3C0KA

Crystal structure of a ribosomal rna methyltranferase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
395
structure length
395
Chain Sequence
SVRLVLAKGREKSLLRRHPWVFSGAVARMEGKASLGETIDIVDHQGKWLARGAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGLPGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQGPVTGELPPALLPIEEHGMKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTYRDRGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLFQKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Escherichia coli 23S rRNA:m5C methyltransferase RlmI (YccW) reveals evolutionary links between RNA modification enzymes
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
molecule keywords UPF0064 protein yccW
total genus 124
structure length 395
sequence length 395
chains with identical sequence B
ec nomenclature ec 2.1.1.191: 23S rRNA (cytosine(1962)-C(5))-methyltransferase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase
A PF17785 PUA_3 PUA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 3c0kA01
3.30.750.80 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA RNA methyltransferase domain (HRMD) like 3c0kA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c0kA03
1EJ6A 3IV6A 2AN3A 4EKIA 1UIRA 5LQAA 5HIIA 5ICCA 3H2BA 4K6MA 1INLA 3REOA 4B17A 4E2XA 2GH1A 2N47A 3UJ8A 4ER6A 2CX0A 1XCJA 1ZL3A 3C3PA 5EZQA 2PV0A 2ZZMA 3A7EA 5CM2Z 3HA3A 5HFJA 3G2QA 1M6YA 3QOXA 4HG2A 2PX2A 3EVGA 2YXLA 2WA2A 5EQJB 3C0KA 2I6GA 1NBIA 2O07A 3A7DA 2NXEA 1R18A 3FUWA 1N7JA 1YF3A 2DULA 3CCFA 3SSOA 3GCZA 3UJ9A 2B2CA 3OZSA 4P7FA 5DPMA 5HZMA 3U81A 4PIMA 1L3BA 4F85A 1I4WA 5FWAA 4C03A 1P1BA 2CKDA 2PT6A 3PS9A 4MTLA 2IBTA 1FP1D 5FUBA 3IEIA 4LWPA 4E32A 4EQZA 2CX1A 2ZBQA 3V8VA 1JTEA 3KQPA 1QAOA 5D1HA 4PYLA 4YUVA 1RJDA 1KYWA 2JH9A 3BGVA 3GGDA 3AJDA 3DP7A 3K0BA 3LDUA 4RYLA 3JWGA 3R9XB 3AXTA 4QVGA 4CTKA 2IFTA 4U7PB 1RJEA 5DXJA 5HILA 3P2IA 2I9KA 3K6RA 3HCEA 2FK8A 3DLIA 2XVMA 3G7UA 1EJ0A 2JHCA 3F4KA 4P7GA 4ZTBA 1AF7A 2KW5A 2PY6A 4RV9A 4BP1A 2AVNA 2EFJA 4C05A 3TLJA 1NBHA 1WXXA 2P7HA 1WXWA 3SSMA 4RTMA 2ZLBA 3G2PA 3LBYA 3OU6A 3TFWA 2Q41A 5FWDA 10MHA 5DM2A 5U4XA 2G1PA 5H02A 4CWAA 4X63A 1G38A 5M5BA 3C6KA 1KIAA 3BXOA 3T7TA 2Z6QA 3TM5A 3EPPA 3FUVA 5DM0A 4R8SA 1SG9A 3BWMA 5C0OE 1P1CA 1X1BA 3BZBA 3CVOA 2NNWB 5IKMA 1PRYA 1EAMA 2ESRA 5C1IA 3OE5A 2AOXA 3UBTA 2JG3A 4C06A 3BT7A 4PYNA 3FPHA 1SUIA 4PYOA 3OU2A 2J5TA 1R00A 3P9KA 3MTEA 3TMAA 4EVIA 2Z6AA 5DTQA 2OXTA 4R6WA 2K4MA 3BKXA 2OBFA 3FYCA 4OA5A 3CC8A 4XUEA 4JXJA 3FPJA 5E2BA 4R6XA 4GOMD 5K05A 3GXOA 1NKVA 4OA8A 5EPEA 3M4XA 3TQSA 3G2MA 4RTNA 4GOLD 2GLUA 4GC9A 2OPBA 5FQOA 5B1SA 1L1EA 2PWYA 4LECA 3KQOA 1K8WA 4CKBA 4YV0A 4X60A 1SVUA 3I5UA 3LPMA 4KVZA 4R05A 5EEGA 4ER7A 2OYRA 2P3LA 3LL7A 2AN4A 5F2NA 5E9QA 3MHTA 5DSTA 3C6MA 3E23A 4FSDA 5E9JA 5DWQA 1X1CA 3MB5A 4CKEA 1X1DA 3GRRA 3E05A 3HCFA 3MCZA 3FPGA 1T43A 3EVFA 1R8YA 2YXDA 3KR0A 3SM3A 3DR5A 2BM9A 3NVMB 3KHKA 1QYRA 3PFHA 1RI2A 1IM8A 5GOZA 3FPEA 2VDWA 1XTPA 2B25A 3I64A 2I7CA 4M38A 2VDUE 5EIWA 5E1MA 2P3QA 2JH8A 1SQFA 4GOOD 1ZS7A 3TR6A 2YTZA 3R3HA 3Q7EA 1N2XA 5DXAA 1NT2A 5BXYA 4MHTA 3NWEA 3P97A 3G8BA 4H0NA 1IQ8A 4GF5A 3TOSA 4V0QA 3O4FA 2P1DA 3A26A 3L8DA 3P9NA 3GIWA 2JHPA 2AB4A 5CUQA 3MERA 5K0NA 5EIFA 1AQJA 2OZVA 2AOUB 4X41A 4A6DA 1EQAA 2IDJA 4PYQA 4ATNA 5FA8A 1SGVA 2VS1A 3HCDA 3SR4A 5ICEA 3O31A 2B9EA 1JG2A 3P71T 4GUAA 3GRZA 5E2AA 3HNRA 4PINA 4M36A 3OCJA 4Y2HA 1KPIA 4LWOA 3CBGA 3KQVA 5EMKA 5FA5A 2IH2A 2BR4A 5DX8A 1JSXA 2YVLA 3I58A 5DTRA 1RI1A 5HEKA 1BKYA 1XDSA 3SGLA 2YXEA 3UWPA 2ZZKA 3GRUA 4PIPA 2YUIA 4PYMA 3P2KA 3LX6A 5LQRA 3G5LA 3OFJA 2ONYA 3CJTA 3ELYA 1G6Q1 1I9GA 2UYOA 2XYQA 3GRYA 2PXCA 2VP3A 4PGHA 5EEHA 4OX9Y 1HNNA 4RTPA 3IHTA 3T0IA 5BW5A 4IWNA 3HEMA 2C7QA 2PXXA 2EJUA 1VIDA 2FHPA 3AWIA 4FT4A 4IV0A 2CMGA 2PBFA 2PWPA 3EGEA 4KWCA 4P58A 3OPNA 4A6EA 2F8LA 3G89A 4Y30A 3M6WA 3MAGA 4HTFA 1P91A 3WSTA 4NECA 3M6XA 2CL5A 4PYJA 1QANA 4P7JA 1EIZA 1DUSA 3HP7A 4PYKA 2BZGA 4AZSA 2UYHA 4YUWA 1JG3A 2CMHA 2IDKA 5C9ZA 1DL5A 2YR0A 2ZIFA 1RJFA 3B3FA 1Q0SA 1WS6A 4KDRA 7MHTA 4Z2YA 2P3OA 5EC8A 2ZBRA 5DX0A 1X19A 3A4TA 2R3SA 2AVDA 4RVGA 5KS2A 1MHTA 4HGZA 3EVZA 3ORHA 3A25A 4UOEA 2P40A 5GM2A 1RI4A 4PCLA 5EVJA 1G55A 2VDVE 5GWXA 5CCBA 1M0EA 3HCCA 4BY9E 2XVAA 1VP3A 1SQWA 4RWZA 1AQIA 1U2ZA 2O06A 2JJQA 3THSA 3B3JA 1ZE1A 3DXXA 3G5TA 1JSZA 3LECA 3LDFA 3P9CA 3PB3A 5EOVA 2HNKA 4RTSA 1NW6A 4IV8A 1R8XA 3FRIA 2PVCA 2ZIEA 2XYRA 3R24A 4P7KA 4QQKA 3KQSA 3EVCA 1L9KA 4FZVA 4M37A 4PWYA 4E70A 3HTXA 5EKUA 2ZCJA 4EK9A 1RJGA 2C7PA 3EGVA 1ZQ9A 1FJXA 1JG4A 3EVEA 5LQNA 4E2YA 1BC5A 2V7EA 3KQQA 3UZUA 4HRAA 5CIYA 3NDIA 2GAFA 2ZFUA 1NV9A 2ERCA 5K8VA 3DTNA 3PT9A 4KIGA 2FK7A 4G56A 3DUWA 3EMBA 2ZULA 5MHTA 4OQDA 3LBFA 3FUTA 1QAQA 1L3CA 1FBNA 4BLVA 4F86A 5EHGA 1TPYA 4XUCA 4RTQA 4QTTB 5LQUA 5DTMA 4XCXA 3HA5A 5DT2A 3CGGA 3ELDA 2YQZA 3R0QA 4AX8A 1ORHA 3GU3A 3DOUA 3DXYA 1G8AA 5CVEA 5D1NA 4DCGA 3ERCA 4RTJA 2AOTB 1YZHA 3NMUF 5LQKA 1ZE2A 2LD4A 3PX2A 3PVCA 1G60A 4ER5A 1D2CA 4PGGA 1JR4A 1JQDA 1YUBA 4O29A 2H1RA 4V0RA 3HM2A 5BP7A 1XVAA 1R74A 2G72A 2C7RA 1ORIA 5KQSA 3B89A 5CVVA 4RX1A 2BH2A 3D2LA 3KR2A 1YZ3A 3FUUA 2G70A 1UFKA 1Q7HA 2QM3A 3PX3A 5CVUA 1KXZA 2P8JA 3HVHA 4L7VA 4OQEA 5GIPE 5F2KA 3PTAA 5E1OA 2FPOA 1NW3A 3UJAA 1SKMA 4POOA 2O05A 2QY6A 2H00A 1NW5A 4RVHA 2DPMA 9MHTA 4YUZA 5GINE 3DLCA 4WXHA 2IBSA 3HCAA 1X1AA 3QV2A 4QPNA 4QTUB 3GDHA 3FPFA 1F3LA 2AN5A 4PNEA 2HMYB 4YUYA 5KVAA 2PX5A 5FHQA 5JUWA 3KQYA 3S68A 4YMGA 4C08A 5CVJA 3EEYA 2ONZA 1R3EA 2PX8A 1KPGA 5GP1A 5DM4A 4MWZA 3UJBA 4DQ0A 3A27A 4QQNA 3KPVA 4GC5A 5BW4A 2Q07A 2ZBPA 1TW3A 2AS0A 3LCCA 2H11A 3LSTA 3O7WA 2NXNA 4FP9A 5K0GA 2PGXA 4RTRA 3UJ7A 5E9WA 3LKDA 1T5YA 2HWKA 2PX4A 1FPQA 2NYUA 4MQ4A 5E1DA 3R6TA 5K0LA 2ZVJA 2QYOA 1NV8A 4EKGA 3SSNA 2AOUA 1KPHA 3HCBA 5EMLA 3HVJA 1SUSA 3G8AA 2NXCA 4RTLA 3QOWA 2G71A 5EMMA 4AZTA 4Q1TA 3FTDA 4GEKA 2C7OA 4RVDA 1B42A 1JQ3A 3OZTA 3UA4A 1OR8A 3PLAE 3LCUA 4QVKA 2P7IA 1Y8CA 3KQWA 4OBXA 2ADMA 3MCTA 5DX1A 3GRVA 4DCMA 4E30A 3ER9A 3B5IA 2NP6A 3UJCA 3G88A 2EX4A 3V97A 1D2HA 1WG8A 4HTFB 5DRTA 3FTCA 2AOWA 1YB2A 2O0LA 3M70A 2P41A 3BWBA 3ID6C 3MGGA 3NDJA 4CTJA 4RSRA 3IYLW 4FT2A 4DM3A 3NW9A 4DKJA 2BM8A 5E1BA 5K0CA 3KR1A 4FR0A 3T7RA 3C3YA 4E31A 3P8ZA 4YUXA 3B3GA 3EGIA 4QDJA 5LR6A 3OFKA 5KYGA 4C4AA 4ISCA 3CJQA 5K03A 2NP7A 3ANXA 2PSSA 4RTKA 1WZNA 4EMSA 5EKXA 4ER0A 3UFBA 1ZGAA 2OB1A 4X61A 5LQJA 1NE2A 4CKCA 2XYVA 5T67A 2GPYA 1O9HA 1V39A 3KPUA 3LCVB 4U7TB 3DMFA 5E8RA 3HVKA 5CCXA 1YFJA 3KPYA 4C04A 2HR1A 2IH5A 3RODA 2OB2A 3HA7A 2ZIGA 3AY0A 4CXMA 4KDCA 4FSXA 1N7IA 4GQBA 3BUSA 4RTOA 2O57A 3UA3A 5FHRA 3CKKA 1BHJA 4HSGA 8MHTA 4E2ZA 3ER8A 4PYIA 4QPPA 1IT8A 3BGIA 5G02A 5E8JA 2J5VA 1VLMA 3FTFA 2IP2A 3I53A 3VYWA 4DZRA 2HTEA 3TKAA 1J2BA 2HV9A 3E7PA 3TRKA 4KIFA 1Z3CA 2G8NA 3DMHA 5GM1A 3VSEA 5EHIA 5K0EA 1KHHA 2AOTA 3BWYA 3LHDA 5FQNA 4DMGA 3GWZA 2GB4A 1JQEA 4BLUA 3G2OA 2P38A 1DCTA 4HC4A 3BWCA 4DA4A 3LGAA 2IPXA 1ZG3A 1BOOA 3KR9A 3NWBA 4X1OA 3LDGA 5K0FA 5EMJA 4FS8A 2YX1A 2E5WA 3VC2A 3KU1A 4OBWA 1YFLA 3SMQA 1I1NA 5DM1A 3KQMA 3FRHA 1KP9A 2QE6A 3KPJA 2BR3A 1UWVA 1QAMA 1H1DA 1XXLA 4HGYA 5FULA 5K09A 1QZZA 1WY7A 2R6ZA 1P39A 5EGSA 1TW2A 4AZWA 3M6UA 4ER3A 5K0JA 4KW7A 5FTWA 5T64A 5JR3A 2ZZNA 4PONA 4KRGA 2JHAA 1VL5A 4C07A 3RW9A 1RI5A 3EVAA 3OU7A 3T7SA 3JWJA 5DSXA 2B78A 1XCLA 1XDZA 5HIKA 1KYZA 1VE3A 3LKZA 3TM4A 3ELUA 1VBFA 3EVDA 4GOND 1M6EX 4R8RA 2ZTHA 3JWIA 3EVBA 5ERGB 2PLWA 5ICFA 5K0BA 1O9GA 1XDUA 3FYDA 3TKYA 2IGTA 4F84A 3MQ2A 3THRA 3UJ6A 2ZWVA 2A14A 3OZRA 4WVLA 3M6VA 3DH0A 4E2WA 3FTEA 3NVKI 4YV2A 4FGZA 3KKZA 2I62A 5F2OA 3E8SA 3HVIA 1SQGA 1PJZA 3M33A 1ZHFA 1FP2A 2OO3A 3OE4A 2ZWAA 2V74B 3P2EA 4RVFA 5T6BA 3GJYA 4DF3A 1Q0TA 1R6AA 3GNLA 3DMGA 2Y1XA 1VP9A 3MTIA 3NTVA 1O54A 2PJDA 4XUDA 5CVDA 5ICGA 2ZSUA 3PFGA 1L3IA 1IXKA 1R3FA 1MJFA 5HOQA 1IT7A 1KR5A 2ZW9A 1JTFA 4HH4A 2IH4A 2FRXA 3BKWA 2QRVB 2PKWA 5FCDA 2Z6UA 2CWWA 2WA1A 4IKPA 3UAIA 5LQCA 1F38A 2PXAA 3BGDA 3I9FA 3SVZA 1ZKDA 2P35A 2UZ4A 4AUKA 2GA9A 5CD1A 5DRYA 2XBMA 5EZSA 2WK1A 3D79A 3FUXA 3ME5A 4MIKA 3EMDA 1G8SA 2ORED 3AXSA 3VC1A 4BLWA 3KQTA 3UJDA 3CJRA 2FYTA 3TPZA 5K01A 3KPWA 4M7RA 4LG1A 2EJTA 4YV1A 2BR5A 2PT9A 3JWHA 2OY0A 3GO4A 4YMHA 2VZ9A 1EG2A 3FZGA 1AV6A 4E33A 2AZTA 1RI3A 2IIPA 3B7PA 1VPTA 3DXZA 4AZVA 5DLYA 5FADA 5HIMA 1NW8A 2FCAA 3ELWA 3P9IA 3SX0A 5KQRA 5IH3A 5P8WA 2AOVA 3SXJA 4GBED 3NJRA 4BP3A 2UYQA 5EG5A 1HMYA 2EG5A 1ZGJA 2QRVA 3X0DA 3Q87B 1VQ1A 1D2GA 4QDKA 5LSAA 2AR0A 5GIOE 5HIJA 1JG1A 2NXJA 2UYCA 1XJ5A 2OKCA 2Y1WA 3EEOA 4PCAA 1NW7A 2B3TA 3RIEA 3DULA 2GS9A 1IY9A
chains in the Genus database with same CATH superfamily
3SYRA 3O74A 2I4IA 3QFSA 1E0DA 1KEUA 2BEUB 3JZDA 3MJHA 4Y2TA 3ROQA 2V5AA 4QNRA 4JWKA 4BMVA 3ZJYA 3HB1A 3I61A 4G23A 2UDPA 2R6R1 1G8JA 2H5IA 2AG0A 1RD4A 4XQEA 4GVXA 5JTUA 2O7RA 4O6VA 2JGIA 3OZCA 1KKLA 2XUIA 3BH6A 4I2NA 1CR1A 1DC5A 4HWSA 5FBRB 2ZZMA 2XOKA 3HA3A 1UH5A 1KOLA 4Y7DA 2D1FA 3QOXA 1EFVA 3QI2A 4HG2A 5H1YA 2ZRQA 4KFUA 3X43A 2XQIA 2OBMA 1KGDA 2UAGA 4IH9A 4KE6A 4Y67A 3T94A 5K6RA 1QNFA 1W36D 1WOYA 1ZN9A 4CG3A 2X8JA 5BUQA 3V4ZA 4U4AA 1SUCA 3ET4A 3TD6A 2ZIXA 3SSOA 5LLDA 3VHRA 2R1VB 3CH4B 3JTMA 3NIBA 4JR0A 4EG3A 2WZQA 2QUHA 1SRQA 3M1YA 1UDRA 4KJXA 4M60A 1JR2A 1IXSB 1L1RA 1ZO8A 5REQA 4H1UA 3WZLA 4MQ5A 4CKXA 4DADA 2ACWA 2X22A 4NMXB 1IOWA 2CKDA 2RAPA 1DJOA 2GCOB 2P9BA 3G9XA 5DGHA 4BX8A 1P7WA 2W6JA 2WF7A 2YIDA 1TEVA 1WO8A 4UBIA 5SY6A 3V4SA 2OUIA 2JH9A 4RIIA 1M0SA 1HEUA 1PT5A 1V3QE 1KYXA 2MTBA 3ZK8A 5FAKA 1J8VA 5IAJA 3HE3A 1MJHA 1XKLA 2JFXA 1EJ0A 1UEIA 1M5UA 2DKNA 5FI0B 2QA5A 4E6PA 4HWGA 1APBA 2V54A 1BDBA 1WXXA 3CB2A 1TK9A 3AFNA 1HE3A 3JARB 4OPMA 5H02A 5U4XA 4DJTA 3SXUA 2HPVA 2B1IA 1VC1A 4ZCSA 4PNZA 1JSLA 2Q4TA 3CUWA 3G2LA 1G7SA 4MR7B 2BGLA 1VLLA 3RU3A 5IK2D 3BZBA 3ZWKA 1EX9A 2X1HA 4UXIA 1K6JA 4B4WA 3MA0A 1H85A 2ZYGA 4O4HA 1J07A 4S1PA 5AHWA 2A0KA 4U7WA 1SHZA 3RJ5A 4DHWA 4Q39A 2WWXA 2P69A 4UM7A 3RFUA 3RVPA 4F2DA 4LKRA 2XV1A 4D8UA 1AZSC 1KS9A 4KV7A 1Z17A 3QELB 2FR8A 1ESCA 4RKWA 4J0JA 1QPZA 1EZZA 4ILKA 1WAMA 3SG0A 4C3ZA 1JPJA 1GKKA 1YK1A 2O5VA 2Q5QA 2WYIA 4GP6A 4IDDA 2HBRA 3NONA 2G77B 4Y1GA 3KZ1E 3Q5GA 4RESA 4KE9A 3E48A 4MSUA 3UEOA 2AIRA 4LZZA 1XD2A 3AEXA 3TZEA 1PGPA 4XIYA 1KSJA 1Z6PA 1SAYA 4NVRA 4OXRA 5ALJA 3FF1A 4TSKA 4WKBA 1WB5A 1VMKA 4WECA 3ABOB 5KOJB 1I4OA 4B6RA 5KJCA 2O2EA 2VZLA 2J45A 5GJVC 4Y2SA 3TOXA 1PUJA 2OXFA 2PJUA 3CQ9A 2B8TA 2IC5A 4HAVA 2NV2B 1CUJA 1MBZA 3F98A 4GVPA 1T43A 2ZKLA 5G0TA 1NZFA 3I8OA 3S55A 3IPAA 1THNB 1DXOA 3NM5A 5T4EA 2O23A 3SWWA 1B00A 2YC4C 3LWZA 3NS7A 4WDQA 5JNWA 3FJYA 2PO7A 2OV8A 2WICA 3FPEA 3IKMB 4RK1A 1GNPA 4WZ6A 3EWAA 4BNWA 1UT6A 4V0LA 1X15A 3I8SA 4GOOD 3UGQA 1T3GA 2ZU6A 3OLWA 4G67A 1SXPA 3Q7EA 4U2FA 4GDMA 4YO8A 1PZGA 1NUTA 4GF5A 2QJOA 2VHTA 3Q8XB 3Q7PA 1AQJA 2P68A 5I5GA 3R9KA 4DV7B 1NN3A 1RYDA 3OIUA 3O4GA 4ID9A 6ABPA 1GA6A 4O2BA 3DMNA 2P9ZA 1JAYA 2XHEA 3IT1A 1GPKA 4NCBA 2ZI3A 2VHVA 1M34A 4XX1A 3TLGA 4QGHA 1E3MA 3H7AA 1DX4A 2D4HA 4Y18A 3R7SA 1OX4A 3KV1A 1Y9EA 4M36A 1GT6A 4O4LB 5K4GA 1W5FA 2VY9A 1W6RA 4NZOA 3ZGXA 1N0IA 1NUSA 4US0R 3ND6A 1K8YB 2AG5A 5LC1A 1JHQA 1Z2PX 3I58A 3KT0A 1K8ZB 2V7QA 5HKLA 3WHKA 5KQMA 1FFDA 2H4ZA 2HHCA 2HYDA 3EW9A 2NO0A 2NYVA 5B1YA 1LX6A 4LY9A 2YFYA 3RKUA 2QP3A 2GZDA 4JHLA 4EL5A 2XZTA 4F1WA 3PNMA 1H8HD 3EN0A 3UOGA 1MAAA 1N2BA 4TKMA 2VP0A 1ABFA 3HY4A 1R4ZA 3KEFA 3PTLA 5TMDA 4A6XA 3DTVA 4K28A 1ORTA 3C74A 3LPNA 4Q7KA 5EERA 4YRZA 6PFKA 3F5FA 1TLTA 4PYKA 2BZGA 4JLWA 1ZUNB 4QGSA 4WY8A 4LF9B 4R1MA 3NRCA 2B1RA 2HA2A 1BAPA 3KB1A 2VXBA 1JJVA 5DX0A 1G18A 3MJSA 1XWIA 4TV9F 2QF7A 1KIFA 2Z8YM 4IGAA 4AKIA 4F21A 3I9V1 3HCCA 3A4YA 1GR1A 4ZC8A 2PUAA 2R7LA 2O06A 2OCIA 2ZYRA 4IG4A 4LDRA 2A5YB 1T36B 5HYVA 2IXGA 1S96A 3OIYA 3EVCA 1FX1A 1E9DA 2I99A 4EZIA 3NU1A 1QU3A 5EKUA 1CBUA 1NY5A 1QFMA 2IYAA 2PZ8A 2C7PA 2YXNA 3RTAA 5LZ7A 4QEKA 4LDPA 1JKFA 2GN1A 3R77A 4FJ0A 3PG5A 4BEBA 1U6JA 1U8CB 3ON5A 4D9JA 1A9PA 3AU8A 3I28A 4OXKA 5AKZA 1M2HA 4IGEA 2QGZA 3IPYA 4JX8A 5D3MA 1GUDA 1AM4D 3G0CA 2ZWOA 2XNHA 3TZKA 4OH7A 5LN1A 1T2UA 4CLHA 1LVGA 3NEYA 1HDGO 3CO0S 1A8QA 2WJHA 2BI8A 3CMMA 2BSXA 2CLDX 3F5MA 3FCEA 4KXQA 5DT2A 4DQUA 3UMGA 3JQ8B 1JHXA 4DLXA 1GADO 3HCRA 1XXHB 1GA1A 3JU4A 1TAGA 3A6DA 2EHDA 4DCGA 4O33A 4EI7A 4UHEA 4N3BA 2B82A 5LQKA 3B6IA 1PZMA 3FZQA 1DV2A 4KSYA 5CXXA 3B13B 4CG0A 4DWWA 4HIZA 1RRPA 3JQAB 3N2LA 1S7CA 1WEKA 3TSCA 3OM9A 2IZOA 3I72A 2I2BA 5DNYB 5JCJA 1ZM3A 3OZWA 4HNUA 2FZKA 3UHJA 2PSDA 3AO0B 2H8KA 3FOWA 4KN5A 3OLZA 3TVDA 1JHDA 4EDFA 2I91A 3V8NA 4N48A 3HBMA 1SELA 2Y27A 1CQXA 1EUDA 1T0JB 3HRHA 3IUQA 2Q0HA 3W34A 1G9SA 1QLHA 2XCLA 1RYHA 3BCUA 2GRJA 3F97A 4JI3B 4KLCA 1FE8A 1R15A 2FX3A 3JQGA 3GDHA 4IKEA 4KQJA 4LSGA 2FKNA 1DE0A 4RWEA 4EIWA 2R7NA 3A1EA 4ZOLB 5JUWA 1B8VA 4AQ7A 3OIRA 3DS8A 4FOSA 2PZJA 4MK4A 1YKFA 2RARA 4WKNA 4X8HA 3WY9A 1AS0A 2E5LB 3NUZA 4G5FA 3ZJ5A 2ONZA 3GJTA 2VT7A 3HN7A 3DBIA 1T4CB 5GP1A 4X71A 3VR5H 5JSYA 3QX3A 2BMWA 2OWEA 1U6IA 4PEVA 4N6NA 3W04A 4BV9A 2G5TA 1IB0A 2VYCA 3B51X 4UREA 3VGPA 3KEOA 5JWOA 1T2FA 2BGRA 5K6AC 4XW2A 1IC6A 4KGZA 3WX0A 1IN1A 2GXQA 3L5KA 3ETGA 1EHYA 5JXJA 5JE8A 1H8ED 1U9ZA 3KO8A 4Q9JA 4ZVMA 1NV8A 3WK7A 2CFOA 1TQ2A 4PW0A 3WQQA 3H2SA 1P1FA 4JJ8A 1U7TA 2FI1A 1V2GA 2BFFA 2JLBA 2NXCA 3CNHA 1Y3BE 3HYLA 2PT7A 4B0OA 5K45A 1HYEA 2O2GA 3HU1A 4PGAA 4ZYTA 2RGRA 3K0EA 2FWRA 5TPWA 4II3A 2JBAB 3UGJA 4KMMA 1CLEA 3SDZA 3T41A 5JAHA 1FDOA 1NQTA 5DNVA 2GN2A 2OZLA 3WLTA 1RXUA 1YMQA 1J90A 5KSZA 1JMKC 1PGNA 2XUHA 3EZ6A 4FX2A 1OLSA 3S5JA 3T95A 4DSUA 4YAUA 1V4VA 4YAWA 4MPDA 1Y3HA 2KYRA 5JZVA 1TJ3A 3ZXSA 4EGCB 1S8OA 5AW7A 1GSAA 2B3DA 4ZKEA 3QI7A 3IUMA 3ER6A 5KTOA 5TQ2B 2I2DA 4L8YA 4N40A 2ZO9B 1E8MA 2E9SA 4NFYA 4FR0A 2FN9A 4QUKA 1DXQA 4TSFD 3SF8B 4N03A 2QAGB 3P8ZA 1NQWA 4BFSA 4UJ5A 3IT3A 3K96A 3H8VA 3W6PA 2GX6A 4QDJA 3C8DA 5CDYA 3WIUA 2DHRA 4LC0A 2JCXA 3O6VA 4RSGA 1QIHA 4IX9A 3LG2A 3DFZA 3Q7RA 5D01A 3MSCA 4YS6A 4NMWA 3GGCA 1L4GA 4YN3A 2YCLA 3LBIA 2VPWA 5LQJA 1B0UA 4BTEA 2ZDQA 1O03A 3I37X 5FNZA 2J6BA 2GPYA 2QUJA 3DA8A 4OSEA 4XVCA 1HNXB 2VK8A 3GRPA 3GPBA 4MI6A 1R0ZA 4L4XA 1U8AA 4FGUA 4KDCA 3OC0A 4FONA 3EWSA 4DYVA 3GELA 1NPYA 5K4HA 3WAJA 2CVFA 3DBLA 2W6ID 4JLKA 3UKDA 1SH7A 1H05A 3OOJA 2ADFA 1IQ0A 3ZYZA 3WKBA 2OOSA 2G5CA 2ZBFA 4FDVA 1D7AA 3DAFA 4HJRA 1NSFA 3MJDA 4WBSA 1Z6QA 4WZBA 4DZRA 1J1UA 1T8PA 4EW6A 1TCAA 2DY0A 2BOVA 5FQNA 5EUMA 2P9CA 4YCJA 3D3WA 4DGSA 4NYIQ 2FWJA 4YRLA 3GAMA 1FFCA 3BEOA 4DC1A 3DYIA 3PEUA 1HURA 2Q7XA 3HY3A 1DAKA 1PTJC 1QH8A 3CBQA 2PANA 4ZKDA 1V35A 4BOYA 4GPZA 4UHBA 1T1RA 5DM1A 2FOXA 1O95A 4G26A 1M2FA 2N75A 1QAMA 1S8FA 2A1TR 2RAFA 2A35A 4C0JA 4CIAA 3R8CA 2QGFA 3DQZA 3VMMA 4FXPA 1QF9A 1QM5A 3T3MB 5KTTA 1GFSA 1ZOIA 1H22A 2B78A 4TKLA 4TRMA 2RFKA 4AKHA 3SLGA 3VNUA 2R25B 4FCVA 3H04A 4DVGA 3HCWA 3VNSA 2Z8XA 5D3KA 2Y8EA 3VTZA 3T3IA 5KYYB 4AKSA 4OVKA 4YRGA 4MNTA 5IZ4A 2FDCA 2QW0X 4DJ5X 1JG6A 2CNOA 2Y9PB 3DJFA 5FWNA 4F46A 1DZIA 3DLHA 2G0NA 2RGEA 3LOUA 3MTDA 4HDNA 1WKCA 3TTYA 4J6EA 2PE5A 4PRYA 2PRKA 3O0DA 4BNMA 1N5MA 1Z39A 4PQEA 4KAAA 2I9PA 1Q0TA 5KX5A 2GK3A 3HI4A 4W5WA 3ABSB 4ZGGA 4H9GA 1K6MA 4X45A 5CB0A 2FN3A 3CNEA 2ZUFA 4IXMA 5ALMA 2XWQA 4W5NA 2X1LA 2OHXA 1UWCA 3EW7A 2VJOA 1Z6AA 3PQ6A 5H4HA 2YNMA 4RHXA 3TLYA 1IT7A 1A9TA 5HOQA 1VKRA 1QRSA 2H8GA 1AKQA 4MVJD 4RFVA 3UB4A 4F97A 3DPUA 3QENA 3HKEB 5A7FA 3EWNA 1S1MA 4CLOA 2J3DA 1NFQA 2ZP1A 3ETNA 5LP6B 5K4AA 5FXMA 3SBEA 2FE1A 2NO5A 3ME5A 3PPYA 4WDRA 4ZT2A 4V2IA 3VC1A 4ZMRA 3SX2A 3P96A 3K32A 3A1WA 3PUZA 1JFRA 3FG9A 3NV9A 4DXAA 1L5MA 2XODA 1ZA1A 3VUEA 3OQIB 3GFRA 2DC1A 2FWBA 2GVDC 1VPTA 3B7PA 3T4XA 2HMSA 5KSYA 3V1NA 2WHPB 1UAGA 2QRLA 3W3AH 1J0XO 4N8DA 3SQOA 4WNAA 2GYYA 5BT9A 4CMCA 2RH5A 1H1LB 5A0FA 1I32A 5TGZA 1SBYA 4F1JA 4CETA 1OZHA 3DB2A 3T54A 4ALKA 4KUGA 4HL6A 4BP3A 4HH1A 3KXPA 5FPTA 1LF0A 5E6RB 2IL1A 3GEIA 4RL6A 1E5DA 5HFAA 1LRLA 3CTPA 3R20A 3T1TA 1NXOA 2NXJA 4HB0A 4B6PA 2RHWA 3V8EA 3GLRA 3EPKA 1LA2A 3RS4A 1UBUS 3CONA 2VNSA 2X3YA 4C5AA 4RDHA 1U2GC 2RB4A 4D0SA 5L3QA 3GEHA 4X1YA 4EKIA 2GZRA 2XXBA 1U7XA 3GVCA 1K4MA 3TQQA 2DU8A 3LHKA 4JBHA 3M6IA 4HT3B 3U49A 2VDLB 3FW1A 4B17A 1EX6A 3AONB 3FR8A 2BFDA 3D5EA 3AF5A 1JFTA 2QZSA 4IHJB 4G0PA 2P2DA 4LJ9A 1N1DA 2FQYA 3CMCO 1RWWA 1IULA 3I2HA 1N5OX 2ZBEA 4PFJA 3VU9A 5LOVA 3I2FA 5E6UA 3PWSA 1ISPA 2PH3A 1BVUA 1ULSA 4D4LA 5AVRA 1RQLA 1DRKA 1NBIA 1NUUA 2O07A 3M9XA 4Y1RB 1GWNA 5EFOA 4JLUA 1X8JA 4PO3X 2EL9A 2W00A 5AVZA 1YF3A 2PU7A 2NU7A 3LBHA 5LU8A 3DFMA 4BFCA 1KU6A 1QO7A 4ZYLA 4HDRB 3JASB 4IOKA 3VZBA 3SEQA 1BCSB 1YHNA 4ZRNA 5TT0A 3K2EA 3ZWAA 3OD5A 1JU4A 3TTWA 2RHCA 3PUWA 5HKAA 5M3BA 4PLFA 2RHBA 2X76A 4BFLA 4KR9A 2IEGA 3F3MA 4EA6A 3RIXA 5C34B 3R1IA 3TLBA 3JQAA 4I66A 1D6MA 4CVNA 3FB1A 4BE4A 4FFWA 4RH1A 3UATA 4DA9A 1PR3A 2EIXA 2VRCD 3AEYA 1VSTA 2I4RA 4OK5A 4LF6B 2VDOB 4EMTA 4XSGA 5EHZA 1T1GA 4X20A 2FQ1A 1P19A 1PNQA 1R0SA 1W4AA 2P7HA 5DOVA 1NN1A 1KGSA 4ND6A 4XE5A 3THWB 2H1FA 2DWQA 4D8XA 1IUKA 5I4KA 5M5BA 1Y4ZA 4E12A 1KAQA 5EESA 1XZMA 5G0VA 3ZXXA 3FE2A 4R8SA 1N6EA 1BGVA 3U3OA 1YRQA 5T41A 3IMFA 5F78A 4E5VA 4YMIA 3SS7X 1FYDA 1XQXA 3PLNA 3KLNA 4O1MA 4DCCA 2ESRA 2XJ9A 3Q10A 1RXCA 2W4IA 2I22A 2MMGA 2ZS8A 4ZVTA 4CMJA 2FSSA 1O77A 3NTOA 1TB4A 2QTGA 1L5KA 4AZ3B 3NHUA 4M8SA 4G5YA 2QZPA 2ZYWX 5I7WA 1T9ZA 2B8NA 1NWHA 2PRZA 3IELA 4TTSA 3FMOB 1DUVG 1SKAA 2Y92A 3D8UA 3AR6A 1H3EA 3C5VA 4GOMD 3D3NA 4MW2A 3C5CA 5EPEA 5IDVA 3O4VA 3QYPA 4PY2A 5AVXA 2E3JA 4JX9A 3UUFA 4A0HA 1TQDA 4MUBA 4KSBA 2IDMA 3WYFA 4ZXFA 4RLSA 1X8XA 1V8PA 2CVOA 5E38A 3KQOA 1TA4A 4EUKA 2DWCA 3MWJA 1QWSA 1ZCAA 2AFIB 1K8WA 1MJ5A 1P8AA 2IHUA 2M2IA 3OOSA 3X2EA 1BMFA 1K75A 3D0RA 2BEWB 3Q1KA 4D8VA 4BZPA 3BCRA 1DWUA 1WMAA 2WDPA 3AL2A 3UGKA 1QRTA 1LBQA 3OZFA 4FNMA 3IHKA 3KB6A 1XTTA 3ASYA 2C9BA 2Q1XA 1H5QA 2PZLA 1ISGA 3FNEA 2G63A 2W6MA 2W8BB 3GRRA 3HJCA 3MCZA 2XGMA 4C4RA 1R8YA 1FDIA 2DB3A 3A1VA 2JIZA 3VHXA 3PFHA 4DILA 1RAEA 2D8AA 4IXTA 1ZJ5A 1WQ4A 1I24A 2I7CA 2EEZA 3HP1A 3M6AA 2QM7A 4M38A 1Y80A 4RXTA 4WOJA 4OI1A 3M2TA 4YRKA 2RD2A 3A2LA 4OHPA 2LCQA 4BO6A 1HPLA 3FBTA 4Q15A 1Q1BA 3PDIA 2D59A 3BIFA 3E5MA 1R9NA 2G9ZA 1CJMA 4A3SA 4E1VA 3ND9A 1BFKA 1UMKA 4B9EA 1WULS 2NAFA 4RHFA 2VSNA 4PBRA 3FOEC 4AIIA 4F72A 1F9EA 3N6VA 5FBKA 5TVKA 2HJVA 1K3TA 2A8YA 2BMJA 2ID4A 1II8B 2WTEA 4IFIA 3NUQA 4MYCA 5IYZB 4AI6A 4CG1A 2DXNA 4ATNA 4ISBA 4WFKA 5IJZA 4AY6A 3O31A 2B9EA 4RZXA 2P6PA 2TYSB 5TB5A 4GBJA 2KQUA 4QOHA 4TYMA 5ECGC 1PFUA 1GNVA 1CERA 2YV4A 4ZT7A 1QIJA 4J6FA 2IX9A 1GKLA 1XSEA 1W4ZA 1A4XA 2I2AA 2OBLA 1UINA 2VDWB 2X0KA 4UC0A 4B47A 4DXDA 4L5BA 5JPCA 4PRZA 2IHKA 2JI4A 2BMDA 3UENA 4BHTA 5A9RA 4K2AA 4HV4A 3KT8A 4GX1A 2I6SA 2JJ2A 3CISA 3G5LA 1EBBA 1CS0B 2XMQA 1UPTA 2J5XA 4EVSA 3CNQS 4UEKA 2Q62A 1P2GA 2H31A 1JYSA 3RC7A 4CGZA 2FF5A 3A32A 1GV1A 3KE8A 4N7MA 4DIFA 1BXZA 1EE2A 2JLQA 3UG7A 4E07A 2YHIB 1VMAA 1EFHA 2P77A 4QOJA 1XHEA 2QD5A 3TG8A 1KEKA 5F5XA 4MR9B 1TLFA 1U0FA 2PWPA 3P5BA 4FC6A 2OQIA 3DD1A 5AM5A 1XALA 1JNXX 1GQYA 2A6PA 5EZBA 2JVKA 1W6UA 4MICA 4TYWA 3GFBA 1WVIA 4E4TA 3VSDA 2NSDA 4WOPA 4QU9A 5HRUA 3JAWA 4IIFA 2ZRIA 4EX6A 3EIUA 7MHTA 1TA9A 1YE3A 1KVRA 3OETA 1ZIYA 4Z2YA 5ECWA 3ZLTA 3EEBA 2W2MA 2KMLA 1C1XA 1ZI6A 3I5AA 5J59A 2B4QA 4KVGA 3CKYA 1Z5OA 3COZA 5IKEA 2DM6A 1O95D 4PAOA 2J08A 4YAKA 1ZBQA 3H1FA 3ZHCA 1NAIA 3EISA 1OZGA 1KHTA 1U2ZA 2Z2IA 4FU0A 4XB2A 5EOVA 3P52A 4QO8A 3PDUA 3CR3C 4YQEA 3REQB 2X0FA 1T5HX 4RTSA 3IERA 4ZPJA 1OI3A 2H07A 2J31A 2X42A 3SYKA 3NLLA 2DKFA 1SIUA 4P33A 4MGKR 5I48A 1DTWA 4HRVA 1NVUQ 2A88A 3ZZNA 3EF1A 2MSCB 4E2YA 1XNRB 2V0GA 3L01A 2QTCA 4MUAA 1E2UA 4R1OA 2ZFUA 1IBSA 1NV9A 5CFZA 4DQXA 4OQZA 3GOHA 3MQFA 3VFDA 3DUWA 5JARA 1KYYA 1JIUA 9LDBA 2L42A 1KP2A 2Z3VA 1CDDA 4J91A 3GVKA 1CUHA 3K9QO 3SBOA 4TMKA 1L3CA 2YNMD 3U19A 3A3OA 2QD4A 3C97A 4XCXA 3QPDA 4ZI2A 3LLVA 3NYRA 1UBCA 3OIWA 1ZRSA 4LYYA 5FL7A 4PS0A 4AX8A 3W90A 1HNZB 1DS6A 2FSFA 2P9JA 1MEEA 2ATXA 2A0WA 2ECOA 3SICE 1T91A 2QUBA 2ZDGA 4PGGA 5ELMA 2YWGA 1V37A 1KSGA 2OTCA 2H1RA 1Z33A 5JWHA 2CFSA 4K6KA 4ROTA 3GHYA 1JDZA 3TNJA 3W8RA 3F2IA 3PJFA 2QP9X 4LHVA 1PR2A 2GN4A 1NNEA 3KYBA 4I1UA 2YWFA 2O8EB 5IX8A 2J0EA 2IUTA 3FKSD 1TA0A 2V4UA 4B7ZA 1CX9B 2IZ5A 2XEXA 1SKMA 4POOA 2Q1SA 4OU4A 2IYLD 4YBRA 3GVIA 3U7HB 1VLJA 3DLCA 4AUMA 4FHGA 3FNBA 2WFAA 3FHCB 4FKBA 4Z0TA 4BJHB 3GUZA 3FPFA 5KVAA 2COKA 2B2XA 2QWXA 3L1VA 4RS3A 4E3ZA 4ENVA 2VA9A 3GT3A 1RVDA 4U7DA 1NJ8A 2VHWA 3PC3A 5CVJA 1A1VA 3DWIA 3PNYA 4ZALA 1KEEB 3H3JA 1RBQA 3AGQA 4K9MA 1YMVA 3IUYA 5IBRA 3VVCA 4I4IA 4BWFB 2YS6A 2A5DA 1H2BA 2X7JA 4HD8A 3ZH9B 2H11A 4GPEA 1PJLA 4X91A 2VSYA 4TLAA 4NZPA 1EESA 3N2ZB 2JLCA 3IBGA 1ISHA 1L4KA 2LIVA 5K0LA 4LGCA 4MQ4A 1PLLA 4HP8A 3DWGA 1RM5A 3MJTA 4DIUA 1LW7A 3VM6A 1IAQA 4A2CA 1UBRS 3DEKA 5CH8A 2Y66A 1QKIA 2Q0QA 1XKQA 1NUAA 1XTBA 5CA0A 3KFXA 1TKCA 1KAHA 1U2QA 4J03A 1B76A 1JQ3A 1KAGA 2DQYA 2RI0A 2YZMA 4R5MA 3UA4A 4DNOA 5C80A 2P7IA 1ZVVA 3FMPB 2A33A 2LRHA 4JCOA 3W77A 3MLBA 1GZDA 4L0DA 4MW1A 1SCKA 1O0BA 1SKUA 3HMKA 3ZV0C 5G0WA 2XZOA 4YJGB 4DLTA 4LHWA 1Q3HA 1W59A 2AOWA 4KIUA 3M70A 1N2IA 2DHEA 3LPCA 4N8SA 4UTXA 1NDUA 2ZB4A 1OTYA 3KL2A 4LI0A 4RSRA 3PI7A 1H2EA 3QMPA 3HABA 3K9GA 4H18A 3OCWA 1A5SB 3M6LA 4KMRA 3RS9A 1RT9A 2J5RA 4IF6A 2EWMA 4NOKA 3HB0A 1LDYA 4AM8A 4CM4A 2ASVA 4EPXA 1Q14A 3BSYA 4R16A 1W0KD 1QTRA 3HBFA 4MVYA 5TVGA 4UTNA 1DARA 3HQ4O 3QUSA 4B32A 2W6CX 2W6NA 4R5HA 3IEKA 2F1RA 2GZAA 4MQ6A 1OCEA 2ALJA 3MOIA 4RTKA 5DP2A 1ISIA 1Y5IA 4KQXA 1W0CA 3ITKA 4UDXX 4X61A 1ACLA 4US2R 2FMKA 2P9TA 1PG2A 3JYOA 3TK1A 3PFWO 4JOCA 1YOVA 1WUKS 2ZPTX 4FWBA 2CB0A 1G41A 3D6UA 2DUUA 3G7NA 4JJEA 4KVAA 1EA5A 4XWTA 1H2WA 1UKVY 1RAGA 4P8RA 1OFUX 4WFJA 5F73A 3PA6A 4JDPA 4FEEA 3IDFA 1DBSA 4O3FA 4AP9A 5LQSA 1G8MA 1WHSA 1UPCA 4TVKA 1G5HA 5HBGA 3PRJA 4KH1A 3CLVA 2IXTA 3E2PA 3I53A 1WCWA 2RAVA 3K2BA 5HMMA 4JB3A 3CTMA 3HO8A 1Z0AA 3RJ9A 2W4MA 1I6WA 4LRXA 4XPIB 2DBZA 3D0QA 4DMGA 2OO5A 2DFLA 3DLTA 4LPSA 4GHNA 3G2OA 1PCXA 4G1UC 1LTKA 1TQ6A 4HCJA 3VPAA 3DDZX 2GEUA 4MQEA 1QB7A 2QRGA 4FNOA 1X6VA 2I4NA 4TWIA 4OUDB 2QLTA 5EMJA 4K1XA 1QH1B 4PLTA 1PSDA 2CJPA 3B9RA 3SMQA 4GDFA 5EVCA 2IV2X 2XX3A 3PT5A 2O8FB 1IN7A 4UU1A 2B21A 4QG7A 4Z0NA 3CRNA 3DE2X 2UV8A 4KL8S 1KQ3A 1HDEA 3QP9A 4UCQA 4C1NA 3V42A 3IVMA 4PC1A 3A9RA 5JR3A 3HYTA 4NESA 2NTNA 4PONA 1MA0A 2W2TA 1RXIA 2H92A 4S0XA 1NVMB 2B6NA 5BRNA 3LO8A 1SG6A 1TKAA 1VXRA 3G2HA 4N54A 3FYUA 3NPAA 4M83A 4R1NA 4EGAA 1Y7PA 4CF3A 3BWEA 3OCCA 2HA4A 4HNSA 1RWNA 3W8FA 1VBFA 3QWHA 1MV5A 1AQNA 4URXR 2Q49A 3LWVA 5DU2A 1FP4B 1O9GA 2CWDA 4XQ0A 4U00A 1LTQA 2C2GA 3T9DA 3UT5A 2QZ4A 1DKLA 2NU7B 1PX0A 2O2HA 2ZWVA 1H8HA 2IS6A 2QRNA 3OQJA 4E2WA 4ESVA 1U7UA 1GZUA 1FVXA 2FDXA 2W42A 1MKYA 4HQOA 4K86A 1EXNA 1NL3A 5CX1A 3U56A 4WKPA 1YL5A 1V1MA 3G2NA 3RSSA 4AUEA 5KQPA 3RUEA 3WGIA 1R6AA 1EGAA 2Y1XA 5CVDA 3LX5A 3BQ9A 3VI4B 2GN8A 3VR4D 2X4DA 3EIHA 4DNQA 3JWPA 1P0MA 3E9EA 2MYTA 4HKTA 1V9LA 3SDSA 1FRVA 1NVKA 5JS2A 4BMSA 3TR5A 3SYMA 5C5DA 3GNQA 3EG5A 3RG2A 1RRMA 2HF2A 4EAAA 1C30B 5B3JA 1VE9A 3GA5A 5KSPA 3GH3A 3MWYW 4U5XA 1IAVA 3FSRA 1P6UA 5HFNA 1J7JA 1YZKA 2WWTA 3HGQA 4BGEA 4FYWA 1XZNA 1SCJA 4BMZA 4BLWA 1OFIA 3R74A 4UUBA 3UJDA 2CDBA 4BRZA 2ZSFA 3O2QB 4JI5B 3QIVA 3J7AC 1BXKA 1QKJA 1R1DA 4K9QA 4DDMA 5C7OO 1J0EA 1NRXA 1CUBA 3N0TA 4AW9A 4F6RA 1U98A 4R41A 2FCAA 1Z6YA 3CWZA 3SX0A 5FJIA 4ZT4A 3O3OB 2G9NA 2EBFX 2J3QA 3JD2A 3VPSA 4CMIB 2GK7A 4PSUA 1WQ1R 2MSKA 1B2LA 1IB6A 1VQ1A 1FEZA 5IN4A 1X70A 2HCJB 2O9JA 3MAJA 4IQGA 2O7QA 1NBMA 3IUJA 1YHZA 4UVGA 1P61B 3K9NA 5L3ZA 3ZZ1A 4UFPA 1GTL1 1YBFA 3K53A 4RGBA 3EXIA 5F21A 4XSHA 2OKCA 4V02A 4O4LF 5EUBA 1DHTA 3JALA 2J9FA 5AYVA 3SZLA 3A6EA 4BMXA 2O6LA 3HUTA 3UAXA 1BE6A 1TYBE 4OQQA 2AJLI 5UKDA 4P6VF 2SKCA 2PCLA 3WWOA 2WHEA 5K8IA 3ICEA 1XAJA 2EDCA 2V97A 3H2BA 2IK8A 4NJEB 1UJMA 5DBOA 5CCEA 2P4HX 1C7IA 3RO7A 2N47A 1NYQA 4Z86A 2VRNA 2GZ2A 4KK4A 5EWMA 4PC2A 1S04A 1EWKA 1H9BA 1Z5WA 5KZMB 3C3PA 3MLEA 2PV0A 1QCYA 3L6DA 2H06A 1R0RE 3MWLA 2H2DA 2OV4A 3B53X 3M9WA 5G1NA 2P2CA 1X92A 4D42A 3WNQA 4YAOA 3RFXA 1QGZA 2CXXA 2DGDA 2YXLA 3PEEA 4LRSB 1Z28A 3ZV3A 4XEUA 1PV4A 2N1BA 4ESHA 1HSOA 2ZWMA 2ZUEA 2I1LA 3A7DA 1G5TA 4M9QA 4O8CA 1M2EA 2IYQA 1U9JA 3PEFA 2PWAA 1BKSB 4XOIA 2HSZA 4EABA 1TL7C 1VFPA 2C58A 4WX2B 1CUZA 1MB4A 2R1TA 3IT0A 4ESEA 3M6MD 1K7FB 4P7FA 1TDJA 3EXEA 4JXXA 4NNJA 5AOCA 3WV5A 1NG9A 3I30X 2C5BA 2RGYA 1ORWA 4M3NA 4J3NA 1TM1E 2VP5A 3GJQA 3IEIA 3H4MA 2FE4A 3I9V6 3HEAA 2HPZA 3V8VA 1UKAA 3EZLA 1Q0HA 3KQPA 3LWNA 1YS4A 3MRTA 4X7BA 2QTLA 5JADA 4F3TA 2DFVA 1X87A 2EARA 2G76A 1QHYA 1VA5A 3DP7A 1PR4A 1X8KA 4FVTA 4QGFA 3G85A 2Z8ZA 3DORA 3KKPA 1SBHA 4Q7EA 5P21A 1OQAA 5EHQA 3N2IA 3E9YA 2W6ZA 1EK2A 4WBNB 2ZS9A 4UZSA 3PL1A 5HK9A 4LZPA 2P4EA 4BNYA 5LXTF 1RTTA 2PY6A 2Z2ZA 1HE8B 3BD9A 3O8OA 3PA8A 1IDN1 3JY6A 3W5JA 1YR7A 3D0KA 2QKYA 4N6GA 2F6RA 1KDOA 2JAQA 4LDZA 5DYWA 4LSZA 2OHJA 4HPJB 4KACA 3FHTA 3D6NB 5D51S 5KDOA 3OKFA 1JHPA 3FUVA 1VKJA 2H1SA 1HA3A 4G37A 2QD2A 4KBYA 3EC7A 2ZUWA 2B30A 3G49A 4JXZA 4QOIA 1B1AA 3TRHA 3OLQA 3T4EA 2GBGA 4ZIRB 2AOXA 1QCZA 2OORA 3JSAA 4A2WA 3OU2A 4FILA 5C1DA 4DNPA 5LIRA 4G5SA 3GJSA 4FDMA 4EVIA 1DT5A 1NMQA 2DHQA 3NJ4A 1BS9A 4UVHA 2VWQA 2VI5A 5J5AA 4G4SO 5FF9A 1OVMA 1WXGA 2HSJA 5GJBA 3GOQA 4RZHA 4DWVA 4NPCA 4EYKA 3D1JA 4JMLA 3GXOA 3PXEA 4OA8A 4ZAWA 3HYNA 4EELA 2GT1A 2QTMA 2ZB8A 2W2OA 1PVVA 3CW8X 5D84A 3UAYA 5IC4A 2BN4A 2G9RA 3N2KB 2ZBGA 5J2TA 3K09A 3NOVA 3P0HA 5JECA 3NHMA 4JUAA 1W88B 3PDWA 3EZ7A 2NV6A 3GFGA 1G21B 3TOVA 1OE0A 2GUWA 4ER7A 4RF3A 3AVQA 4A0FA 1P7YA 2WUEA 2GHQA 3AR8A 4OHCA 5E9JA 3REGA 3ZPXA 1L7XA 3H42B 3RTEA 2JGEA 7REQA 5AKEA 3WB0A 3MGBA 1Z5GA 4J0GA 5EZYF 3EVFA 4JVOA 1SKBA 4OX9B 2YZGA 4PFSA 1D4FA 1T25A 1KMHB 2DTDA 4GO1A 2G1KA 1I5RA 4I8IA 5KOHB 2CK3D 5FUXA 2PFKA 2BDUA 5FDFA 3T12A 2R79A 4IS2A 4ZVVA 4PG7A 3VR1A 2P3QA 3P32A 1A97A 1NXVA 1RNLA 1ZRMA 3HKCA 4B4UA 3OG9A 5BXYA 1XCPA 3RVOA 4XTCS 5BPHA 2XTZA 3UHOA 2X0JA 4DT1B 3LPAA 4HZUA 3AR3A 1X7HA 1TUBA 2P1DA 2DY1A 2QE7A 3HWSA 3T7AA 3FCXA 1G9XA 5JFTA 5KU7A 4H27A 4CEIB 4C30A 1GCAA 2XIQA 1TH8B 1M0WA 2R8RA 4ZCLA 4HR7A 5A04A 2P9HA 3P71T 5JDCA 1U0BB 1X94A 3C3BA 3OZEA 1PG0A 1X1TA 3HNRA 3B7GA 1FOEB 3G3EA 4TL6A 2CMFA 4PSAA 3CN7A 3NXKA 4LMAA 3G0DA 2DPHA 2YVLA 3FPCA 4QJBA 3NGLA 2VN8A 1AIPA 2NX2A 3VQTA 2QRJA 3O4HA 4HDMA 2W8BA 4FE4A 1ECJA 2AZMA 2VAWA 5IT4A 3G0HA 4C0WA 1U1CA 1IVYA 4B5LA 4DC0A 1J5EB 4DIMA 1V1RA 1WLSA 3SXPA 2IEAA 1C8VB 3TTSA 1M6VA 2VPXA 3TWOA 1VYHA 3WRYA 3IHTA 4DUGA 4RULA 5BW5A 2J33A 3HY6A 4RVNA 2C7QA 1GZVA 4CKBB 1VGRA 4KWCA 1Z26A 2ZRBA 2Z4TA 1U9CA 1NBMD 3DD5A 5ALFA 2F3RA 3L84A 3VMFA 4C4TA 4CDRA 5F98A 1WNFA 4L72A 4MV7A 4LSWA 3K4QA 4PYJA 1BTOA 1J0DA 1EIZA 4OG2A 4EW2A 3HP7A 4HB3A 4TRJA 3SPXA 3GC6A 3S8EA 1QC5B 2N9UA 4NZMA 1MABB 1A27A 2JZNA 2OQ2A 4S3MA 3TCNA 2OZPA 3VV2A 1Q7GA 4N5MA 4AB1A 1BWPA 3COSA 4IOLA 5C8ZA 3B85A 5CFNA 1SVLA 2QRUA 5AVQA 2IZ1A 1L7VC 2V3WA 3JYHA 4HGZA 3BMQA 4LJSA 3WXBA 4PCLA 4Q6BA 5EVJA 5BSUA 1W9HA 4BRWA 3A2MA 3N58A 4Z51A 1SQWA 1II0A 1EWVA 1CB7A 3RHZA 4XGNA 2PR7A 5DYTA 1XMSA 3W4IA 4EWLA 3CXRA 1X14A 3TLZA 3RUPA 2ZIEA 3QUAA 1GQRA 1R8QA 3O90A 3HTXA 4H77A 5KOIA 1YNOA 2WT8A 1REQB 1Z36A 1STOA 1AUOA 1TVKA 2FUKA 1U0EA 3NHPA 4MVJH 3STTA 1HWYA 1ZQ9A 3U3MA 1MRZA 5L6MB 1D0SA 1OT3A 3PWTA 3WWCA 2HKIA 4OK6A 3UZUA 4PS1A 3N3BC 3H1GA 4E08A 2HUNA 3LLUA 3UAGA 1IVSA 4QRIA 2A94A 3MIZA 4OREX 4TWJA 1YS6A 1EE9A 5AKXA 2D1QA 3X2FA 4FXOA 2REXB 2E85A 3AUSA 4QUEA 4A2QA 3WAGA 1T36A 3AOGA 5EPUA 1C1DA 5TV2A 2FU5C 1M83A 1XGKA 1Z0KA 3NEJA 4E51A 2OBXA 1G8AA 2Q5FA 4GKKB 4COKA 1MO4A 1QH9A 2PGJA 2JGJA 4RIGA 3U37A 4HUTA 1XTQA 2IPLA 4OOEA 4YPFA 3QQ5A 4XGQA 2F3QA 2AJTA 4QUDA 4TL7A 3ZGNA 2XNJA 5ICMA 2G72A 3KXDA 4DPLA 3EOZA 3IIIA 1K08A 2B98A 1W75A 2CD7A 3A6ZA 3GR6A 5F4ZA 2BH2A 5DGTA 5IZCC 2VP6A 4JP3A 4ZEOA 3PX3A 5CVUA 5EUCA 4EQ6B 2E21A 3EUWA 3EPRA 3KUXA 1RWXA 3SJBA 4B45A 4YJFB 4V0MA 2VTBA 2HRBA 3AY3A 3IOBA 3R23A 2DPMA 5FUQA 2YCBA 4IMJB 5HNKA 3IJEB 1N6HA 4G6ZA 4L5CA 2OBBA 1JR6A 3LIPA 3HPQA 2VXOA 4DM4A 1FTGA 1IXRC 4HS4A 4YALA 4EJ6A 4ZDIA 2AN5A 1FMFA 3QEMB 3PFBA 4UAUA 1VB5A 2C84A 2VPYA 1Q20A 5LYJB 2J32A 2BEUA 1DX6A 4N5HX 3RSGA 5BQPA 4B84A 4AG3A 2VQFB 1ZESA 2HCRA 3CB4A 3PPXA 4MYHA 3QX7A 3V7FA 3TB6A 1E64A 3L4KA 4WUTA 2HHHB 1KPGA 1HORA 5LQUA 4TMTA 5EJAA 1BFDA 3EAFA 4BGUA 1WHTA 4MKGA 3WDLA 4ZYUA 3RYHB 1LDBA 5C8DA 3C1AA 1VL8A 4J90A 1QGUB 4WASA 4G85A 2IE0A 3S2ZA 3TSYA 3EDMA 3NAZA 4BVEA 1VL6A 5IC5A 3ZWXA 4BZQA 1IVNA 5BRJA 4F0JA 1L7RA 1FY2A 4JLOA 3DBOB 1E3QA 1XE3A 1N6LA 3HP4A 1BEUB 2AUSA 1T9AA 3H3XA 3NAQA 5AK3A 5JH7F 3QFFA 4YROA 4AL4A 1XF1A 1Z4PX 4JFRA 4RDXA 2NZYA 2PMCA 3VH4A 4GW3A 1KJQA 2XRFA 3B8EA 4QUHA 1PEKE 1YCFA 2O7NA 3FVRA 3N8HA 3I9MA 4S1TA 4EKGA 5KJ6A 2XVZA 1SUSA 1P4AA 4G0ZA 3LI2A 1YRHA 3JPWA 3TQFA 2H6EA 4AZTA 3FTFA 3T5PA 3FTDA 4OLAA 4JBXA 2VPIA 3OBIA 2FMFA 3D7RA 1N2ZA 3QY9A 1KMCA 3FWZA 3RADC 3GGJA 2PN1A 1Y8QA 2O6HA 2V45A 4K1LA 3WGMA 3GRVA 4CYMA 5DNWA 4PN7A 4R1UA 4IJMA 3F6SA 4YIHA 2VA8A 3KZCA 2EL7A 3WLKX 4PX3A 1POXA 3R6GA 1RYFA 2P41A 3VO2A 1ZITA 3EC2A 2CXNA 3BWBA 3DE1X 4M0EA 2M6KA 3WB1A 1JW9B 3RTGA 3TXYA 4FT2A 2PTHA 1EQUA 3JZAA 4DA7A 2QTBA 1GAWA 5FORA 5DN6D 4AS2A 4BQQA 5FP0A 1I7PA 3T7RA 1LFDB 2V6BA 3Q7QA 2P2LA 2IODA 3QOFA 4IDBA 2ZRCA 3OJWA 2CXRA 2RJOA 2P9QA 4DVJA 1NM5A 3KOXA 1TEZA 5KYGA 1V0EA 1GKIA 3ZXIA 2CD9A 3RC1A 4J16A 4BKOA 4EGSA 4KQ2A 4NJEA 2HMUA 3L4JA 3QLVC 2C7GA 5FBVB 4QFDA 1NNI1 4I9HA 3AIMA 1CY7A 1Y7IA 1GPJA 1XTKA 3IV7A 1ARZA 1UBEA 2AUMA 1HE4A 5JVDB 5C51B 1NBWB 2FQQA 3PJDA 1ZD4A 5G0UA 5CEEA 4MJ7A 4BCBA 1L7NA 2GSDA 1LQTA 4NE7A 2X2PA 3V6LA 4WV3A 3DGEC 5LMZA 1H1LA 1YZUA 3CNOA 3CEMA 4JR1A 1J9GA 3HU2A 3R7LA 5JMOA 4E15A 1U5AA 1E1LA 4EY3A 1AG9A 3Q4GA 4MS4A 4NDZA 5GM1A 4DUGD 3VSEA 3PPIA 1JZQA 1SWVA 4DGFA 4XM1A 2BI4A 2XUQA 3RRMA 3AINA 3PENA 1R37A 5KHAA 4CIBA 1PFQA 4B2IA 1OASA 3WL6A 1ZDMA 1FSFA 3L43A 1X7WB 3HDVA 3CF0A 4HB2A 5K0FA 2WLTA 2J0VA 3T52A 1BEZA 1XL1A 3U61B 2IXDA 1UK7A 3EQ2A 2Z56A 4JKIA 4IZHA 3DT8A 4LBYA 2JFBA 1XROA 2GBLC 3P26A 4E46A 4CG2A 1QHIA 2LDBA 4DFDA 2C8KA 2WM2A 3FAKA 2H4FA 3AQ4A 1VZ2A 3QBVA 5IVHA 4L8LA 1ISJA 4JLDA 4PZAA 5K0ZA 4YT2A 5IYZA 1QGED 5EZ5A 4B44A 3I01A 4X5OA 1RQPA 1BKDR 4YT8A 5TIIA 1H9CA 2VUUA 4F9GA 2IITA 2AFHB 1ZBOA 1E7RA 4M0KA 3BMNA 3TKYA 3UYLA 1E9EA 2XNDD 3OQBA 2FUNB 4LYDA 3CEJA 2A9FA 3MQ2A 4EARA 1YOBA 5GTDA 3ABZA 5ER6A 2PRJA 2A14A 3H2HA 2WTBA 1MGPA 2HNAA 5ANRB 3VGJA 4U2CA 1T1IA 2CK3A 2H51A 3B82A 3ET5A 3H7IA 3M33A 4NJMA 5PNTA 3LLMA 2VJLA 2ZBVA 1KZ9A 5T6BA 2FY8A 1F2VA 1VP9A 2PXHA 1EUDB 3O8LA 4XWGA 2D2FA 5K1ZA 4V38A 4B5KA 2W6OA 2ZPAA 3EH7A 1GQSA 1ZD9A 2NTYC 3FYUB 4JWTA 4URFA 1GDHA 5CFMA 1MJFA 3WNZA 5H68A 5BR8B 2QGNA 4ARUA 3V7YA 1HOXA 2FRXA 3CZQA 3ORRA 5AK6A 3RVBA 1DZ3A 3OTQA 4IKPA 1KEPA 2D5CA 5LQCA 1DRJA 3LCJA 3U5TA 3GJRA 4I4NA 1C9NA 2ATIA 5DYGA 3WLIA 3J80A 1IN8A 2R8EA 1GUBA 4ZRMA 3VRHA 5A06A 2AA3A 3VA7A 1LBTA 4KQMA 1H4YA 5CDHA 2DXLA 1FNNA 2AKAB 1UBHS 4MIKA 5EGNA 1HH4A 1V1RB 4IVPA 5K8UA 1QIIA 5JQGB 3KQTA 1ULBA 2ZDHA 3TPZA 1WUIS 2FPWA 5EXSA 1CLUA 1FFHA 4HYYA 3WL8A 4CLRB 4ZZ3A 5JEDA 4CEJB 4E5YA 2PT9A 2EYUA 3LFUA 4RFSA 5J1SB 1YZNA 2QN3A 1Z5NA 4KAXA 4X20B 3S1SA 3TAXA 1G3UA 1IBRA 1T3SA 2C8LA 4Q4HB 2UVDA 4XAQA 3S2UA 2GN0A 1GPBA 1UM9B 5JQWA 1XMOB 1USIA 1PV1A 4PNPA 3SCZA 2GSWA 5BVHA 3D8BA 1W47A 1T2VA 1ZXBA 1Z7WA 1K89A 5KMGA 3UWOA 1ZK2A 1YS9A 1ZC4A 2W0SA 3PPVA 1OKKA 1V8OA 4MMYB 3WWEA 4B4KA 1ZJZA 5JI3E 4F2WA 5B7QA 4ZZ0A 3I5XA 2B3TA 4YRQA 4PPYA 4H1TA 1FK8A 1SHTX 4Y6SA 4C6TA 2IHNA 2J4DA 4FDLA 2DHDA 2BGGA 1T1EA 1LU9A 4WJLA 3EE6A 1E2KA 4J1TC 4K6MA 1QBKC 2GCPA 4WKGA 4JVLA 1TYCA 4TXLA 4EI2A 1QMGA 1TIDB 1BQ4A 2ZUVA 4EF5A 4YRRA 4YMVA 4F5DA 3USCS 4QELA 2FW8A 1AQUA 2JF0A 2KWIA 1ST3A 4QYWA 5JI2E 4R98A 3G2QA 3K0HA 1T3ZA 3QVWA 1XCBA 1YK0A 2GN6A 2QN9A 4MB2A 3F78A 3U4IA 2FAXA 3W78A 4KN6A 1JWLA 1GTVA 3HADA 3VOSA 3ZDQA 1K5PA 1B3RA 3OCYA 5IBPA 4BNGA 2V4ZA 3CCFA 3HV2A 4HO1X 5JO0A 2F1JA 2C3OA 3C1UA 2VHYA 2B2CA 3TE6A 4NWIA 1WSDA 4I1VA 3U81A 1TCVA 4DB2A 1CUVA 2CBXA 3N05A 5ARDA 3PS9A 4FZJA 4IDGA 1SB8A 2YWHA 3I9KA 3IOEA 1BS1A 2P65A 1FW6A 3G1TA 2I55A 4MWCA 1QAOA 5D1HA 1I3NA 2O8BB 4W1SA 4INZA 3SHWA 3K0BA 3WBJA 4JYMA 4I46A 3HLTA 4JEMA 4E21A 5JZBA 4QVGA 3ZZ0A 1SHUX 5DXJA 4M8NE 2YYZA 3A3KA 1RM3A 1LEHA 1L4BA 1ZVQA 3K6RA 2DWPA 3B78A 5HF6A 4YLEA 4HXGA 2BGUA 3F4KA 3Q9NA 3EEIA 3QBEA 5CAEA 1OA1A 3WFZA 1Z0UA 4OHKA 2PKYX 3MTJA 2VAPA 1WXWA 4NS1A 5CR9A 4R8LA 4MKZA 5GPBA 4C7XA 1E3JA 1JKJB 3BJIC 5AK4A 2H65A 4EUSA 2NAPA 1Y3AA 3EAGA 4YACA 3VU1A 5JVDA 2Z6QA 4DSTA 2D6FA 3NT4A 3OZXA 4WZZA 2WT9A 3C5HA 1XEWY 5ELXA 5FH9A 1YDWA 5TGDA 2V9PA 3C3EA 1T2AA 1UOYA 1VPEA 4R69A 2HYIC 1P33A 4TS4A 3ZD9A 1U31A 2EP7A 1BVRA 1NPTO 2R60A 3DDOA 3FNIA 1E0AA 3UF0A 2GJ4A 2K7ZA 2X0IA 3IURA 2QD1A 5BOVA 4L73A 2QVBA 1E1RA 1YB6A 3EZXA 3AEQB 1B74A 1XZPA 4IXNA 1D2AA 1EFLA 2NZJA 1C3VA 2YMQA 3NDRA 1QDUA 3FDIA 4IIXA 4OHXA 2ZAOA 3GJ8A 3CT6A 3WC4A 1LPBB 3CEAA 2R11A 3DSRA 4R68A 4B6GA 3BMQB 2VXCA 2GEDA 3MVEA 4K9NA 5DLPA 2QRZA 3Q9LA 4L9WA 4PC6A 5EIAA 3U4CA 1RHJA 3OIZA 4OAOA 4C43A 3LPMA 2BEVB 4DPMA 2YY7A 1EK5A 4GXTA 4K8RB 3ZTYA 4HDKA 4RPCA 1OIVA 3NASA 2JFZA 1F2DA 1R6TA 2E4VA 3USES 1NF2A 1KRHA 2XNKA 2DH5A 4QUBA 3S70A 4BUCA 4C7VA 3CLUC 3B70A 2FPPB 3RH0A 2ZAYA 2AK3A 1WM1A 4I0WB 2E5FA 1LKZA 3UQYS 1IM8A 1GTMA 1JGTA 1QG6A 4M1EA 4Q3LA 5AIAA 1UEJA 1F2TB 4F60A 2O3TA 3E8MA 3V4PB 5IJ9B 1MNQA 2VDUE 4H0FA 5EUUA 3TTTA 4Q3CA 5E1MA 4D9FA 3HC7A 5IDWA 1BHO1 4ZQBA 2RH9B 5LA6B 3CVVA 1U7WA 4P81A 4DV4B 1ATIA 3O4JA 5IVDA 4DLZA 1JEDA 1GKUB 2IOFA 3JALB 4KAFA 1RBMA 3STUA 1IQ8A 5B4TA 5FOXA 1W0JA 1PJ3A 1W4LA 5I4BA 2PPVA 4GFDA 4GIBA 4ZI7A 2GPSA 5CT8A 2ATEA 2VAVA 4WNIA 1CQIA 1TF2A 4OAPA 3IP7A 2RMKA 3DFKA 4MTCA 1DEAA 4WADA 2XTJA 5IG2A 3QKRA 5CVCA 1JG2A 3GRZA 2BI7A 3DBHA 1KYVA 1IXZA 5G1OA 4BO3A 5D86A 3H13A 3OCJA 1D4AA 3OO0A 1Z6TA 2B7CA 3DF9A 2BF4A 4FW8A 3ZNOA 2ZJ0A 2IH2A 5DX8A 4HLUA 1EX1A 2V6IA 2QG4A 4MI3A 4WACA 4AXXA 4QQFA 1J2YA 1QONA 2Q21A 4HLQB 2B35A 4J0FA 2HO5A 3V1UA 2HF9A 1AD2A 2J8ZA 2W98A 2YV1A 2PKXA 4NJOA 5J2UB 1JMVA 3CG0A 4JZYA 3GDWA 5KC8A 1UJBA 1HBJA 5E7MA 1ESNA 2WILA 2KPOA 3LY7A 3QK7A 4UXJA 1XEAA 2XA1A 3K30A 2Q3FA 1A7UA 4IWNA 4LJKA 4D0RA 4GKVA 4KO2S 4DTIA 1SOWA 1AS2A 5ALTA 2C98A 1ND6A 1T0IA 4LMRA 4EA8A 2R7AA 2PA3A 4PVDA 4Y30A 5IJAA 4IEEA 3NX4A 2OV2A 2ZRMA 3EQ8A 4OJMX 3Q3GE 1VBNA 1C0LA 4YUWA 4LF4B 4IHAA 4QAQA 4NFHA 3PUYA 2PWZA 1MCZA 3CRZA 3RUCA 3TZCA 2YHUA 4GECA 2QN8A 3E4CA 4QARA 1ZIXA 1LK0A 3O2JA 3VDNB 4NS4A 1PDOA 2BJVA 1YASA 3NY7A 3QELA 4RMNA 5EN4A 5CEJA 4MUEA 4QXPA 5FFFA 2AVDA 2WMDA 2YHIA 5JD5A 4N7BA 3RU2A 1J8YF 1M6VB 4DCVA 3D8RA 1HTWA 4R51A 4MAMA 2PL3A 1CIVA 5KTRA 5L8VA 3I3OA 4JIGA 3LXRA 3R9IA 3FN4A 3DZJA 3BH0A 3DXXA 4JL6A 3RBAA 4RF2A 3C4VA 3F74A 4EJ2A 1K5HA 1SC9A 1Z0ZA 4GPBA 4NU5A 2V8OA 1HTBA 4QPZA 2Q3LA 2GMWA 2VVTA 3LCRA 4FDAA 4UNQA 1IY2A 4FNGA 3Q9UA 3W5HA 1OYYA 3OQPA 3SQWA 1MF7A 3S1AB 2P2NA 3P2OA 4MCHA 2C1EA 2QP4A 3AERA 3EVEA 3N53A 4RF5A 4V0KA 3SIWA 2O2DA 3C8ZA 4R71A 2F7SA 3QLTA 3TB4A 3PD1A 1O3YA 4NP6A 4OFBA 3RVKA 2K6GA 2ZK7A 4DRYA 1Q1QA 4G1BA 4DB4A 4LJAA 4YP1A 1FRFS 4NICA 2HL6A 1L4FA 2EZ9A 3HJWA 1A7KA 1J49A 5T5QA 3O26A 2FPSA 5E4JA 2KS6A 1FBNA 3L8CA 1W1WA 1JU3A 2G06A 2LR0A 4CM9A 1F0YA 5LDHA 4KR2A 1EUQA 4ARAA 2AQIA 4QKQA 4JR2A 1TNDA 2GPJA 1GGVA 1Y34E 1P3Y1 4C3VA 4D5GA 1T9CA 1UBTS 2AQKA 3U0BA 4S0ZA 1P3JA 3A9UA 3NXSA 5HJ2A 1X9GA 3CE9A 1OBFO 4E5NA 1DT3A 1NC3A 4HRYA 1JQDA 3CCCA 1P4SA 3KNZA 4KR0A 3WQRA 3ORSA 1H4SA 2EYQA 2C2XA 4MKIA 5CEFA 1XVAA 5A7HA 1TT5B 5KQSA 2EOAA 1PZHA 3KR2A 1YZ3A 2I8AA 3QTBA 4Z5XA 4CKEB 5L4NA 1CR2A 6Q21A 2NGRA 1EDEA 4C7KA 1J0CA 1DQYA 1YVUA 3QVLA 3VR6H 1B23P 2WJPA 1EPUA 3I6BA 1L5NA 4EO9A 4H31A 2DBRA 2II6A 2UXCB 3BRWA 4X6YA 4ZI3A 2VNHA 1NW5A 5F9MA 4O4JA 4TN1A 2YWEA 1WMSA 4WXHA 2Z0MA 1DFGA 3B12A 4M53A 3P4XA 1W4BA 1WX1A 3A04A 4MROA 3B6EA 3EUEA 1J99A 2M1XA 3MWDA 2ZUUA 4OHUA 1IRXA 3RSLA 2GEBA 2I2XB 4K9DA 2PQ0A 3LQQA 4YCCA 1IM2A 3LKLA 4ADSG 4AN0A 1CUXA 3MZ0A 2HIGA 1S4QA 3Q8MA 1BYUA 3NNDA 2NU8A 4N01A 2B69A 3FPSA 1DC3A 1KKUA 3RDPA 4C0XA 3WHIA 4FYIA 5K7SA 1HDRA 3CNLA 4QQNA 5TEWA 1HY3A 5BW4A 2ES4A 2O7VA 4KQ9A 3KQKA 2G67A 3STVA 1AK1A 4CM7A 2QNIA 1CDZA 1C7FA 3DVLA 1YXMA 2JA2A 3G0GA 3JQFA 1I80A 2DFNA 4H4CA 3UJ7A 4RJTA 4W5RA 1ODFA 1SIWA 1HSZA 1NU6A 4GLLA 1BFUA 4XQCA 4WLEA 7YASA 1GGHA 2DFDA 3RS2A 1DAIA 4LZOA 3ZHRA 4IH1A 3PQEA 4KTVE 1MPXA 1W5BA 4N41A 1UK6A 4GR5A 3HZZA 3PU6A 4KX3A 3PEWA 3T5TA 2R2AA 3I5YA 2RGGA 1W44A 3RRNA 2DQ4A 1UJ2A 2HCTA 4GYJA 3HXKA 4FFLA 3U44B 1OR8A 2W7TA 8ADHA 5LVAA 3MS4A 1UIMA 1ORRA 1CUGA 2ONJA 1V9SA 3MCTA 5DX1A 5FWXA 1TYDE 3NBZC 5IFLA 3JCZA 1WUTA 3U5ZB 1IOLA 1AKWA 1XB2A 2AZ4A 3G88A 4OP1A 1YUMA 3MBOA 2A0UA 4ZAXA 2COUA 1IJEA 5DRTA 5JAQA 4BU0A 5IWCA 1KZGB 1NJSA 2HH9A 4AKGA 2O0LA 3JS5A 5FOUA 2V7TA 4WPGA 5DYNA 4L76A 3EB9A 1N2CB 3CX6A 3IVXA 3FWKA 1DQRA 1N8TA 2C31A 3CR7A 3F49S 3LF2A 3OUUA 1Q1NA 1HQYE 3QXJA 4NARA 4GZLA 4MA4A 5E1BA 5EJFA 5K3AA 3RYHA 3L0OA 3VO1A 1GOTA 3ZHUA 3F9RA 1ZX1A 2OR3A 2VJPA 1YA8A 3K05A 1JZSA 4KE7A 3EGIA 3LIIA 3ZCRA 3BRQA 3ULKA 3PHGA 1TCUA 4BLQA 3F8SA 4C6SA 4XOUA 4I3HA 1W0JD 4C4XA 4DMHA 4XDHA 3UWDA 4KQ6A 3L7OA 4QX6A 1ULTA 4XUGB 2ILTA 1WZNA 3DLAA 1GNLA 1E8NA 4LQDA 4L74A 1MOSA 4YAIA 1FXWA 1O0CA 2ZJ2A 1RTKA 2YASA 3PLRA 4AZ0B 3CKMA 2G9VA 5E8RA 3WNCA 1Z2AA 2VUIB 1ZJ6A 3QPUA 4J7AA 4UZFA 1YL6A 2G04A 3FZNA 1H42A 3AY7A 1N7IA 1QVAA 5CFRA 4UVDA 3FNHA 3DM9B 3NP9A 4HSGA 1I01A 4D2IA 2ZEJA 1E0KA 3FCSB 2IX3A 3Q72A 4CLEA 2AI1A 1Z83A 4KB5A 3I9OA 3S29A 1Z7GA 4HUQA 4B74A 4L28A 1HFWA 2ZIZA 4JJAA 4RKQA 2NUTA 1T3LA 2IRWA 1ZBDA 2GB4A 3A3YA 4IILA 5EJ9A 4KGDA 3KSDO 4DLAA 1AC5A 2RBKA 3WYBA 1XNGA 4JQCA 3AILA 3RTDA 5B3JC 3BE4A 4KI7A 4JJZA 4A16A 5EQFA 2QVGA 1G0NA 3B5JA 4FS8A 5F76A 3GJ3A 3OMLA 2B9VA 3KQMA 2G9UA 1K92A 4PG5A 1UBMS 1XUOA 3U9SA 2CEAA 2NPIA 3LYHA 2F1HA 4F9EA 4MV8A 1OYWA 2X86A 5FB3A 3ZTTA 3M5CA 4Z7OB 5HS4A 2B1JA 3GFQA 4XVRA 5LXTB 4IDPA 4Q1BA 4JUCA 2JLWA 4F04A 5EYPA 3DOIA 4F96A 3EPHA 1ZINA 1DC4A 1LLDA 3GPDG 3DDWA 4DJJA 4ESOA 3KWMA 3SBXA 5BNZA 1I2BA 4Z99A 3SBDA 1CD5A 1E9VA 1VC2A 2IGTA 2QEQA 3HS3A 2BPOA 1A8SA 2ORWA 4M7PA 1L5VA 4H0CA 4UUNA 5GJCA 1I0LA 1U9YA 3EG9A 4UU7A 1AUZA 3L4BA 2PYZA 5TF4A 1CZHA 3LF1A 3C3AA 2CV1A 3WLLA 3C7KA 3D2CA 4ABTA 3HVIA 1E6LA 2I80A 1FP2A 2OC9A 1PBNA 1Z07A 1ZRHA 2QMUA 1ZH0A 3ETCA 3EJ6A 3UTDA 1HR0B 4AS1A 5A1TA 5JCOC 1O54A 2HMWA 2A9QA 3VPCA 4KNYA 2WP8J 4N0QA 2FR1A 1SUAA 3PNQA 1KH3A 3CRQA 3BKWA 3PR2B 4NC9A 2EFGA 4H7IA 3E4DA 4MAAA 4A7PA 3C3DA 5EJ5A 4AJ9A 4BJ6A 4FR2A 2ZXEA 1OTXA 3I9FA 3SVZA 5EJ6A 2GCIA 4WTOA 1K68A 4ND8A 1E6EA 2BKVA 3C7CB 1VJ1A 1RP1A 3EIFA 1KYTA 1Y4DE 1WDWB 3GLHE 3K1YA 3RC3A 1OXKB 2BBSA 2NO4A 2C04A 1WKVA 3G5MA 3QLUA 4HLCA 4Y3UA 4ZDWA 3UHAA 2V9ZA 1U81A 3OZGA 5AVYA 5KB3A 3U44A 1EQ2A 4CMBA 3L7KA 3WGHA 5CFPA 2FPMA 4HWKA 4X0EA 4YV1A 5K8JB 1EM6A 1LPSA 3DMTC 3DQPA 3F96A 5LA6F 2EV9A 1KDYA 1F48A 1X7YB 3LAWA 1GXSB 3T9FA 3VHQA 4E94A 4OFXA 1FZQA 2J5QA 5F7ZA 5FADA 3P2YA 1YZVA 3GT7A 3C6ZA 3DC7A 4CLOB 3WYDA 4URUR 1YKGA 4Q1VA 1W5AA 2ECPA 2Q5JA 3UCXA 1M6NA 2JK1A 3PV0A 1VI2A 5TPWB 5HSGA 1XRRA 5JBIA 3RSFA 4UNRA 1Q3KA 3CKLA 4TT3A 4MDYA 5ABPA 4DV5B 1JG1A 1MQSA 1TAQA 4R2IA 2I54A 1F20A 1VSVA 3R5JA 1P0FA 5DASA 1UBOS 1EXMA 3AM5A 3OAAA 3BAFA 5EWLA 3RIEA 4B85A 5HKKD 2GS9A 1NGSA 1OA0A 2OSVA 2IS1A 3O73A 1D5CA 4D74A 2EP5A 1KIMA 3Q7IA 5DHRA 5LOVB 2WUGA 3RHTA 2R47A 1XYYA 5C8YA 3TPCA 4EP1A 4E2XA 2C9OA 5HP4A 1U2RA 4N5DA 2GO1A 4HFRA 3E53A 5AM0A 5CM2Z 1KQNA 4BMYA 1BA3A 2GZ1A 4U3JB 3LP5A 3EVGA 5FT9A 3QMMA 2HIMA 5FNVF 1CZOA 3DAGA 3HR4A 4HAXA 4H6VA 5BSTA 3R0JA 3S40A 4C7MA 1JKXA 2ARKA 3GFTA 1BN7A 3BE8A 4NZYA 5AI4A 2H16A 2GAJA 3K9FC 2APOA 1IDOA 2QRHA 3RHSA 2KBFA 3OT1B 5HZMA 4HAYA 1L5SA 1IU9A 1EK1A 4CL0A 3DFFA 3GN1A 7REQB 4IH4A 5EIBC 3VDQA 1FX0A 1T1JA 2PT6A 2IV7A 2IYVA 1TYAE 1AA6A 1DKQA 4TSRA 3DJAA 2AJBA 2VHUA 4IJKA 2JDIA 5TXGA 3T0GA 4JZKA 4Q82A 2FGKA 5FTNA 1NG1A 3H05A 3OECA 2DLDA 2QMHA 2IFTA 3WVNA 5BXQC 2DWUA 1TAHA 4CL3A 3OO1A 1N9GB 3NHKA 3RHFA 2BL4A 3KJHA 2OZKA 3D02A 1NXPA 3RGGA 3T7DA 4CDMA 1JHVA 3MXTA 3NYQA 3R3WA 5A5DA 2X4LA 2FEWB 1Y42X 3KJGA 3QJ5A 4X24A 3WGUA 3DL7A 2RB5A 4GPD1 5HW0A 1AF4A 2WJZB 4ZVLA 1YA4A 3A9SA 3S4YA 4XD7D 3U31A 3GLGB 4MUXA 2PKQP 2NZWA 1EFKA 3GFVA 1BXGB 3L7DA 1PLKA 5C0OE 4RC9A 2WI8A 3GX1A 1MOZA 4LXGA 2JI8A 1RPTA 1EAMA 3M1AA 5LDDC 2POQX 4YDHB 4YLYA 2DT5A 3ANSA 3H16A 1NTOA 1SUIA 1TTPB 4NXMB 1EVZA 1PYOA 2NW6A 2G08A 2ORIA 3D4PA 4P34A 1K97A 2XMRA 2HDHA 3ZE7A 4YXWD 2WF9A 3FYCA 1CNFA 5AI6A 4GZMA 3E1GA 5EUZA 2IY8A 4I6JA 5A03A 5JXGA 4RJLA 2ZRGA 2BM0A 2HGZA 3G2MA 2JFVA 1Z37A 1R0BA 3OWHA 4RZ2A 2FOIA 3RIGA 4ARBA 2C4NA 2XT0A 2PZAA 4S24A 1QOPB 4QDUA 2BFCB 1S2DA 1RW4A 5C7LO 5KTNA 1QQ5A 1SQ5A 1KEVA 3OAAD 5I7RA 5BSHA 1T5LA 1JEJA 4J0KA 4D4MA 3UPTA 1VJRA 4H7FA 3WJ1A 1EFTA 1DLJA 3C6MA 4BBJA 1OFGA 5AW5A 4EMUA 2GCNA 1OHHA 5E9AA 3E05A 3PYLA 3OOEA 2VBIA 3OD1A 3PEVA 3DZGA 4KPGA 1UZAA 4I1OA 5DW0A 3WLNA 2RHHA 4LOKA 4RVCA 2ACEA 2O5CA 1FNDA 4IHJA 5AKKA 1ODKA 2HLDD 2QMYA 1F4VA 1EG7A 2J9GA 3NAGA 2PS0A 4WWHA 3ZLBA 4BUJA 4EF6A 5F3WB 2XNSA 4XB1A 1LZKA 4F3CA 1G3IA 3TLCA 4OB8A 3ENWA 2JFFA 4RS4A 4D02A 1EZ4A 5E3HA 4B83A 4ENUA 1SBTA 3A70A 2FRVA 3E3NA 1ILWA 4G65A 4KWIA 1HUQA 4Y2UA 4ZA2A 3SIPA 3KVOA 5CA0F 3CX7A 1N2XA 1FUEA 2IOYA 4L9AA 4Q48A 1FCFA 2QMEA 3NWEA 4UBKA 5IF3A 5TE9A 1U3TA 4P4SA 2C9CA 1WHSB 3TOSA 4AY2A 3MERA 2OZVA 2VOJA 3F1KA 2JLAA 4ARZA 1UZNA 1TM5E 1SC4A 3LVFO 4IDQA 3WGYA 3R8FA 4KAJA 3SZ3A 2RK3A 1P81A 3OKPA 4QA9A 3M3PA 3FDXA 4UM9B 5AJTA 1TK3A 5E2AA 4EUEA 1DKMA 2AF4C 3AESB 2EQBA 3AM3A 2JGRA 5JRZA 3IXLA 2XE8A 3IVRA 3W2FA 2W2PA 1LPMA 5IJ9A 1W35A 1A5TA 3LWQA 1DELA 1F2TA 1GPMA 2MR6A 3QOYA 4XQ9A 2QNBA 4G9BA 4ZQHA 5DTRA 3UXYA 4A8JC 5JJCA 3UWPA 3B1KA 4JBNA 3P2KA 3LX6A 4MR8B 4R7GA 1PNTA 2CL6X 3H18A 3KDPA 3RTCA 1FLVA 3S2YA 3EXFA 3WAKA 4CF5A 1YQUA 1V3VA 2VP3A 3E03A 1S8AA 4L4UA 1JDVA 1IEWA 2WF5A 3H19A 3IOCA 2BH9A 5EEHA 3ZG6A