EJ6A 5F2KA 2FK7A 4ER0A 4ER7A 4ER3A 2QY6A 4DCGA 1ZE1A 2V7EA 3MQ2A 2Y1WA 5U4XA 2P38A 1EQAA 3EGEA 3FZGA 5LQRA 1QAQA 2K4MA 2IDKA 3LDUA 5EKXA 4ZTBA 1FJXA 2JG3A 4RX1A 4AUKA 3HM2A 2HWKA 2NXJA 2YUIA 3B3GA 1YUBA 3G2PA 4FS8A 4FSXA 2G71A 3IHTA 3CCFA 1WXXA 2AVDA 3DUWA 5DM1A 5K0LA 3CBGA 5FHQA 5CUQA 3G2MA 3M6XA 5LQJA 1DL5A 2Q41A 4C4AA 4E70A 3KKZA 3LX6A 4HGZA 3O7WA 4V0RA 2UYQA 3L8DA 5E9QA 3UJ6A 5DXAA 3HA7A 5K0NA 4P7KA 2PGXA 2EX4A 5E1DA 4CXMA 4CKCA 5E8JA 1L3BA 4X63A 3UJBA 4X1OA 1RJFA 2ZW9A 4V0QA 1YZ3A 1L3CA 4LWOA 4UOEA 3NW9A 2ZIEA 1Q0TA 1IT8A 1X19A 2ONYA 1NE2A 2Y1XA 3EVEA 3CJTA 3P71T 2I62A 3GRUA 2O05A 4HRAA 3P9KA 5EGSA 4F84A 3C3YA 5CCBA 1JG4A 1PRYA 2G8NA 2YX1A 5E8RA 3PFHA 2FPOA 2IP2A 2AR0A 2PT6A 2PWPA 3DXZA 2QM3A 3HCEA 3LECA 5GWXA 2IIPA 2BM8A 1ORHA 4HG2A 4OX9Y 3JWGA 5ICFA 4EK9A 1SG9A 1XCLA 3KR2A 4M7RA 5DX1A 3SSOA 3FTEA 4AZWA 4DKJA 3TPZA 1YF3A 2B3TA 3FPHA 5T67A 5LQCA 1D2HA 2P40A 4PIPA 2B78A 3D79A 3ANXA 3HVIA 1FBNA 3AXTA 4WVLA 5FTWA 3LKDA 3FUVA 4C04A 2UYCA 4QQKA 1YB2A 2AOTB 2OB1A 2ZZMA 4FP9A 4M37A 1JSZA 5K0EA 2FK8A 2UZ4A 2P35A 2PY6A 3LSTA 5FA5A 3G2OA 1NT2A 1NW6A 2JJQA 4R8SA 1IQ8A 1HMYA 2GPYA 1ZL3A 5C0OE 4C07A 5K0FA 2PVCA 5HZMA 4CKBA 2GS9A 5DTQA 2AN3A 2B25A 2PJDA 3GU3A 3LPMA 3OU2A 3T0IA 2FHPA 1AF7A 2AZTA 4CWAA 1KP9A 1ORIA 5T6BA 3C3PA 3KPJA 4H0NA 1JSXA 3T7RA 3GRZA 3HCBA 4PYQA 3O4FA 4E2XA 3I9FA 3K6RA 4AX8A 1B42A 1XDSA 1I1NA 5ICGA 4RTJA 5K05A 4F86A 2IH4A 4BP1A 1RI3A 2P3QA 5K09A 1JQDA 2IGTA 3G7UA 3FTFA 2ONZA 1KXZA 5DM0A 3HCCA 1YFLA 5E9WA 2Z6QA 1ZGJA 1XJ5A 3KQWA 5FQOA 2V74B 4KDCA 4PCAA 3LHDA 1JQEA 1Q0SA 3GO4A 3KR0A 3DOUA 3NDIA 1EG2A 3DLIA 2WA2A 2CX1A 5FWDA 3K0BA 4EKGA 3LCCA 4YUWA 2ZIFA 2C7RA 1Z3CA 5JUWA 2ZWAA 1VL5A 3RODA 1IXKA 3DR5A 3NWEA 5EEHA 2O0LA 3BWMA 2G1PA 3M6WA 4RTNA 2EG5A 3V97A 3SSMA 3FPJA 5DTMA 2B2CA 5CCXA 1NW5A 1XTPA 5ERGB 3PS9A 2JH8A 2PV0A 3MHTA 4RVDA 1VQ1A 5E1OA 4A6DA 1EJ0A 5IH3A 4OBWA 2IPXA 3LBFA 3ELUA 3LCVB 2Q07A 4DZRA 2CMGA 1P39A 3KQSA 4GOMD 3FUTA 4G56A 1TW2A 4KDRA 3OU6A 4OA8A 5HILA 3AXSA 5EMLA 2E5WA 3DXYA 1QYRA 4LG1A 4DQ0A 5C9ZA 1TPYA 5LQAA 5EPEA 2FRXA 3BZBA 3MAGA 3OCJA 2QYOA 4EVIA 3UJDA 1FP2A 3UFBA 4X41A 2ZSUA 3HNRA 2AOTA 2PX2A 3Q87B 2C7PA 2GLUA 3F4KA 1H1DA 5HIIA 3VYWA 4PYNA 4MWZA 1RJDA 2BR4A 3B5IA 3BWYA 4QPPA 4XUDA 4FR0A 5IKMA 3EVDA 4KVZA 2YR0A 2C7OA 5EVJA 3UWPA 4EKIA 4MTLA 4BLUA 4RTMA 3ME5A 3C0KA 3DMHA 4PYIA 3I53A 3BKWA 4E2ZA 4DCMA 5CD1A 3OE4A 3PX3A 1UIRA 2XYRA 3TFWA 3C6KA 2YVLA 3AWIA 1N7IA 4QDKA 3GIWA 4P7FA 2UYOA 3EVAA 3E7PA 9MHTA 1AQIA 4PYOA 3EGIA 3M6UA 3PLAE 1TW3A 3LGAA 1WS6A 4RTKA 5DLYA 1R00A 1RI5A 4GC5A 4BY9E 2JH9A 1ZKDA 1R8XA 2VP3A 2CL5A 2EJTA 2XVMA 4Y2HA 2P1DA 2PX5A 3M33A 4X61A 5GM1A 5HFJA 4C03A 2IBTA 2Z6UA 1JG2A 1EIZA 3ELYA 1XXLA 3FUUA 3TKYA 3KU1A 4YUVA 3SMQA 1SGVA 2JHCA 3NDJA 5EHIA 1YZHA 3REOA 1R8YA 4KIGA 5CVUA 4U7PB 1R18A 4ATNA 3MCTA 3OFKA 1F38A 5E9JA 5K0BA 3OE5A 5K0GA 1G8SA 5LQUA 2ZLBA 3MERA 4GBED 3G5LA 4WXHA 1JG1A 2CKDA 3LL7A 5E1MA 2PBFA 4Z2YA 1ZE2A 1KIAA 3E05A 3IV6A 2I7CA 3EVZA 2F8LA 3NJRA 3PVCA 4GOND 1KHHA 5G02A 1O9GA 2BZGA 3BUSA 3HA3A 2PT9A 3P9CA 4PIMA 5MHTA 3OZTA 2ZBRA 3LCUA 5EIFA 4GQBA 1NBHA 3A27A 2H11A 3TKAA 4MHTA 1M0EA 1PJZA 2KW5A 3FTCA 2IBSA 2CX0A 3BT7A 1NW8A 3DH0A 2NXEA 3HA5A 3VSEA 4HH4A 4FT4A 4X60A 3TM5A 5BW5A 5KVAA 5EMMA 5M5BA 1SVUA 4R6XA 4C06A 3B3FA 3M4XA 5E1BA 2ZZNA 2G70A 3G5TA 3S68A 1U2ZA 2GA9A 2IFTA 4PWYA 5EC8A 4ISCA 3Q7EA 1L9KA 5DX8A 1M6EX 2I6GA 2VDUE 5EG5A 4E30A 3B3JA 1QZZA 1WY7A 4OA5A 4R6WA 3UJ8A 2FCAA 2IH5A 1JR4A 3UA3A 1NV8A 4R05A 2H00A 3A7EA 2AS0A 3C6MA 3QOWA 3FUXA 3HVJA 3UJ9A 4AZTA 1Y8CA 5DSTA 1IM8A 1KYWA 2NXCA 3JWJA 3PFGA 3KR9A 3H2BA 3RW9A 4YV2A 7MHTA 3SM3A 2ZFUA 3R9XB 1RI2A 2GB4A 2P3LA 4POOA 2DULA 3PX2A 1JTFA 3PB3A 1WZNA 2A14A 2P41A 4U7TB 2ZZKA 3R24A 5K01A 3GJYA 5EEGA 3A7DA 3DXXA 3KPVA 5FA8A 4HC4A 5KQSA 2QRVB 1RJGA 3WSTA 3G88A 3O31A 2VDWA
chains in the Genus database with same CATH superfamily
5T4HA 2JL1A 2FKNA 3ZLTA 3K9NA 2H7VA 3MINB 5EP4A 3QVLA 3H4VA 1I7NA 1Z2NX 4K9LA 1JH9A 3DE3X 4QWMA 4YP0A 1SQFA 5AMXA 1QWSA 2O2CA 4D8XA 4JI7B 1UJ5A 1S0UA 1ILEA 4L3WA 1WPQA 4ZAWA 1IUKA 2P69A 4UDNA 3NAQA 1XAJA 2XKAA 3ECAA 4AY4A 2I9KA 4MIKA 4K1XA 2VK8A 4A8PA 2CSXA 4YALA 1APBA 5ULLA 3B1YA 4XWWA 2CLDX 1QCCA 1ZH0A 3MB5A 1PFGA 2ECOA 4FHEA 1PR3A 1DJNA 1GAJA 1Q3HA 2PFKA 3WA7A 2Z09A 5K6RA 5DW3A 2X19A 1J5PA 2ORYA 3ILYA 5J2UF 3C7AA 1G16A 2CLCX 3DNFA 4FSDA 4X6UA 2PZGA 4QVKA 2O2JA 4UMEA 5DTRA 5AKXA 5IKEA 4PFJA 2HKIA 2HAEA 3LT1A 4I1OA 1F2VA 3GEEA 4RVFA 1R3EA 1QS0A 3IS3A 4YJ2A 5KC9A 2DXIA 4GX5A 4FW8A 2OZVA 1FZQA 4TSFD 1SBQA 2AG5A 3BRWD 4ZP1A 1BWQA 1RQRA 5GVSA 4OGKA 2QVGA 4QGFA 3Q4GA 1IEWA 1ISPA 1R9MA 2P1RA 1EVEA 2H1HA 4IV0A 4RDHA 4BNKA 2H52A 1S7GA 4E14A 1P2UA 2J5RA 2WAOA 3BICA 2REQB 1WUKS 2NO1A 1NM5A 3A0RB 3NHZA 3QG5A 4IIHA 2AC7A 3HJNA 1B00A 4LBZA 3F98A 3BKXA 5JW6A 1PWEA 2Q6LA 1VMAA 3WGHA 2C4MA 4FFBA 4D8TA 1K89A 1ZH2A 3RC9A 4I1SA 5JIBA 1X7ZA 4REQB 1W1WA 1P17A 2FPGA 5A6SA 1XVIA 2IEDA 1N0IA 3LKBA 5BQ5A 4BVBA 4C0BA 3BRWA 4Q4AA 4U8GA 3OLXA 2G1KA 2B61A 1GLGA 2DY0A 1TVEA 3KHTA 1B74A 4DLYA 3RAPR 1T2AA 2R6GA 3RVNA 4ER6A 1QH0A 2FSGA 2V6GA 3T95A 4C5AA 8ATCA 4WZ6A 5F76A 1ZD1A 2XVAA 3COVA 4GP7A 1B8NA 4TZTA 3SXUB 2Z2ZA 3KC2A 2PLWA 3THYA 1MX9A 2CJPA 1N32B 2OBFA 3LCMA 2W0SA 3EISA 3LH5A 2DFPA 2DQZA 5E2BA 4N48A 1VYTA 3L02A 1SUIA 1VJRA 4QBIA 4MPJA 4YAOA 3J81A 2SICE 1G4HA 1MJGA 3EUAA 4LHWA 5JH7B 4DA7A 4Y2SA 4JYBA 4F3YA 4G5QA 4PV7A 3KSAC 4TZ4C 2RHTA 3OFJA 3ND8A 1IWOA 2QX7A 1H4YA 2GEKA 3RFUA 1QRRA 4G1UC 4G41A 3W8NA 5CNJA 2QU8A 3R3HA 3U13A 1X77A 3K0KA 4OMUA 5HOQA 4N0DA 4RNCA 4DSZA 3OIFA 3QUAA 1P44A 2PEZA 4QG7A 1DPFA 1VLMA 4Q0MA 3T38A 5D3ZA 3TAUA 2ID8A 3A4IA 4U2EA 5LD2C 4RJLA 3C7TA 4MAAA 2WF6A 2VFAA 3T7DA 1AURA 3Q5GA 4MRVA 4IEIA 3DONA 2IUUA 1FC0A 1AUZA 1L8AA 2JZCA 3Q72A 3OQJA 4ZVTA 3BRSA 4BKQA 1BUZA 1WE2A 4IAOA 3MPOA 1WUJS 4RHYA 1R3DA 3BILA 5FBQB 1KI1A 4C88A 2RMKA 4RSGA 3SDSA 4TMYA 4MVYA 1G3UA 4D26A 3AVYA 1OZGA 1Z0AA 2HBZA 2VA9A 4C5BA 2QQ5A 5AVOA 5CBPB 3PDCA 3WXBA 1JEYA 1J42A 1K7EB 1PR2A 2WHPB 3E81A 5C8YA 1XKLA 1YVDA 4EUKA 1WCV1 3GUYA 4V0LA 3D4BA 1Z6ZA 1VSVA 2B8NA 3I2GA 3ORHA 3Q2IA 4EMSA 3DBHB 3BE4A 3LHIA 2DH6A 2FZKA 3R6WA 2XUGA 2HIGA 3EXIA 2B21A 1FVFA 4HQ0A 1KQGA 1MB9A 1X1BA 5DHSA 1KPHA 2OBYA 1YE3A 5IMSA 3R0XA 1WZIA 4BEJA 1GPWB 1E99A 3HVKA 3MS4A 3AP3A 3LWNA 1KQ3A 2QZZA 3LW8A 1BKDR 1XCPA 1YQQA 1V39A 2H29A 5AVSA 3N9IA 2ZDHA 2C8VA 1TU4A 4L7QA 3EASA 3LNCA 1CUZA 2XVYA 3A4VA 2P65A 6AT1A 4IZOA 1EDZA 2EVWX 2MDTA 2IXGA 3C14C 5D1NA 2LKDA 5KZMB 3OLYA 1NULA 1O97D 1W4ZA 3DZJA 3M6MD 4JUFA 1Y8RB 3GT0A 1SKAA 1QPGA 1F2TA 1SURA 4NCKA 3RU9A 5KEIA 1E3IA 3KCQA 1FX1A 1L5HB 2UZ1A 3SN6A 5C8DA 2FWJA 3A1SA 1HL3A 4NC9A 1FX0B 2AOWA 3AONB 3BJIC 2OFWA 4UM8B 4Y2YA 5A5EA 5JD3A 2ZRLA 3QWIA 1NKVA 1YBMA 1FCFA 1PFWA 4EY4A 2QN8A 1UZMA 3UAYA 4ZI7B 5T8KC 3BD8A 4PGHA 3NFYA 1GIAA 1TUEA 3KEOA 2WR8A 1MEOA 4LZJA 4DIMA 1C3VA 2X23A 5MN5A 1X1SA 4DIFA 1GZ3A 4EPVA 1VRCA 4W1SA 2QRGA 1PEKE 3DP7A 4DGFA 4IS3A 5J2UB 4WASA 1R4NA 2FSUA 3PPIA 5KYUA 1WSWA 3MGAA 3VO2A 2F1KA 4MUJA 2XVXA 2JLUA 1IPHA 2X8AA 3GLGB 3G13A 2X77A 5D1HA 4QODA 3V7WA 3KPYA 1IN4A 3U19A 1NI4A 1VIAA 3GCZA 4GUAA 4U2KA 5FQNA 4GWKA 2AK3A 1GSIA 2DP9A 1KFJB 4LEIA 3DYBA 1VPDA 2E7ZA 2PFGA 3KTOA 3LHFA 3PYLA 4U7GA 2OXTA 3VX4A 3FNEA 5JSKA 5AM0A 4D9GA 3N5CA 5DH9A 4MP3A 1CUAA 1WBJB 2DSTA 2WKRA 3BE6A 5DWVA 1Z4JA 1EZ4A 2D0PB 3HB1A 1MZPA 2XYHA 1O6ZA 2QXUA 4P4SB 1VI2A 5TE9A 1Y7IA 3IQIX 5DGDA 1CZLA 3F47A 1JEQA 1PFYA 2ZQYA 1X0XA 4WKGA 2ZSKA 2ZJ3A 4F45A 4XGIA 1XD2B 2HRBA 1P2SA 3OIZA 1SU7A 3MM4A 3HDHA 2HLPA 2BGLA 2IHZA 4AIRA 3PR3A 2JLWA 4QDTA 1EXNA 2OP0A 2O5VA 2ZDGA 5AK5A 4HF7A 1CXZA 4XAQA 1UDBA 3VNSA 1I2BA 4MS3B 1VXRA 4M0DA 3GVPA 4DCGA 1CLUA 4FGWA 1XV5A 1FFBA 2V7EA 2HQ1A 3ZTBA 4D42A 3PQ5A 1JDTA 1RD4A 3L7YA 3COWA 3IR6A 4MRNA 3ZDXB 4AMUA 1HOTA 3ZCVA 1BXGB 2GPTA 1VCIA 2H85A 2FFQA 1YUBA 3MVEA 1Y4DE 2D8AA 1XMPA 5HHTA 1YAJA 1E2NA 5EINA 2AVDA 1P9RA 2AZ4A 4R1LA 3SX4A 3SYLA 1XZGA 3KNZA 1Z36A 3CU5A 9GPBA 2XE4A 3D0OA 3IOBA 4HWGA 2JCBA 3HU2A 1UINA 4JYMA 4NABA 5T8KA 1OXBB 2X42A 4EO4A 1LSSA 5BVHB 3AVPA 1WHTB 5EZ6B 2EW1A 3OM0A 4JK3A 4V0QA 2REOA 2AFHA 1L3CA 4UOEA 3TIFA 3G1WA 1IIRA 3NHRA 1GCIA 4G0YA 4US0R 4PBSA 4U0KA 4RL4A 1E4OA 1Z7YA 1G3QA 2ZB2A 1XWIA 4V3BA 3JVUA 5B2FA 1LSJA 1UDAA 3IGFA 2PKEA 4FGUA 4YJ2F 1UDRA 1YI8A 5BSKA 2QDXA 2ISSD 4LDZA 1MGOA 2VHYA 1QHFA 2Q49A 3DZDA 3CZMA 3PKJA 5FBKA 4D25A 2H9AA 3JASA 1NOIA 4JWTA 2B3TA 3KE9A 1Z88A 3FPHA 1E32A 1ZK2A 3BX1A 2I2XB 4NX2A 4YDRA 3WZ2A 4OK3A 2EBUA 1U1DA 3DBLB 4MS4A 5EXXA 4MV4A 3SJCA 1DELA 1GU1A 4ZVMA 3FBTA 3UPDA 2W2MA 4KR7A 2WF5A 4FGJA 2IEYA 1MORA 4YN3A 3FIJA 5DCLA 4X20B 3UT0A 2PY6A 1YZGA 2AI3A 2NYAA 1SOWA 1NW6A 1VLZA 1IQ8A 1HMYA 1ZL3A 2IOFA 3R41A 2VAPA 3BIOA 4JX9A 3DMTC 2OESA 1FMLA 3KJFA 4O02B 4R1OA 4Z4CA 4YUAA 3FLBA 4CWAA 3GUUA 2IOYA 1KP9A 5LM3A 3NBUA 1K8XB 5LC1A 3C3PA 4QBTA 3WO1A 2CV2A 5CDUA 1EWTA 3HCBA 1ZOIA 3DDHA 4U5QA 3W1EA 1TCVA 4A73A 2J87A 4JQSA 3TZ6A 1KK3A 5F7OA 2VTBB 1RMTA 1BS9A 2I67A 2P3QA 3S29A 4BP1A 4JI8B 2JHFA 3NT4A 3STHA 1D0IA 1RLMA 1PZXA 2BTQA 3TLKA 1OXSC 5FWYA 2EQBA 1IONA 1SBYA 2YZMA 2IIVA 4MEAA 3QKUA 3OP4A 3QHAA 3M7IA 1N3LA 3GO4A 3NKFA 5ESXA 3DNPA 2P79A 5D3MB 3K5WA 4ANFA 5DN9A 4G0UA 1SUDA 1HE5A 4K2AA 3U3OA 5IN5A 1YZVA 4DJEC 5ALIA 1HKUA 1R0XA 4KVFA 2EKBA 1GAWA 4NBRA 3TBFA 4D3XA 1EB8A 5FEUA 3EX7C 3E5NA 4M0LA 1ENOA 1L7MA 1U81A 2JLSA 3AFOA 3GN2A 3WYNA 621PA 4H3HB 2V1XA 1YIOA 2EIXA 5FOXA 2JGRA 4M99A 5IXYA 5EUUA 4CKWA 5KNBD 4WIAA 1XALA 4MWCA 5COQA 4BFUA 2XMPA 3A1NA 5CFQA 3B6JA 3EBOA 5AQEA 4B3RB 1XTPA 2TS1A 2AH5A 5D8DA 3UC5A 2PGLA 1OYVA 2XDQA 3OLZA 4BRWA 5JZBA 4L6AA 1CVLA 4DC9A 4JEHA 2QOEA 1A96A 1MV5A 4RULA 3KQSA 4IOLA 3KP1A 3QIVA 1AU9A 3ZE6A 2WUDA 2BE9A 3ZXIA 2JKVA 4DQ0A 3RT7A 3G9QA 1B0ZA 2FRXA 3WL8A 5AK6A 1W93A 5C8YF 4Q6WA 4WE3A 4WDRA 3N8HA 3EVNA 2ZI6A 4C7OA 4ZI5A 4MICA 4QYIB 3ZY6A 4U2GA 1KI2A 1B0UA 3DMTA 4UXIA 3LOUA 1KC1A 3IEKA 4PLWA 5IKMA 2C7OA 5AJZA 4COKA 3R23A 3PQ2A 4S05A 4DL9A 2QPAA 1G9TA 2EQ5A 4MRRA 1BEZA 3FA2A 2DWQA 3RKSA 1OFTA 2N1MA 5EMHA 3QA3E 5DHUA 4HX9A 4I4TA 4CTNA 1DAFA 2DHRA 2NUBA 1ZC3A 1G8YA 2C5LA 3EVAA 2RHOA 3WQQA 3WB9A 3NAZA 1V2HE 5H8WA 1PX0A 4AC9A 4YP7A 4GLBA 1TCUA 2A94A 1KVRA 3IAM6 3ZV6A 4E5PA 3I92A 1PFKA 3DJAA 4B0OA 5JSHA 4HQFA 2D4AA 4DAOA 2O54A 4E7PA 4FDAA 1IQ0A 3OX3A 2GN8A 3PE3A 1KAHA 4XDGA 1T2NA 4BC0A 1RMYA 1F6DA 4OY3A 4BMNA 1E7RA 2IWRA 3D4IA 4IJ5A 3PDHA 5ESWA 2DQ4A 3O4VA 2JCGA 4XYMA 5DT9A 3RASA 4GRIA 1KH1A 4LIPD 2SNIE 2V45A 3EH2A 3S0JA 4ZDKA 1L7BA 5B7QA 5BWBA 3ZGZA 2CF6A 4JU8A 2VF2A 5AOVA 2R00A 1I6WA 5TEVA 4DGHA 3WGVA 1Q5PA 4AUEA 2Q28A 2VLBA 3ILXA 4MGEA 2CYCA 1AGNA 2YZ7A 1XHEA 3CUVA 3DBIA 1USGA 1NP6A 2CE2X 3CZ9A 5EAIA 4NYJR 2VI5A 2WZCA 4W8HA 1EX1A 4XR4A 1LQ2A 2KW5A 3D6VA 2GFIA 3DE4X 3LS2A 3PU6A 1TFRA 3OM9A 1ZW1A 4KAAA 4MGHA 3UATA 3NHFA 4YRIA 5C4MA 5L9AA 1C4XA 1QS0B 5EJ9A 5DEOA 1ULZA 4OFXA 4YJ2B 3GV0A 2ZSEA 4EFNA 3WSWA 2WSBA 4IXWA 4OLHA 3COYA 3NXKA 2WTBA 2HEGA 4P83A 5DV9A 3G85A 4L4SA 3SJ7A 2QM8A 2WT8A 4MUEA 1KQPA 2BT4A 1N8TA 2R2AA 3UV7A 3GI1A 4OUDA 4CLOA 1XQWA 4MWDA 2ZAMA 3D8BA 3GY0A 2FZEA 4MH0R 3URKA 3PD7A 4FFBB 3AETA 1LRJA 4F12A 1X7ZB 4MV8A 2FPGB 4PBRA 4N6NA 1N9KA 5A6SB 3OJLA 3LIPA 1GGFA 1NR1A 2C4UA 1ZLXA 4TTRA 1K9VF 5KJFA 4Q4AB 1PG2A 4OOFA 4R9SA 3JRXA 3V32A 4AUMA 5F7JA 1ADJA 5AIAA 4KWTA 2O48X 1I0ZA 3KLNA 3IRUA 3LUCA 3K5IA 4PG5A 1MOZA 1MJGM 3LBHA 5IUKC 3MJ4A 3THYB 2C2BA 1IHPA 1K3UB 1XDZA 2N75A 3LPDA 5D6OA 2ATCA 2ZS9A 3MNFA 1K6EA 1GO2A 4JASB 4F9TA 5ICCA 3HKCA 1CFJA 2YDXA 4DE5A 4D0NA 3ETDA 5HF8A 3SHQA 1Q17A 5KS2A 1GZ4A 2EZ4A 2GPSA 4C3VA 3QOXA 3F74A 2C95A 5AOBA 5F64A 5EJIA 3SR4A 3ZE2B 3BJMA 1YL5A 2VKQA 1CVRA 3KVYA 4Z5XA 3LDFA 4MB2A 1VPTA 1TUIA 3EULA 1EP9A 1GLNA 4L16A 3TVDA 4EBFA 2AR9A 3RF6A 4MJ3A 4OBXA 4QHTA 4BPBA 3BXOA 4F6CA 1UBNA 4MGYR 5SZHB 4MYRA 2ZT8A 2PH5A 4EI8A 3Q7QA 4HYYA 4BLQA 2VATA 3WTBA 3H1TA 3Q9LA 4M0EA 1CG6A 4YASA 3C3DA 5JAIA 1YR1A 2FV8A 3G9ZA 2I3BA 4PRYA 1NMQA 2PSHA 3U49A 5TVKA 4MK4A 3ZDEA 4EZIA 4PICA 4MWEA 3V6LA 1X42A 5KU7A 2Q3DA 3CKKA 1YJXA 4GKBA 3CLUC 3IH5A 3F3SA 3PNPA 1SZCA 2C4KA 2HMYB 3IIJA 1YCFA 3QV2A 4NVRA 4M7PA 5F7ZA 3BE8A 2D59A 4A0GA 4P22A 1RI4A 1OXMA 1Z6PA 1E3JA 4TLBA 3JSAA 5C8YB 1JEYB 1J07A 3SU8A 5TJHA 1A3CA 4DCSA 4E1VA 4DUPA 2VQ6A 4Y1GA 1N7GA 4NV1A 1B41A 3WLKX 1PT9A 1T36A 2V0CA 3EXIB 2ORWA 5IJ0A 1WIWA 1EUDA 5FPYA 2Z56A 3K94A 4WK4B 1JJVA 4BO4A 5C35A 3UAXA 5K8CA 3UOWA 1V8FA 4JQZA 4YRQA 4ZU1X 3FPFA 2L0XA 1SMKA 2DQSA 3ER6A 4BVKA 3SR3A 5TEWA 1ZOSA 2OZKA 1IOZA 3SGLA 2ZR9A 3V2HA 4KQJA 3KQMA 2JFBA 1FEZA 3HN2A 4KO3S 4LMRA 4R7ZA 1IT7A 4PU0A 3VPXA 1TUGA 2JD1A 5H3LA 2IX3A 4Z7NB 4E22A 3IQXA 3NGLA 1E59A 3A6JA 4XJTA 2ADOA 1DBRA 3FAZA 1E4EA 2ODWA 2DWCA 3Q1KA 4GECA 4IPTA 5TF0A 4B82A 3CBQA 4OSEA 1FRVA 4CTKA 3D3WA 3PXXA 2QV7A 3CLUD 3E1GA 2QZ9A 2YC2C 2J4CA 3C1OA 1F2TB 1MXHA 1XNGA 1CDDA 3K4PA 1I4LD 3A2LA 4XGKA 5JY1A 1U5AA 3BRCA 4KQGA 2B82A 2LUOA 2UZ1B 3PG5A 4N03A 3QF7A 2O1XA 2QX9A 3HPRA 1YRYE 2PBLA 2G4LA 2RCNA 4XTCS 1VG8A 1U7UA 3A05A 1Z4IA 4X62B 2FR0A 2G0AA 3K4QA 1YRBA 2RHLA 4EFDA 3GZNA 1Z6AA 1KR5A 1M8GA 3SQXA 3UOAB 1QF7A 4JENA 4HXFB 1TQ2A 3EXG2 3ONFA 3TW8A 3DT6A 2YBEA 1KZHA 4EDHA 4BN5A 1Y5LA 1YUNA 1GCOA 1RPAA 1URPA 3HUDA 3LQFA 4DEXA 3DLAA 4AS2A 3W5HA 2GAFA 1R4NB 3GEPA 4M9CA 2YWBA 5KYUB 1OAKA 4XIIA 1HTBA 1ZD8A 4PPFA 2B99A 2H57A 1D1TA 2X0RA 3GLTA 2JEZA 4LKRA 4DLAA 3LMKA 2R8ZA 3LFTA 5MF6A 2IHKA 3NC1C 1NI4B 3GBSA 3AM5A 4ZO9A 3R9WA 3UMYA 5BNTA 4G65A 1ZM3A 1JQAA 3N8DA 1H2EA 1ATIA 3OCUA 3SNKA 4ZCQA 2QG9A 4BXOB 2JLQA 5JCOC 5KVCA 4NYJQ 4EG7A 1RFGE 2WV7A 2X5OA 1QHYA 4ND1A 4FOOA 4ZRNA 521PA 4JYAB 1Q7BA 3DOJA 3KUDA 3W5AA 4YMGA 2O20A 3EPPA 3WDSA 1RXWA 5FUMA 3HCDA 2WYHA 2Q0QA 4AU1A 4KRFA 3FNRA 3OZSA 1Y1PA 3KUXA 3K5HA 1JEQB 1P74A 1C41A 1AY0A 2IEAA 3ZG6A 2YHAA 1ZS7A 1IZ8A 3LK6A 2XUAA 3CFYA 2D4HA 4XJVA 3FFXA 1QYDA 2O2SA 2OGTA 2YH2A 4JKOA 1BOFA 1SWWA 2A9FA 2TECE 3ROMA 4TWBA 1U3VA 2OTCA 5DXFA 4FGLA 1GPBA 5EJFA 5A2QA 3CF6R 1W94A 4N8SA 3AVQA 3I4CA 4D3DA 4KTTE 2WZQA 2ZI5A 3PPWA 1JTVA 3MD9A 2IKQA 1WDLA 3R0JA 4GGPA 2HA3A 4IDHA 2VH5R 3PRJA 4LXYA 2JLZA 1W75A 1JQ3A 3TOXA 3WNCA 3IOCA 3C16C 3T15A 4JB8A 1DGQA 2QSJA 4L76A 4DV6B 1NBOA 2WYUA 3OZBA 4DNQA 16PKA 1RW4A 1YULA 1U8CB 4QJIA 2EL9A 4URHA 4BO8A 4ZCTA 5BUSA 3LC1O 3USZA 1KERA 2YV2A 3BD9A 3PGLA 3HA2A 2BDTA 1ZZEA 5CEFA 1QIJA 2AFHB 2EBHX 1C9DB 1M8PA 2P6MA 2J07A 2YN0A 1ZY2A 3K9QO 4BNLA 2IUYA 3PNOA 4HY3A 4JROA 4TYQA 4I8XA 4Q7QA 5HSGA 5EUWA 1GG9A 1T13A 1GVNB 1UBTS 2XYQA 1KZ9A 4J0QA 4PEVA 1G8AA 4GMXA 4Q02A 2BOVA 2B2NA 1KMMA 2V5VA 4FINA 4AZ0A 1ZCAA 1JHZA 5M04A 3JQEA 3Q98A 4ITUA 3SQNA 5JCOA 2I78A 1JKMA 2XWPA 1I94B 1TM3E 4QO8A 4ZN6A 2PX4A 4Q7KA 5G40A 5KKNB 3JASB 5KNLA 1NJ6A 4NNPA 2V54A 1EE9A 2XYGA 3RIGA 1KRWA 1U11A 4MS4B 2VOEA 4HEJA 2OLKA 2Z3ZA 3EPLA 4RK0A 1QOQB 4HEA1 1XDBA 1OLOA 5EESA 2E1PA 2EFJA 1YMVA 4KXWA 4LZNA 4U7WA 3LVFO 4QFCA 4DZTA 4MPDA 1Y6FA 1U7OA 4XLTA 4E2YA 1QUFA 3K6JA 3N86A 4B43A 4ZZ3A 4HD8A 3MWEA 1DSSG 5I45A 1P1BA 4U7FA 2IP1A 3IP6A 4FN4A 3QVGA 1K86A 1M2KA 4JBLA 3OT1A 3RFXA 2JIDA 2PGNA 2O52A 4UVDA 3ICVA 2C3YA 4Q05A 4YJDA 3TLEA 3TRJA 3WGZA 3PSAA 4DIOA 4LY6A 4BDTA 4GWLA 4XEUA 4RX1A 2OHIA 2W6JD 3GX1A 1O1YA 2J3DA 4CM9D 4QD3A 2DR2A 1UXHA 5A4MS 1NVMB 1MTZA 1U4NA 2PX0A 4OHMA 5C34B 3AR2A 5THQA 2YBDA 3DLTA 2OO7A 3DUWA 4ZICA 5CUQA 3ROEA 4C4AA 4E70A 4V0RA 5TRTA 5AUPB 2BTQB 5FWYB 1R15A 3TRIA 1C0LA 1RBYA 1GKKA 5C8ZA 1RHJA 4G5YA 4FFVA 1CDOA 1LF0A 4PPQA 3SOZA 2OHOA 4ND6A 3LP6A 3NW9A 1SCKA 3A3YA 3SLRA 3TE6A 4E5UA 5B3JC 5ILGA 5KREA 4IEFB 4HZUA 2PQ2A 3FLAA 2A1TS 5CP8A 4CM9A 2ZIUB 5KJCA 2QHXA 5A62A 1WLYA 1TKRA 4QQRA 5CH8A 4CKWB 1F3OA 4BV2A 3RAEC 2J9GA 1P9OA 3GF4A 2IHVA 4LRTB 4G01B 3I1FA 4A0FA 2IITA 2FWRA 2EP8A 2QN1A 2G9ZA 1WEHA 1CC1S 3M83A 5A4AA 2XDQB 3BXHA 1E94E 2GJ4A 1IB0A 3OZGA 4AZWA 5C80A 1XA0A 5KHOC 4DKJA 1YF3A 4JJFA 2Q27A 3U60B 3VO9A 4FILA 1EWQA 3GVIA 4ZAFA 4O0LA 1SVOA 1ID8A 4YRLA 3URMA 4CIAA 1E62A 4AX4A 4PHGA 1NW4A 4H17A 4YCJA 4C7OB 3R5FA 2OORC 4BFCA 2O5RA 3AY3A 2ZZMA 4M37A 1JSZA 1N2OA 3D1VA 5EJGA 4LI3X 1H94A 3R4CA 3QPAA 2PZJA 3M6FA 4MDEA 2AE2A 3EW9A 5CPFA 4HLQB 4BNWA 1DQZA 4ZYVA 3O94A 3HY3A 3QU7A 4GXRA 4H1UA 2ADFA 2X76A 1HKHA 2R11A 2YMQA 4OHPA 5E9AA 4RZHA 1T6ZA 4A26A 3D9QX 5AJXA 1W6UA 2O8EA 4O8ZA 2BKUA 4CMGA 4IXDA 1DC8A 4F8YA 5GV7A 4I4TB 1ZAKA 1QO0D 1XHFA 3TECE 5FUXA 2VSFA 2JJ2D 4R1QA 2JGEA 1M2NA 4BXOA 3HXPA 2ODTX 5K09A 2CL6X 4NULA 2PT5A 2BEVA 3R1IA 5BV2P 3W34A 3FTFA 3R7LA 2R8BA 1E2PA 3BWDD 4IVNA 1UKCA 2HMAA 4DG5A 1XJ5A 3KQWA 1TYBE 2NVWA 3MW8A 4KDCA 1Y34E 1QMPA 2A0UA 1JQEA 1Q0SA 2WABA 3FOWA 2LE0A 2J0VA 1RWBA 5B3JA 4L0DA 4AN0A 3U5ZB 3GUHA 3N2ZB 3R3UA 2Z5VA 4INZA 2YOHA 1IXKA 1QO0A 4ETIA 3HU3A 4LBYA 3H2SA 3D0KA 5LBUA 4DV7B 3KEGA 4UMVA 1M2EA 2HMWA 2NMVA 1M9NA 5FO0A 3I2YX 5HF9A 4KH0A 3ZNOA 3RTAA 8ABPA 2JH8A 3GZJA 3PRYA 4F2WA 4B47A 1LDBA 3R8XA 1C7ZA 1T1EA 3AUFA 4EHHA 3AKCA 8LDHA 3FSGD 1K1EA 3FJ1A 4ND2A 4CIWA 4WTOA 4QEZA 4TQ9A 3I76A 2PTHA 5HRAA 3NHWA 3L9XA 4K5QA 1PZNA 2ZYHA 3DDZX 4K86A 3WWPA 2OORA 3KOMA 1FP2A 4KLCA 1CHDA 4UM5A 4B45A 1NLZA 2BGIA 2WHXA 1MTOA 4OLJA 4D5EA 5I6DA 1NP3A 2HWYA 1H1DA 4TLEA 5H80A 2ZIZA 5B1HA 1QG2A 1XEWX 1E9CA 1TQ6A 3EZ9A 1FDIA 1OFIA 3NFRA 5KO2A 1NMSA 3QITA 1ZZGA 3FSGA 1H5UA 2WG2A 4IBOA 4ZYZA 3H19A 3T7IA 4EUEA 4OUDB 4CLOB 1X9HA 1P7ZA 3DV9A 1KVUA 2QSZA 4BJ6A 1FUIA 3AETB 3Q12A 2ZUEA 1U3UA 3FNHA 3IAHA 3D4NA 2J3EA 4KBFA 4OHFA 5LYYA 4DR1B 4ZWNA 2VDMB 4HAVA 4QM6A 3VM6A 1W0JD 2OOSA 1Q15A 3GLVA 3LGAA 4OGGA 3A6GA 4RMJA 3DLPX 4RTKA 4E5MA 4BY9E 2IE8A 4QYWA 3WYDA 1JR3D 2LKCA 3NRCA 1UWKA 1M1ZA 1KVTA 4Z0NA 4RJIA 1M5RA 1ZQ1A 3IJ5A 3B6IA 2PUAA 2JA1A 1N2GA 4NCXA 4W1RA 3W1VA 2R8PA 1Q3TA 4NJEA 4QBKA 4RY9A 3FH0A 4G0NA 5JNRA 1KP2A 4B4UA 3FWZA 1IJBA 5LQUA 1Y9ZA 2IU3A 4BPRA 3HKCB 3QTTA 4MV1A 1GEGA 1QV6A 1ZL2A 3D5QA 3H42B 5FV7A 5JCJD 3COSA 1TVCA 2DYKA 4GOXA 3IEVA 1R10A 1FL9A 4RPLA 2WWTA 2V6MA 3PVCA 4O4JA 5ALTA 5TGTA 1JEDA 3VR6A 4B48A 5C51B 4HNGA 4G8DA 1AQUA 1JR3A 3BH6A 2VNAA 5AP9A 2P4EA 3GVXA 3ZOKA 4IRXA 5KWIA 2TYSB 1PSDA 2LR0A 3IHAA 1U94A 4P92A 1T1RA 3O8CA 1MRZA 5EMNA 2PUJA 1WZ2A 2NZVG 2HCTA 2EJBA 4WEOA 2W22A 2ZXEA 4X95A 2IPNA 3ZWPA 1EKXA 1LPAB 2NO5A 4L4XA 2HU2A 2AMLA 3Q0EA 4C1BA 1AX9A 1QHIA 2FPLA 3PXDA 4GKVA 1NL3A 3IP8A 3EWAA 3MWGA 4U9IS 5LCXA 2IH5A 1RACA 1SBIA 2LRHA 3KSRA 4R05A 2TMDA 4MUBA 5IJ9A 1OPRA 2X8LA 1YD7A 3N07A 4K46A 3SZOA 4BZZA 3A1EA 4JJIA 4O0MA 3RGGA 2QL7A 1N3IA 3JWJA 4U9UA 1SM4A 1Z4MA 2G4CA 2PAAA 3RS2A 1GN9A 3RW9A 4GPBA 4X8LA 4BFWA 1Q22A 4D82A 4F4JA 7MHTA 5JMWA 2A57A 1KZ7B 3Q10A 5EWJA 2BFEA 1Y6QA 4V2UA 4POOA 4E4TA 3KFXA 5DEIA 3R7AA 2FH5B 1NSFA 5E0OA 4CNBA 2F3QA 2CUZA 4GBMA 4N82A 4YC7A 4FCTA 1T36B 821PA 3KUCA 1J70A 4CLXA 5IJ0B 2QTMA 1EUDB 2KJQA 3FPAA 4NDZA 1QNLA 3FMVA 4PXAA 2DRIA 4K87A 4WZAE 3RVSA 5DYIA 2QN3A 5LMNB 4P80A 2AI2A 2WJIA 3F5QA 5JPCA 1NRXA 1DFGA 2J09A 3QK7A 4KU4A 5JO9A 1ZISA 1CUUA 1XJ0A 4CVNA 3LYAA 1FDRA 1M72A 5CBKA 3I72A 3QLJA 5E4YA 1CZUA 2YINC 4GC9A 4JC8A 2CK3A 5F1KA 2G1JA 4KTVE 2Z30A 1Q3KA 2GKGA 3D3JA 5ECYA 4C7BA 5EUBA 1RWKA 2HFKA 1ZJ4A 2ZULA 3ZHQA 1COZA 1UBHS 5LWQA 1CJTC 2I1WA 4KODA 4DIDA 2E21A 1MVNA 2VTVA 1E4EB 2B5WA 1SIOA 3K8OE 4UU1A 4CTJA 3D3WB 4YDHB 1VA4A 4IKPA 4Q16A 4G89A 4PLYA 5KU1A 4L3OA 1HQCA 1JJIA 4YPFA 3OZRA 4ESVA 1DUIA 1RLJA 5FI1B 5CTJA 1TDJA 3KK0A 3EH7A 3PTLA 4NZNA 1ADYA 2WRZA 3WMGA 4YMHA 1K5HA 4EJSC 5JE8A 3D2BA 4GXQA 1W34A 4KO2S 4MKXA 2VXOA 5CT4A 5FD8A 4D3ZA 1C8VB 1J99A 3M3PA 1KYVA 3GZNB 4JEIA 4IF4A 2CEKA 4Y6OA 4C87A 4EKYA 3E9ZA 3UHAA 1ZVQA 4O1IA 3AW8A 3RAGA 5LXTA 1AHHA 4OHRA 4KR9A 1E0DA 3RRBA 3TW8B 5EIAA 5IG2A 1FP4A 3OURA 4LXQA 1X7XA 5FI5A 2QMUA 2AHRA 1ZD3A 3GRFA 3N2IA 1NC1A 2FP4A 2HXSA 3LP5A 4LK3A 4M7WA 4IP0A 3AFGA 2Y76A 4I4LA 4RQAA 4YRAA 1JVNA 2EU8A 4HWRA 4XFJA 1ZOLA 1ONNA 2CNDA 4PTZA 2DFVA 4DCVA 4RTSA 1I7DA 5H4GA 1D2CA 3C3EA 3ROKA 3TZLA 4Z1MD 1YI0A 2M1ZA 2JD2A 2ECPA 3ZKWA 3H5AA 5TR9A 3R9XA 3OVMA 1NI5A 2XVZA 4RHXA 3WKEA 4J3FA 4LA4A 1WM1A 4EYQA 4LJAA 3HBLA 3EWIA 1PLLA 3PBKA 3G0OA 1UZLA 1LS1A 2AZDA 4JODA 1C1YA 3KQTA 4K3UA 4A0SA 2ZAGA 3DR3A 4BJHB 1TTTA 2FGKA 3LD9A 3MSCA 2I29A 4GH5A 4LFBB 4OU4A 1YB5A 1P7PA 2H4YA 5ALQA 4WY5A 4P3XA 5L6MB 5EQJB 1KQOA 2H1RA 1NVWQ 3JU3A 4O5AA 4PZCA 4LE0A 2J7PD 3L43A 2B92A 3N2NA 4MKFA 1BMQA 3MXOA 5LL6P 3LZDA 1ILWA 1SCBA 3GFOA 5ALZA 4H1WA 1KF0A 4IUDS 4OP1A 4CR7A 2H2IA 1NUSA 2Q9BA 2RHWA 2YUTA 3JCZA 3F6SA 4YT5A 5J40A 3RUEA 4A4DA 4C4OA 3P2KA 1QGDA 1S3IA 1YR7A 2J59A 4RHFA 5IWAB 5EKUA 4EG6A 1A8UA 3ESXA 3LZ6A 3QKTA 4G85A 4KW7A 2ZM6B 1EFDN 2I0FA 1II8A 2DR3A 2FVXA 2VUIB 3DVSX 4MMXB 4QUEA 4W5HA 2JAHA 2D5AA 4ZREA 3RB8A 3QNMA 1KJZA 1W35A 4D92A 1KKMA 1QE5A 3R9KA 4KZKA 4HUQA 5IZCC 1TEHA 4EJSA 1VLQA 4KYVA 2FKAA 3S2ZA 4C0WA 1JYFA 1MH1A 3I01M 3KV1A 4WLVA 1G2QA 4QXQA 5DI3A 1XPUA 1QAMA 1I3KA 2J7PA 3NXSA 3ACCA 1MVLA 4G5HA 2DPMA 4UUBA 3CC8A 1OA0A 1SVMA 3B2EA 4NXNB 2JRCA 2XB6A 1UPXA 2XJ9A 4WSOA 1NWHA 2P2YA 2WV9A 3GB9A 2I54A 3IT0A 2QXTA 3JZDA 3K0FA 3DEAA 3DHVA 2Y0DA 4B2PA 5KYGA 4LJRA 4WA7A 5FWXA 2W11A 1W49A 2ZJBA 3HV0A 1BWSA 2NG1A 2Q99A 4PNZA 4S1NA 3VVLA 1KOGA 3CW2A 3OLWA 1B76A 3H04A 1BAPA 3P97A 1E9RA 4LJ4A 5JAMA 2XUDA 1U90A 4AZ0B 3HV2A 3FDXA 1XVAA 4CEIA 2OCBA 3WLRA 3T99A 3S1AA 1Z17A 3ZJ4A 3EA5A 1IUPA 4YCBA 5AJTA 3DTNA 3U1TA 1X0VA 3OEYA 4Z6KA 4TKVA 3D3UA 3RUIA 2PX8A 2ZTHA 4HPWA 3RBZA 3GP5A 4JXKA 4AMGA 4Z4HA 2XTMA 3EQZA 3K72B 4H6PA 1QTQA 1X9IA 3ZDZB 1EEXB 1BC5A 2OECA 2VAMA 4WOJA 3UCEA 1W85A 4KXFB 4A6EA 1E2JA 4LCBA 3OZVA 4CLHA 2LCIA 3TNLA 3HJFA 1BH2A 3DAFA 1R2QA 4JFRA 2C94A 1RRPA 3GCGA 4PZEA 2AB0A 2DKNA 5A7HA 3N0VA 1VM6A 4RV5A 1BE6A 1T8UA 5BRJA 3MWEB 4CJXA 2Q1YA 5FDFA 4GYWA 2WVJA 4JB2A 4F85A 4YCMA 2EL7A 2Y2UA 3QVGB 1J8FA 2WJVA 3LQ4A 3OT1B 3QU2A 2XSZD 4GE3A 4XDHA 4ZQBA 3V5NA 5LZ8A 3M5DA 4LTNA 4OHKA 2R1VA 4H7PA 1IIBA 1NXTA 2QTWB 4GRDA 2AL7A 3PEYA 5JVDA 4QPNA 1C7JA 3CRVA 1MP0A 3SJBA 2V97A 2OY0A 1Z8DA 1X92A 2YC4C 3TPCA 3V2IA 1ULAA 5EE0A 2VF7A 5EERA 5FADA 4FD2A 3C7CB 4RJ2A 1XTKA 2BMJA 4IIJA 3TI7A 2YIVX 4TT3A 3WLJA 2X41A 4I5FA 2WT4A 4H6XA 4TXLA 4N9WA 1R5NA 4QXMA 3LZCA 4FJ2A 2ASVA 1WKCA 4JD5A 2QP4A 1Z15A 3AR5A 4K81B 4O4JF 2PZ8A 4K9QA 1MO4A 3H97A 4KDFA 1L5LA 1PK8A 3QRWA 4KXLA 3EMDA 3D43A 4WADA 1JLHA 2CUTA 1Z8HA 1PNOA 3I58A 4D41A 5CDFE 4B9AA 1L6RA 1LBEA 3KWFA 4CMKA 2RH5A 3AEUA 4BB5A 4HZUB 4C3UA 2ZTMA 4IOKA 4HSGA 1QIEA 2Z4TA 1BE1A 2VS1A 1XTZA 2RGNC 4LNAA 4Q6BA 1ELOA 4OQEA 4QXAA 3WL6A 4JLOA 4Y6LA 5DHPA 10MHA 1K4YA 3PNMA 4EUSA 1UJBA 1VA5A 3GLHE 4ACBA 4PLPA 2DFDA 3BS4A 2WSIA 1QLHA 3O84A 1SC1A 4C22A 2W83A 4OJNA 3W5SA 1A9YA 1YB4A 2IS2A 1CK4A 2FN4A 3TLBA 4KZPA 5LZ9A 5A3VA 5A7GA 3PT9A 5JPIA 5K8TA 3DDOA 4RE6A 3UGQA 3FMGA 3T6KA 1BXKA 3DMPA 3PKZA 4AKHA 1WV1A 2QVYX 1A9SA 3GL9A 2ECFA 3QX7A 4B40A 1EJ2A 4MQBA 5H1YA 1G4AE 2B9EA 2AMVA 2HDOA 1UBOS 1NXQA 5F21A 3F46A 3P4XA 5HDBB 1R9NA 2VPYA 4RLHA 3DMNA 4ZCRA 4OLAA 4G5GA 4RY8A 3A31A 2J5KA 1GGNA 1S2MA 3WRYA 3WLSA 2ECKA 4A1FA 1JIQA 1N6PA 4B6QA 2CXOA 2YRFA 3DVAA 4JT4A 5KCMA 2F00A 2EGHA 4KOAA 5C7YA 4JH0A 2G28A 3K8YA 1P5FA 1U2QA 2O8EB 3GVKA 4R5MA 5CYPA 5CYOA 4MQ6A 1ZU4A 3P27A 4M88A 3F1KA 4O2RA 3VHXA 2A0WA 1ZUHA 2CC2A 3WX0A 4QUAA 4ZTUB 2J9RA 3LDHA 4ESEA 1P77A 1R5JA 5DNWA 2JJYA 2NZJA 1GQSA 2H07A 1WPXA 2Z6VA 3S2GA 2Q50A 1AO3A 4JJEA 4BO9A 2BEVB 3AKEA 1SXQA 1OFGA 2B3DA 1SZJG 2HADA 2G6TA 1U8YA 3AVOA 5T7BA 1DOAA 2I8CA 3KAPA 2JI4A 4X7MA 3GC6A 4J6FA 5JWHA 4AK9A 2Z3VA 1L3BA 4BQSA 1BJKA 1X80A 3FLMA 3FRJA 1M73E 2UUBB 4WVFA 1VLJA 5M7EA 1I3MA 1KAQA 4EJ0A 1X19A 2ONYA 4MLDA 2HY7A 2OEPA 5JY6A 1UDXA 4XJSA 1ZI9A 2RG1A 2RGNA 3P9KA 3PP8A 3DFMA 1XZFA 5IVPA 1D6JA 3N70A 1KVQA 1WAMA 4HYLA 4WECA 1W73A 1O2DA 1FYVA 2HA6A 3R76A 1XVTA 2OC4A 3F67A 3X43A 3UKJA 2CFTA 1L5NA 4MVJH 2HRZA 5LXTF 4G24A 3KTDA 3ZTYA 3HNOA 3L05A 1S8AA 4KITB 5HGXA 1V26A 2W2TA 3VO1A 3VBEA 2CXNA 4QELA 4AMZA 5CIWA 4DLLA 4RD3A 3DEYX 4BQNA 1XCOA 2PK3A 1V3QE 3BMCA 4OI4A 3PLNA 3LC0A 1NJ1A 5K3BA 3TR5A 2WSLA 4CHGA 2CLSA 4NYIR 2RRLA 3MAJA 5CB8A 1P81A 4QQKA 4BNMA 2PUFA 2MMCA 1LZKA 1D8TA 4FXOA 1YDFA 2RC5A 2WU8A 3ASVA 2NSLA 4JUCA 4Q4DA 4CR8A 3BK2A 1U8TA 1EFRD 2DFTA 4HFMA 2XGSA 4JUBA 4C07A 1PV4A 4I4NA 3TSZA 5JZVA 3DKPA 4TLLB 4RANA 1P2VA 2Z9BA 4Q3OA 4JOCA 4S3MA 2QNBA 3OPMA 3WG9A 3KSMA 3WIBA 4Q4JA 1FC9A 3FCAA 1UL1X 3A3PA 1Z6YA 3G0DA 1KE1A 4PYQA 4UXHA 2I22A 3I9FA 3CWCA 2D2EA 4FBGA 3RRJA 2HWWA 4KBGA 2R7AA 3JQ7A 4DQUA 3HK2A 3PQ4A 2P0EA 4OOEA 4LYFA 4GLJA 5ISMA 3ABZA 2RE8A 2HSDA 2IU0A 2EJVA 1J06A 3RSOA 2Q9UA 2BFCA 4N8EA 4HL6A 1E7MA 1SKQA 2P6PA 1UT5A 1JALA 3FWHA 4J0JA 4JJ7A 2HCRA 4K9MA 2R1TA 5CH3A 4K26A 1TM2A 4W9RA 3F73A 3DLIA 5JAPA 6REQA 2MSEB 1QC5A 4A8JA 2X4IA 3NGMA 1S1CA 2WJAA 4MPTA 4AW9A 4NJEB 3WJAA 1H6CA 2IY7A 4I19A 2ZJZA 2RB4A 2GCGA 4PQGA 2FLVA 3I6ZA 4FHDA 2OO5C 5GONA 3SIWA 3OHSX 3ZIAA 2HA5A 1DARA 2AYXA 4LXUA 4MKGA 4B4KA 3FWPA 5EKTA 2R62A 4PX2A 1XCMA 4OQMA 1US8A 2C92A 4HDCA 1TIBA 4DVGA 1QVAA 2IVFA 1PP4A 1FYFA 1LPMA 1NW5A 4O4JB 5DOZA 4ZAGA 2IV7A 2JAWA 4A1OA 2CBXA 4DOMA 5A06A 4X91A 3HRIA 4A6DA 1MAVA 3W2FA 3UEOA 1N2EA 5I47A 2RI1A 1GT91 1PEDA 3U62A 5JNTA 3LLOA 1GDTA 1OWOA 5HILA 4A2QA 5EMLA 1QYRA 3CZ5A 1BROA 1T6YA 1ZUNA 2BKLA 1NTRA 4I9HA 1UEJA 1TEVA 2GFHA 2ZUVA 3SYRA 1PZEA 3VTFA 4E51A 3AU9A 4UMDA 3S2SA 5B58C 3QF4A 2ZSUA 2XOKD 3LGSA 4C0QC 2I2AA 2OWEA 4GHWA 2GETA 2D2IA 3I9LA 2I4MA 4I50A 1XZKA 3Q88A 5AHWA 4S2EA 2UDPA 3D3QA 4RACA 4D56A 4IL5A 3H5VA 4M4SA 1OD6A 2MTBA 2DR0A 2HJGA 4CU5A 1QHGA 1V6SA 3QSGA 4B3FX 3VPHA 5F4ZA 5IJ9B 5JBIA 4D57A 2CJXA 1NG9A 2C07A 3QXGA 4IFBA 3EC1A 4DLNA 2VDRB 4AJHA 1QHHA 3L7JA 3MLEA 3JRNA 3HRHA 1DV2A 1O08A 3D1LA 2BFEB 5EWJB 1HEYA 2WP8J 5HFNA 1NFQA 1EE2A 3W5CA 1NI3A 2XOKA 5AKEA 1IOLA 1E2FA 1SCAA 2C2KA 4LOJA 1Z4NA 3DCNA 4CIVA 3PHBE 1ZKDA 4QOGA 2K87A 2CL5A 2GN2A 2Q3LA 4ZOLF 3ZS9A 2IYTA 2RFLA 1OX4A 1JG2A 5EHNA 1ODKA 1Y1SA 5C4IA 1XXLA 5JVDF 4O63O 4LQDA 4YUVA 2JHCA 4LYGA 5EHIA 1FDTA 2GXSA 3BEDA 1Z5UA 4WNCA 2WYWA 1JXAA 2AZMA 2YJ6A 2YFYA 5DWDA 3GT7A 3UMCA 5K3OA 2C9CA 3ELBA 2OO5A 4IHKA 4IIJF 4YO7A 5CHYA 3WVNA 1V8ZA 2ASEA 4GBED 2P0YA 1WP9A 2PGOA 4WFQA 4WXHA 4JI3B 2NZ2A 5PNTA 2NW6A 1N8KA 1UJ4A 2DXNA 1JPUA 1QIKA 1UKAA 3H99A 3PT5A 4FHGA 4ED9A 1AF4A 3H05A 5G02A 2J08A 3EJWA 2B8EA 4UBKA 3T06B 2A9PA 1JDUA 5DYYA 1J00A 4C30A 5JASA 1ULSA 2Z0MA 1PWZA 5BOSA 3PGVA 4NESA 1PEAA 1Q6ZA 1Z39A 3KV3O 2GK4A 1GHTA 2XI4A 3ETNA 1AG9A 4JZYA 3E4DA 4DIBA 5ES3A 1DB3A 1XRLA 1C0PA 4M2LA 5JZOA 1C2YA 1L4UA 5BWMA 3OT4A 3D8TA 1TT7A 3UB3A 4R84A 3ABSB 4PRLA 4CEJA 2WUEA 2JGJA 2ZUBA 4GEGA 4KPGA 1E9DA 3ZWWA 5LXTB 4BMZA 4ZU6X 1FP4B 1ULBA 5EG5A 4AP6A 2W37A 1X7XB 3CF0A 1BEEA 2GPAA 4HYQA 4LJSA 1G5PA 1J1ZA 2XNHA 2FP4B 3KTFA 1SZDA 4CQMD 5ARCA 1VIVA 1YRWA 2CNNA 1EWRA 3UOGA 2O2GA 4ZIRA 2ZPTX 4B44A 1KMHA 1Z13A 2C57A 3IMEA 3WK9A 1A2KC 4OVKA 3NT2A 1MH9A 2WWXA 1GU7A 3ZKWB 2VPIA 3OQOA 1P75A 3R9XB 2P3LA 5J58A 5D85A 5AFSA 2EBFX 2D5LA 1XTUA 4MWOA 1T5BA 4E0BA 3GAZA 3EW7A 3ZJTA 3L0CA 2P41A 1ISGA 3H5OA 4RK7A 1A2BA 3F2VA 4UD6A 4ZJZA 1M34A 2AYYA 2JI9A 5FA8A 1NKTA 1DKOA 4Y2UA 4FDMA 4HC4A 1ACMA 1EGQA 5IK2D 1X7HA 5CEEA 4CQMA 1W4RA 4IQ8A 2Z08A 2F9LA 4X97A 4CL8A 2C3MA 4NYIQ 1T4DA 2QJTA 1LH0A 2ZQZA 3N2LA 2WW8A 4LWQA 3UA4A 1EFUA 5CXSA 1RHQA 1J90A 1R6UA 4Q24A 4TUYA 4PZDA 2IYOA 4GX2A 4PLVA 2XWSA 5HCNA 5JRDS 4N1AA 4QATA 3HVUA 4YRFA 3UK0A 3VPGA 1LX6A 3WNQA 2VP6A 3WGTA 1KFBB 3HL4A 2YCLA 1N6EA 2HA2A 3CVOA 1IG0A 1UWLA 1MD9A 4WCVA 1MW9X 2CW5A 4TSKA 1HZZC 3Q0TA 3V7UA 1II8B 3ECCA 3KIPA 3S2YA 5BMVA 2X1MA 4L8LA 1DIRA 1MX1A 1OXKB 4XWKA 2PL1A 5ALJA 2VHJA 2P3SA 3QEMA 5IK2A 2ZOAA 4DY6A 5K0TA 1ORVA 2C00A 2XQIA 4CKEA 1T8RA 1Z6TA 2P2LA 4HUQB 4EJSB 5L7TA 1SUAA 3AGQA 3GNLA 1QIFA 1B6SA 3DB1A 5DI3B 5DHTA 1ODTC 1PKEA 2I99A 1JHXA 1LNQA 3QE3A 2POQX 1PJ2A 1QIMA 1CNEA 4QEKA 1JVSA 1NMEA 4ZQIA 4DWJA 2KA5A 4B7ZA 1ISMA 2BDEA 3CT4A 3CNHA 1QK5A 2G72A 4S1VA 1MRNA 3AM1A 3TL3A 3K0FB 1TF2A 4D74A 5CITA 3NPAA 2GZ1A 3PEEA 3F71A 4PLGA 4EJFA 1K0FA 2TMGA 3OOSA 5FWXB 1W76A 4PZAA 3FIUA 5ITZA 2ZRIA 2X1HA 4CDRA 1CY0A 7GPBA 1OVMA 4LX0A 3JAKA 4EITA 2G5CA 2X2OA 4WK6A 4MIEA 3CINA 4OPMA 4QC2A 4V1CA 1IL0A 3TM4A 4DTCA 3BMNA 4CEIB 3RUHA 5K45A 1VP9A 1E6KA 4PW0A 3S1AB 1BU8A 3PUJA 1E89A 2AW3A 2C98A 3E2MA 1R0YA 3WNVA 5IUNC 1AQ6A 3HTXA 4TKVB 1GZHB 3DO6A 4Z8XA 4QT0A 4HMOA 5DHFA 2W2PA 5ALXA 3TI9A 1TQ4A 1MEEA 1XTIA 3RM3A 3B7PA 2QTGA 4W5TA 2I34A 1G2PA 1SH7A 1W85B 4R51A 3EEBA 3GMFA 4LK2A 1U1IA 2CVHA 3IEXA 4PWZA 3SHOA 1PCXA 1QZTA 1NHGA 2F7SA 2ZJOA 3K9HA 3N39C 4RBNA 3IMKA 4KBYA 4DJJA 3GW8A 4KEAA 3PCRB 5HKKD 1RCFA 4YRBA 5AVXA 4EATA 3E4CA 5G0UA 1T5OA 3RJTA 4G8CA 3QDQA 1JIVA 4UTOA 3D5TA 4HQLA 2A0XA 3GCDA 3K05A 4WBSA 2R6FA 4BQQA 5DP2A 5CVVA 5L3ZA 1HZZA 2QM7A 4RKWA 5K3FA 1LTQA 2QEQA 5FOSA 5TLSA 1SIWA 2P90A 1ND6A 2I66A 2R1VB 2VWPA 4XS5A 3VRHA 1YOVA 3H9GA 5JVDB 4JR1A 4C3OB 4EA7A 3CVUA 2GJKA 3HMKA 3EC7A 5GIOE 4WXEA 1POWA 3CR8A 1L4GA 3WNZA 1XQXA 1CUYA 1ECJA 2JI8A 2B4TO 2MYPA 2QTHA 2W6ZA 3MRTA 4HTFA 3PHHA 4IIJB 1SQWA 2ZATA 3DE7X 3EA0A 5JADA 2FPKA 2OSVA 2C5SA 3JQCA 3ND6A 5GONF 4F0JA 3G02A 5HKKA 4GEKA 4NS1A 2GVZC 5ITWA 3EVCA 2H8KA 1X2EA 1W96A 1YS2X 3IXMA 4M49A 4DLTA 4EABA 1Z56C 4I1UA 4FJ1A 4F1JA 3ZHCA 2ZREA 2FXIA 3V7FA 1KK0A 1ID1A 2HTEA 2FZVA 5HQJA 4C1NA 4H7EA 3K0CC 2PWYA 2R8EA 3CLKA 3VYVA 1KDVA 3CRW1 3EGXA 1YU6A 1T15A 2J67A 3AEUB 3MIIA 4L28A 2C03A 4K8RB 2E4VA 2HIMA 3ROZA 1K5GA 3WL3A 4FCWA 3HNPA 2GPNA 3OMXA 1H0KA 1WOMA 3ONNA 4N7MA 5DKFA 3RS7A 1SY7A 3U1VA 4P4UA 2XLBA 3OOHA 4U8HA 2XCOA 3BRQA 2YQZA 5CLFA 4L5CA 3OZCA 2A33A 4ZKEA 4I50F 5E0KB 3GP8A 1WXEA 3UJAA 1FIUA 3V4LA 3G0GA 3BAFA 1B1AA 3DULA 1YA8A 4KE7A 4NJOA 3UW1A 4AB1A 3G49A 3TLJA 2WWYA 1Y9AA 1JDJA 2VHCA 1K32A 4B71A 1JBKA 3EB9A 3MAAC 4KMMA 4DRZA 5E4FA 1HM5A 3X1XA 4RADA 2AOXA 3IP5A 5FUQA 5ITSA 1UC8A 2ZGVA 2WIAA 1I4EB 3A3KA 1ZMTA 1OZ0A 4TTVA 4G63A 1KEWA 4X45A 1K2VN 3EXEA 1A8IA 1OZAA 3OZWA 4NCIA 4RM3A 3VAAA 4BKMA 5DYNA 3VNUA 2GN6A 1DEKA 1GUZA 1FZTA 1B2LA 5A9SA 1SJ9A 4JBHA 3RIEA 3DS8A 4OJKA 3B9BA 2ZANA 4LF9B 2P9GA 3DVAB 4QLAA 3AEZA 1QLJA 3FYDA 2VHEA 2QR3A 4E94A 4PN7A 3EEYA 4X6XA 1GUBA 4RGVA 2H4WA 3A4LA 4LOHA 1E3SA 1GA4A 4MHSA 4HVCA 1PJSA 1EDOA 4L75A 4MLCA 5DNAA 4DR7B 3FUWA 3VHXB 4LSWA 2PO5A 4HUJA 3THRA 2P3OA 3IBSA 3TNJA 4HOYA 2GEFA 1II0A 2FI1A 1GZ7A 4UE6A 1HYHA 2Q5LA 1WETA 1XZLA 3R3JA 4M9QA 4LSMA 5COAA 5KTNA 1WXWA 1SD2A 4ZV7A 5ICMA 4MQ5A 5CFOA 3B78A 1X80B 4DF3A 4FFNA 2PSFA 2ZITA 1AMNA 2WA1A 3AEKA 3L1IA 3OJWA 2JBHA 1W4AA 1HR0B 4WKBA 1QRDA 2PQ6A 5DULA 4LVNA 1LB1B 3VKFA 1WG8A 3SCZA 1IBCA 1EAMA 4GXNA 2HW8A 3PIRA 3IEIA 5BSWA 1YIAA 3AFIA 4RCVA 3HYCA 2D54A 3JYPA 1AOXA 1AGXA 4H15A 1KBQA 1E2EA 3A32A 1IN6A 3OZDA 5EQTA 2QENA 1P3Y1 3IULA 3KOWA 3MUOA 2ZK7A 3NHYA 4TGLA 1FNDA 4E15A 2XYVA 1MVOA 2LD4A 4RKEA 4NZOA 1IBKB 2F2TA 5KDDA 1A95A 4C05A 2PMCA 2HIHA 2I2FA 1NC3A 4LVUA 5JZMA 5KYKA 4U2FA 3P4UA 2VK2A 5EMKA 4DAEA 3LKLA 5B53A 1P61B 2CCGA 3P45A 5DNVA 2VPQA 4RYLA 4RPKA 2L42A 4RFLA 1ZS9A 3L07A 4JLUA 4KLNA 4ZCMA 1DKQA 4RKFA 1TQHA 3ECSA 1ZXXA 3Q7IA 2JIQA 4Q4JB 2P38A 3KU4A 1EHIA 2UZAA 2RIRA 4KR0A 5FORA 3C6XA 3QVJA 1K97A 1PJ3A 2HO5A 2NOAA 3OM1A 3MTQA 1IQPA 1YKSA 3BCHA 3N0TA 4TUYF 2CE7A 4TQGA 2J33A 2P5UA 3JQ7B 1UT8A 1AKWA 2AUSA 3C8DA 3GEGA 1B8VA 2GRJA 3HDTA 4X85A 1HL7A 2ECQA 4QXPA 2Q41A 4UEQA 1KAMA 2AJBA 2BFCB 2GESA 1Q44A 2QMEA 3QKSA 4FNAA 4L5JA 4K9DA 3HA7A 4P3PA 4TVSA 5CB4A 1H3NA 2R1TB 1MABA 1Q50A 1CZRA 1JILA 1XT6A 1QTNA 4H0FA 4HQNA 5BMVF 3Q0IA 1BFUA 1KO1A 1T2VA 1RDFA 6REQB 1QC5B 4A8JB 2MR5A 1XZQA 2VWQA 1QG4A 1DRJA 1X74A 3T61A 3OC0A 5ESDA 2PD6A 2QKYA 1PD0A 4MVJD 4AF8A 5CFNA 1M1YE 1MN6A 3AB8A 4MRSA 3RT9A 5GONB 4QXOA 3TW6A 5BV8A 2IP2A 2EOAA 1DHTA 2PT6A 1U9YA 1PYGA 2IIPA 1T24A 1US8B 3CLTC 2NZYA 5TMPA 1NASA 1YL7A 2UUOA 5F5NA 3VH2A 2Z98A 2C7BA 1PUIA 1L7QA 3FOEC 4N3NA 4ZVQA 1D1PA 5BUQA 5AM4A 3U3ZA 1Y6GA 4LE2A 3DLBA 1HTTA 2YV1A 5FPQA 3SNHA 4WQMA 4FIDA 2OQIA 1I36A 1K27A 1JA0A 1XEWY 3JPWA 1ZUNB 1A76A 4WVLA 3KQKA 1I13A 3QXSA 4MVJA 2QROA 3WI7A 3AUUA 3QF4B 3H4MA 3Q8XB 3VUFA 5JQGA 1JGTA 2IPLA 2OB1A 3COPA 4YJKA 5TMEA 4I50B 1P8JA 1J2JA 2P35A 3RFVA 3W8RA 1NT2A 1PU2A 3SQDA 3VKWA 5H81A 4C9BA 4I6GA 4IRUB 4ZCPA 2D7CA 4XB6B 2IHTA 3MT7A 4FC7A 3TCNA 1L7NA 5K0FA 2XZOA 1EI9A 3F5FA 4CKBA 4G36A 2PJDA 2QE7D 5MN6A 1YE8A 4I66A 4BVJA 1YRQA 1QHHB 4KP7A 4RWEA 3K0AA 4H0NA 1SVSA 4Q4LA 5B4UA 5ICSA 5SZIA 3ITKA 3LY9A 4WACA 3H0CA 5LB4A 2Y1EA 2L18A 3GFPA 3K6RA 4L8WB 1W5TA 3CLTD 1ZOPA 3IV9A 3KG2A 5LDHA 1JIUA 2BUCA 1DKUA 2ONZA 2OV4A 3DL2A 1QGOA 4OQFA 3VSBA 1W6RA 4RSHA 1LPSA 1UJ2A 2J5BA 3F8WA 2UZIR 1OX4B 1UODA 2ON6A 3LKVA 3NKVA 1N33B 2IDMA 5J4VA 2GBFA 3ROPA 2TRSB 2H31A 2QE7A 2RKWA 3RFTA 2X9QA 1JI3A 1JHUA 1O95C 2R84A 3IT2A 1U02A 4FCCA 4PYRA 3MWJA 1UXKA 3UT5A 1KJNA 5D6NA 4IM7A 3T1TA 1TCCA 3REFA 4JBYA 1TZCA 1PGQA 4MP6A 2RAFA 3LAWA 2ZVDA 4PG7A 1QQ7A 3NCHA 2G1PA 3IB6A 2X58A 4IVPA 2GBIA 3IX7A 4X84A 3H5WA 4TXMA 2D3TA 4FFDA 4Z9AA 2CJYA 2HMVA 4LQLA 1V96A 4MW5A 1KQNA 3UGKA 3TLMA 4TQAA 1R8SA 4Q18A 2XF8A 4DYVA 3AR6A 5BOSB 1P4JA 1Y1TA 3OTHA 2L82A 5BQOA 3UGJA 2VUSA 3UUWA 1MPXA 3DQQA 3IV7A 1AKMA 3U39A 3FOFC 1NUAA 4DYHA 2A9QA 1D09A 1V8PA 2RONA 3K4HA 3PICA 4RAOA 3AHCA 5EPEA 4GOKA 3ZHYA 4BEBA 3OD5A 4M8SA 4Z4QA 4A6PA 1T8PA 3EHDA 3PUIA 3ZIDA 1UC5B 3WKDA 1F8XA 3NBKA 2A9RA 4CEJB 3AV0B 1ZJWA 1GPYA 2HI0A 3RJ5A 4KGZA 1WEKA 3PD1A 1RMQA 2N9UA 3N28A 4DR2B 3LX4A 5HCIA 4F1WA 5AKHA 1PWYE 3CRMA 2G9VA 3Q3JB 1O95D 4LE1A 4ZIRB 2FJUA 1TOAA 3GOHA 1KMHB 3X1ZA 1VL0A 1CIVA 3K53A 4DJAA 4CZ2A 1HYBA 1JG6A 2GF9A 2IPOA 4N7RA 4TS3A 4P7FA 3GJTA 2BSXA 1PTJC 4LX8A 3W8FA 1AQIA 5IT4A 3O47A 1YHNA 1HETA 3PLAE 1HBJA 4QQFA 1M34B 4JDPA 1NW9B 3WLLA 5KTTA 1E18A 2W8BA 1ZM7A 2WF9A 4RJKA 2GAJA 4W63A 1VHDA 2X0EA 2Y6UA 4CQMB 3DHWC 1H2XA 2PS0A 1IK6A 3RRYA 1O95A 1PDWA 2KLHA 4XDZA 4GLFA 1T34A 2CNWD 4PAGA 3JARA 1IXYA 2CMDA 1CD5A 3IBCA 4TTTS 4LHXA 4TUYB 3WGGA 1L8LA 2ZROA 4RLQA 1VCMA 4ZQFA 4ATNA 4YV7A 5K0BA 5MFZA 4ES6A 5KVVA 4RZSA 1LRLA 5L8VA 1B6GA 1VKZA 3QENA 2MSLA 3HU1A 3V8PA 4OG2A 1W47A 1P80A 4BLPA 4H7FA 2K6GA 4Z2YA 2JLAA 4II7A 1NYLA 1T1JA 3E05A 1KI9A 5BMVB 1KHHA 3P9CA 3A36A 1OH8A 2PT9A 2UUCB 3OZTA 3QEMB 3ZV3A 4XEHA 3RK4A 4X7PA 3LQKA 3OZFA 4CKEB 2OT3B 3WGKA 1Q91A 3S81A 1ZN8A 3HABA 4MQFA 1R50A 1U0FA 4ZOAA 2CNWA 3OUTA 1SIBE 1ZU5A 2E6KA 2JDID 1NVGA 2VDLB 4K7JA 4EY5A 1ND5A 2RBKA 1EYZA 1KIFA 3M34A 2J32A 5EMMA 1L4BA 1XRSB 1SVUA 1W8IA 3JVEA 2PS3A 3EGCA 4PZYA 5EA2A 1PFUA 3WWDA 4WINA 1HDGO 1E8DA 4UEKA 4KWHA 4D9HA 5I4KA 4F46A 3QE4A 4TM8A 5B2EA 1M2WA 4IGFA 2KE5A 1WY7A 4N3GA 3JAMA 2ERXA 3PNSA 1YDHA 4GLLA 5ITZB 1TZ2A 1ZA2A 2AS0A 3L84A 5IXJA 4WEQA 3HJHA 3SEFA 3ZQUA 3HVJA 1SG6A 3JAKB 1KYWA 3AM3A 4BIIA 4V1CB 4MDFA 1YTUA 3JU4A 3FFWA 2QTBA 1U2DC 3OJXA 3BMNB 1PTJA 4D3FA 4OFBA 2JI6A 1CIPA 1M3SA 2H48A 2PX3A 3OLQA 3R3WA 1XRMA 4F21A 2EXXA 1L6IA 5BSFA 1BIFA 1USIA 3R24A 3TZKA 1T5DX 4U6SA 1VE7A 3WMRA 1RE0A 3I5XA 1MFZA 4LQ4A 5LPNA 2O0KA 1NVKA 3DW3X 2WHEA 4MKHA 2Q8PA 3BYZA 3B3QA 4R2IA 1KDOA 3VDXA 3UG7A 1L1QA 3UV3A 3JWIA 1YMUA 3MJEA 4MSUA 1KO4A 2RK4A 5KYTA 1OWLA 2CNKA 2ACEA 1BNCA 2QSUA 4MKIA 3EAGA 3B38A 3IR5A 3STWA 2CHEA 4EOGA 4BE7B 5LDDC 3T3IA 5K3FB 3IHWA 4DA4A 5BSRA 3RQIA 4HDSA 5CB4F 1RJWA 4II2A 1ZBQA 1YOVB 5F3DA 3V4VB 1D1QA 2AXEA 1BW9A 3EXAA 3HDVA 3KDPA 2XAUA 2PG3A 5KTPA 4TYYA 5AVJA 1NW3A 3OH8A 1VE6A 3QH4A 4HTFB 1NXVA 2LBPA 2WNHA 2ZI3A 1KZ4A 3NHMA 1MO3A 5B4TA 3X1WA 2X3YA 1TIKA 1HY3A 1QFYA 3BXFA 1AZLA 1D2EA 2OOKA 2QZ4A 1D8AA 1T6BY 2F1HA 2HK6A 3AWDA 5JCPA 1RYFA 1VPLA 1VFPA 4RK1A 3LY5A 1LWNA 1S8FA 3E0QA 4GD3Q 4FFPA 4CG3A 1I5OA 5BORA 3EGXB 3H9CA 3IP3A 3ROQA 4LRWA 4DSOA 5AESA 2AG6A 1XZAA 2A2ZA 4JUIA 2OUKA 4GR9A 2V7VA 1U2DA 4NU6A 1WDMA 1I7LA 3ED5A 1P1KA 1WB9A 4MVJF 1JHPA 2CDAA 4FE4A 5JQGF 1MB0A 5AVWA 3KBOA 1T3SA 3CGWA 4GI2A 3JD1A 4RA6A 1JXOA 4HNAA 2FE4A 5DO9A 1Z0KA 3LLVA 3ZY3A 4F7DA 3GHFA 2YV3A 2FGJA 2FW1A 5AKGA 3T9FA 4AN1A 4DABA 4A36A 4IIDA 3QVWA 1G8GA 3BD7A 5HRCA 4B3GA 4ZI2A 4LMAA 4M8KA 3SJUA 3KQPA 3X1DA 3CH7A 4Q1FA 1I4OA 3LT2A 1K68A 3RRMA 3ZD7A 1BA3A 2A0KA 4ZZ2A 4HAYA 3F43A 2CD7A 4EB3A 3DDUA 1XELA 4V0ME 3VU9A 1EXMA 2QB5A 3TQOA 2G17A 3EXEB 1HE2A 2FQQA 3EIFA 1E9SA 3FOBA 3H5LA 4GQIA 4AVYA 4GRAA 5T6MA 4CQLA 5HQ3A 1KP3A 5A9SB 4K6HA 5G0SA 1Q16A 2WWVD 4Y1FA 5LOVA 2IXEA 2RJOA 3RBAA 2ZVJA 2OXCA 3PC8C 3WLPA 1FS6A 4OQLA 1GKLA 4RZXA 4NMHA 4K2HA 3Q6MA 4PHHA 1JR2A 3WOVA 4EW6A 1QF9A 3AL2A 3ZI0A 2Q4DA 3OJ0A 4LYAA 4R2MA 1Z06A 2E0IA 2HV9A 2JFXA 3L82B 3LWZA 2H1IA 1JHVA 3ENWA 3NAMA 3PGJA 4OQDA 4AP5A 1VKHA 4ND5A 4EKGA 4GNKA 4KVGA 4YECA 1LLQA 2JF0A 1YS4A 3B8EA 4NXMB 2ZBDA 4F97A 3FLEA 4NFYA 3CO0S 4NQZA 1ENPA 2Q6TA 5AUQA 3IAEA 2RARA 2J6BA 4ZO6A 1D9XA 2V6FA 3FFAA 3G6KA 1IH8A 1NQOA 2XQVA 3VC1A 2WEKA 2FN8A 4FPXA 1VBFA 3AEKB 4K88A 2EF0A 1SG0A 5HKLA 4ESOA 2J45A 4G1MB 5GADl 2VP4A 4QXRA 3BGSA 4KPUA 4MQEA 1Z7BA 1V1RA 3VVBA 3GGDA 2FDCA 1XF9A 5DI9A 1WR8A 3M4ZA 3DSRA 4UC0A 4WK2B 3F9RA 1VJCA 3FHCB 5L6LB 3NVKI 1RP7A 3LA8A 1CR6A 4IDAA 4B7CA 2II6A 2KHZA 3HWWA 1NSYA 4DR4B 1Y3HA 2G82A 4UVGA 1WPGA 5THXA 3DWGA 3RRXA 2IX9A 5LBIA 3RE1A 4NI5A 4TLCA 4Y3UA 1W19A 1GA1A 1CJVC 2OFXA 1MEJA 1FXWA 2OV1A 3C41J 4Q3CA 4DA8A 1B7GO 3GJZA 3QXJA 2H1OA 4CL2A 2R7MA 3ZGVA 2A1TR 2Q5EA 1SCJA