2CX0A

Crystal structure of a pua domain (ape0525) from the aeropyrum pernix k1 (sulfate complex)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
b'HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein APE0525
publication title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (sulfate complex)
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
total genus 50
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2cx0A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 2cx0A01
1ZS7A 1Q7HA 3C0KA 1SGVA 2CX0A 3UAIA 1ZL3A 1ZE1A 1WXWA 2CX1A 2AB4A 2Q07A 1IQ8A 2B78A 1R3EA 1IT7A 3D79A 2AS0A 1K8WA 3LDFA 2J5VA 2P38A 2CWWA 1ZE2A 4Q1TA 1J2BA 1IT8A 1R3FA 3VSEA 2J5TA 1SQWA 1T5YA 1WXXA 4DMGA
chains in the Genus database with same CATH superfamily
1E97A 1NDOB 3VF1A 4XBTA 1W7CA 1AY7A 3PCSA 3V98A 1O7PB 3CME3 1K8A4 3B7CA 4KVHA 1VQL3 2XSHB 5IERA 1KSIA 2W9QA 3V99A 1RRLA 1ZE1A 1UI7A 1X1WA 2UUGC 4FMBA 3CMA3 2F56A 3URPA 1A90A 4GSPA 4IPBA 3LT8A 1JKGA 2RSXA 1M9GA 3MQKA 3ALAA 1G0TA 1OHSA 5IW9A 1Q864 1FZUA 1ZE2A 1RGGA 1EG9B 1AR0A 1IT8A 1ZO2A 2IUKA 1VQQA 3G6E3 3M8CA 1MWRA 1BSBA 4HM4B 2F5WA 1BRGA 1I0VA 2WOHA 5M18A 1A2VA 1N9EA 1V74A 2CFWA 2H0HA 3BNCA 1QMAA 1OACA 2RNTA 1VQK3 1CEWI 1LVNA 1WXWA 2E2TA 5D81A 2GXFA 2IMJA 3KCHA 1LOWA 4XB5A 1IVVA 4J5GA 4O8SA 3NHXA 1M1K4 4U13A 1HYFA 3CCE3 2OOVA 4HZBB 2GU3A 3LDFA 2F4YA 5G1KA 3FG3A 2P38A 4FMCA 3GSPA 5HGRA 1BGSA 3MKIA 5CF1A 3F14A 3UB1A 2CHCA 3G16A 3LH4A 1F8NA 2L1SA 1JB2A 2WGOA 3AGNA 3LTAA 1ULIB 1BNJA 1D6UA 1T2IA 1WMNA 2YX9A 1VQP3 3FG4A 3LXUX 3GZXB 3FLJA 1UCKA 1U5OA 3DGOA 1WMOA 3EBYA 3NXJA 1GOVA 4AEQA 3ZV0C 2Z76A 1WTHA 1RLSA 2LQVA 2W9PA 4K90B 2P09A 2HMNB 4R80A 1IYYA 1OPYA 5A0OB 2KAAA 2QA43 3D5IA 1Z1SA 3SOAA 4GHOA 2Z0TA 3Q2PA 2MF7A 1O7MB 2E2UA 3AMOA 4CJNA 3K5TA 2MC8A 3G8ZA 4MMYB 9RNTA 3HAXA 4XBYA 7GSPA 2HVYA 6RNTA 5FW5A 4BTXA 1JZOA 3CU3A 3M65A 3M6XA 2BMQB 1W00A 1STDA 2ZHXB 3FZWA 3A5EA 4AKZA 1MWUA 1NB3I 3I0YA 3JUNA 1B20A 4HVNA 4LGQA 1XNEA 2OWPA 3EQQB 5AIGA 1I3IA 4HM7B 4N3VA 4N6UA 5ELUA 5BU4A 3X3XA 1MNLA 2EY4A 1LRAA 1RNBA 2SBLA 3DY5A 1EEJA 8CHOA 2OTJ3 4OUQA 1N5HA 2HMKB 5I97A 2AB4A 1QAKA 2CH9A 2HMMB 1GD3A 1RTUA 3KZTA 3I553 3FKAA 4O3VA 3DXOA 1IT7A 1FYSA 1UDII 3LWQA 2CC3A 2CIUA 3L0RA 3SLUA 1VQ63 4J5KA 1JNQA 2AAEA 2L4VA 1JZDA 4KT3B 1BSDA 1W02A 1UGIA 3CD63 5DREA 3U28A 1FUSA 1Q9EA 1X1YA 1CYVA 1VQO3 1C54A 1LOXA 3PZWA 3CPW2 4N6MA 4JF8A 5STDA 5AEUB 3LWOA 3EX9A 3ZG0A 3K0ZA 1IV7A 1JJ22 1B2ZA 4I5QA 4WP5A 1IQYA 1T5YA 3ZG5A 2XFSA 2BU4A 2F99A 3SXXA 3B8LA 1GS3A 1UCLA 1RCKA 2FNQA 2JDIH 2GBXB 2BMOB 3G713 1IV9A 1VQM3 3C0KA 3LWRA 1BSEA 1C7HA 2KCDA 3FF2A 5AI1A 5ELJA 1BRSA 5D83A 5EQLA 1YJN3 3LTCA 2CFKA 3EB8A 2XSOB 2W56B 3CNMA 1TIJA 4WWUC 7STDA 1TTOA 2CWUA 2B78A 1BSAA 1RJOA 3AGOA 5JPPA 1IVWA 3HIGA 1UCIA 2R4IA 5BVBA 3S29A 3AMOB 3LWPA 4G1MB 5AIFA 3LTBA 5M1AA 3HOHA 4ILFA 3F40A 1ROAA 1K28A 4HM1B 3CCS3 3ZFZA 3EN1B 4EW5A 4FCZA 1LOVA 2BO9B 3NV0A 1ZBOA 1BVIA 2W2CA 3TDGA 3LOYA 4BTWA 3SYUA 3NBJA 3OWSA 3WA3A 4EYCA 1VQ73 1B21A 1FGTA 1GYBA 1RGAA 1RGLA 1OF5B 2O3OA 3JUQA 4KFFA 2GEXA 1ZGXA 3F7XA 4L8OA 5GSPA 1OHPA 1FA3A 3N9HA 3O8YA 4XM4A 4XDWA 3PYJA 1NWWA 2BIRA 3DM8A 1AVLA 3D79A 4H61A 2ANEA 1E3RA 1K734 4N6OB 5CK6A 2GU1A 2QGUA 1DE3A 1BAOA 5TGNA 1EQKA 1BNEA 2LYXA 3EE1A 3T8NA 6STDA 3VSEA 2RBIA 1O7NB 5KP3A 1VQ43 1BRHA 2I9WA 3G0KA 1N9JA 3E99A 3KIIA 5EVHA 3S5CA 1RNTA 2F98A 1I2FA 3U97A 3F8HA 4EV2A 1GMPA 5LC6A 4RNYA 3OXAA 5AYSC 1FUWA 3CNXA 3CC23 1UCJA 1IK3A 3B4PA 3CC73 3GRDA 3F8XA 1YVBI 1DYUA 1CH0A 1A2KA 1GMQA 4KZ1A 3CCQ3 1B3SA 1I3FA 1BNFA 2BT3A 5IEOA 3U1WA 1TJDA 5IF6A 1W6GA 3M6WA 1CQSA 1JRQA 2BNGA 4CI2B 2F86B 3MHEA 2STDA 2W6JH 3MWZA 2Y74A 5JPUA 1YHQ3 1S5AA 4L7KA 1YI23 1QALA 1KD14 1SARA 3STDA 2XF3A 1CYUA 4FCMA 3D4AA 3S28A 1KQS2 3OV4A 1PY3A 4DMGA 3NQZA 3NQYA 3M4XA 5DRVA 1RN4A 1ULJB 3H3HA 3V92A 1K9M4 4FMDA 1UUGB 1N8R4 1BRNL 5IG0A 1IDPA 1PU4A 1TFOA 1KC84 3SX1A 2XFTA 3JUOA 1K41A 2CWVA 2RFRA 4R9LA 2HMOB 1VZZA 4KFEA 4ZM8A 1QAFA 2Z6BA 5M19A 1W2ZA 4FR9A 1YJW3 2CFDA 2D42A 1RMSA 1SJWA 5CXOA 3UL5A 3LT9A 5IENA 1JKGB 4BIRA 2W04A 3Q90A 2APOA 4Q1TA 3NM2A 1BUJA 2P0XA 2ZA4A 3NM7A 2ZDJA 4KFDA 1IVXA 3RGRA 3S67A 1DVDA 1I8VA 2P0MA 4FMAA 4K1VA 5LC7A 4WHAA 2GSPA 2PNCA 1TP6A 4Q53A 1NNVA 3T8UA 3X41A 4BTYA 1OCVA 3VSYA 2C4BA 3ECFA 2A15A 1GY7A 3BU4A 3ROBA 3IUWA 4WFOA 3DZLA 1O7GB 1TUHA 2CKFB 5AIIA 1RDSA 1YIT3 4BL2A 1VQ83 4X2HA 2M7OA 3BLZA 5CLKA 4CI1B 7RNTA 1RGFA 1T3BA 4RZMA 3CCV3 4BU4A 3DGMA 3FGYA 4N6NB 1WQLB 1JBSA 4LZIA 1IVUA 1R4CA 1RGHA 2KRTA 2O9UX 1MWTA 1G02A 1UI8A 1W6YA 1X1XA 2KF6A 3KE7A 4ORLA 1I70A 4HBRA 2K3DA 3NBBA 3JUMA 3LJCA 2H0GA 3H51A 3PGBA 3UNLA 5IG3A 3FF0A 1R4YA 3A76A 4EXRA 5IG5A 1S723 3MG1A 3MYTA 2XH9A 4HM6B 4HYZA 3KKGA 1B2MA 2K54A 1EUIC 1FW7A 2CX1A 1BIRA 1M1XB 4FCJA 1AVKA 1HU9A 3AHSA 3K9MC 4R1KA 1R3EA 4TX4A 5D82A 1ROVA 2E2VA 3RDEA 1VQ53 1RN1A 2ML6A 1Q814 1SIIA 2B24B 1NJI4 3HK4A 5EEOA 2ML5A 1RCLA 2C11A 2UGIA 4NPBA 4HM0B 5BIRA 1RKYA 3MSOA 1UGHI 1NB5I 2YFLB 1UUWB 1Q40A 3GAXA 3J7Yd 3ER7A 2WGQA 1TU5A 2DP9A 1LQMB 1AQZA 2IA7A 3HX8A 1FGMA 2KF4A 2CW9A 2C10A 4HM2B 3IJEB 1JN5A 2OQEC 5FGOA 2ZL8A 1GMRA 2W03A 2CG1A 1B2SA 1YGWA 4HZ9B 1VQN3 1JBRA 1BUQA 1LXEA 1RRHA 4DKIA 2CG0A 2QIYA 3DGNA 4R4KA 3Q1CA 1W6CA 1YGEA 3EF8A 4LSOA 2XGNA 1STFI 2CK3H 1RSNA 3LZAA 3D5GA 4OVMA 3KN4A 3WODG 4QWTA 3CCJ3 3WOEB 1RN7A 1J2BA 2GEYA 2B1XB 1OHOA 1TRQA 1IQXA 1X1UA 3WA2X 1I2EA 3WDGB 5HOHA 1LQGC 4EV5A 4RBNA 3WR2A 3HIIA 3IPTA 5RNTA 5KP4A 1GSPA 1UUVB 4HM8B 2F5MA 1FGRA 2Y73A 1A2PA 4WYKA 1SGVA 3LYGA 3UAIA 1WK2A 4HKVB 2Q07A 2KKUA 1YIJ3 2E5OA 2KF3A 1JB5A 3EC9A 3MG3A 3QK9A 4MMXB 1TFKA 1SPUA 4STDA 1MGRA 1D6ZA 1KWIA 2KF5A 1DETA 1E3VA 3RNTA 4OK0A 3FG1A 3CCM3 2XRXB 3D3LA 3MG2A 5AIHA 4GB5A 4CI3B 3HJWA 3BNDA 3DUKA 4L8PA 4RNZA 4EC6A 1OH0A 1FUTA 2AUSA 1Q7Y4 3CC43 3CCR3 1W01A 3NX0A 1AV4A 2WOFA 1GD4A 3BB9A 1Q40B 3GZRA 1IU7A 2INXA 2XEPA 4HOHA 1OGXA 3NV0B 3DGLA 3NUVA 4J8TA 4XBXA 3X3ZA 3I563 3EJVA 3M6UA 3LMLA 3UL6A 1BRKA 2GBWB 1L5GB 2CX0A 1ZL3A 1D6YA 1OUNA 3N8BA 4JRFA 4LMIA 1JN5B 1Q824 1DMQA 5G2GA 1Y4KA 2IY2A 2OCTA 2XR8B 3MPHA 1US1A 3G4S3 4CDLA 1DVCA 1I0XA 3UJMA 3DH2A 3PXMA 3CXC2 2CWWA 3N54B 1YVSA 4EBGA 2CFGA 3FCSB 3IMAB 1YJ93 1BSCA 1BNSA 1UOYA 2P05A 3SOYA 1BANA 1ASKA 2J5TA 1FGQA 1BRJA 2HMLB 4H3UA 3SVAA 1QVF2 1HZ1A 2OOVC 3BNEA 3F9SA 2CFLA 4RNTA 1ZS7A 1B2XA 1EA2A 3CPOA 8RNTA 3K63A 1MGWA 2W56A 4LEHA 1BNRA 2SARA 3VGNA 2BHMA 4WYKB 1QVG2 4N6TA 3NBRA 1ISKA 1BU4A 1TE7A 1O7HB 2FGTA 3DGYA 4PEJA 5G1LA 5AYRB 3JVCA 4XDVA 3X42A 2V1LA 1RGKA 3KFQC 4HAAA 4MMZB 1JB4A 4N6LA 2J5VA 1GY6A 1WNHA 5IG4A 3HJYA 6GSPA 1T2HA 3B4OA 3M6VA 3EHCA 4HM3B 1BNIA 3SEDA 3FSDA 1NO3A 4N6V0 1JBTA 1GOUA 2UX0A 2QEX3 1B2UA 4NHFA 2BMRB 2YFIB 3CCU3 2YFJB 3OWYA 4IIAA 1S04A 3K7CA 3S27A 1YNVX 1OF5A 3PCRA 1FGOA 2RCDA 4K1UA 1Q7HA 2CWTA 3FH1A 2FRXA 3GWRA 3KSPA 3JUPA 4NREA 1LNHA 2AADA 1Q42A 2W0QA 5BXQA 4CCVA 1IQ8A 1A67A 1RGCA 2H0IA 3OWUA 1B27A 4BL3A 4AKYA 4O2HA 3LTDA 5AEWB 5IEPA 2AS0A 1GOYA 3WOFB 1K8WA 1LOYA 1O7WB 1ZX2A 1MOLA 1V58A 3X40A 3CCL3 2RGQA 2IUJA 1RHLA 1VQ93 1GY5A 4HJLB 1V57A 2Z7AA 3D9RA 4HM5B 4O02B 2OQEA 1SQWA 2RFKA 1JV2B 1U8CB 3T0UA 1BOXA 4MJDA 3LWVA 1DMMA 4IT7A 3EN8A 3X3YA 1QJGA 3AHWA 4MEIA 1N5PA 3EBTA 3GZBA 3HI7A 2R41A 3HZPA 3QRDA 3OX9A 1WMPA 4CPKA 2WO0A 2HMJB 3GZYB 1RGEA 2IYJA 3BIRA 2FXTA 2J8XB 4I4KA 3OW22 1W2B2 2HOHA 2OTL3 5KP1A 2K0MA 4TZ4C 2D1WA 4GL6A 1MWSA 3KSED 1N8QA 4K61A 1I2GA 2KXGA 1TRPA 5JBSA 1OGZA 1DMNA 3BNBA 3RGAA 5CF2A 2PZVA 4X2OA 2JQ5A 4J9AA 1BRIA 1PYLA 2XGLA 1HKXA 4LYLB 3Q3FA 1G96A 1EKMA 1R3FA 4R9KA 3WMDA 1W5ZA 3DMCA 3F7SA 1LNIA 1PFPA 3WHOA 2Z77A 1NU3A 1SIHA 1UW1A 1W4NA 1M904 3PS8A 1BNGA 1WXXA
chains in the Genus database with same CATH topology
1ZS7A 1Q7HA 3C0KA 1SGVA 2CX0A 3UAIA 1ZL3A 1ZE1A 1WXWA 2CX1A 2AB4A 2Q07A 1IQ8A 2B78A 1R3EA 1IT7A 3D79A 2AS0A 1K8WA 3LDFA 2J5VA 2P38A 2CWWA 1ZE2A 4Q1TA 1J2BA 1IT8A 1R3FA 3VSEA 2J5TA 1SQWA 1T5YA 1WXXA 4DMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZS7 A;  1Q7H A;  3C0K A;  1SGV A;  2CX0 A;  3UAI A;  1ZL3 A;  1ZE1 A;  1WXW A;  2CX1 A;  2AB4 A;  2Q07 A;  1IQ8 A;  2B78 A;  1R3E A;  1IT7 A;  3D79 A;  2AS0 A;  1K8W A;  3LDF A;  2J5V A;  2P38 A;  2CWW A;  1ZE2 A;  4Q1T A;  1J2B A;  1IT8 A;  1R3F A;  3VSE A;  2J5T A;  1SQW A;  1T5Y A;  1WXX A;  4DMG A; 
#chains in the Genus database with same CATH topology
 1E97 A;  1NDO B;  3VF1 A;  4XBT A;  1W7C A;  1AY7 A;  3PCS A;  3V98 A;  1O7P B;  3CME 3;  1K8A 4;  3B7C A;  4KVH A;  1VQL 3;  2XSH B;  5IER A;  1KSI A;  2W9Q A;  3V99 A;  1RRL A;  1ZE1 A;  1UI7 A;  1X1W A;  2UUG C;  4FMB A;  3CMA 3;  2F56 A;  3URP A;  1A90 A;  4GSP A;  4IPB A;  3LT8 A;  1JKG A;  2RSX A;  1M9G A;  3MQK A;  3ALA A;  1G0T A;  1OHS A;  5IW9 A;  1Q86 4;  1FZU A;  1ZE2 A;  1RGG A;  1EG9 B;  1AR0 A;  1IT8 A;  1ZO2 A;  2IUK A;  1VQQ A;  3G6E 3;  3M8C A;  1MWR A;  1BSB A;  4HM4 B;  2F5W A;  1BRG A;  1I0V A;  2WOH A;  5M18 A;  1A2V A;  1N9E A;  1V74 A;  2CFW A;  2H0H A;  3BNC A;  1QMA A;  1OAC A;  2RNT A;  1VQK 3;  1CEW I;  1LVN A;  1WXW A;  2E2T A;  5D81 A;  2GXF A;  2IMJ A;  3KCH A;  1LOW A;  4XB5 A;  1IVV A;  4J5G A;  4O8S A;  3NHX A;  1M1K 4;  4U13 A;  1HYF A;  3CCE 3;  2OOV A;  4HZB B;  2GU3 A;  3LDF A;  2F4Y A;  5G1K A;  3FG3 A;  2P38 A;  4FMC A;  3GSP A;  5HGR A;  1BGS A;  3MKI A;  5CF1 A;  3F14 A;  3UB1 A;  2CHC A;  3G16 A;  3LH4 A;  1F8N A;  2L1S A;  1JB2 A;  2WGO A;  3AGN A;  3LTA A;  1ULI B;  1BNJ A;  1D6U A;  1T2I A;  1WMN A;  2YX9 A;  1VQP 3;  3FG4 A;  3LXU X;  3GZX B;  3FLJ A;  1UCK A;  1U5O A;  3DGO A;  1WMO A;  3EBY A;  3NXJ A;  1GOV A;  4AEQ A;  3ZV0 C;  2Z76 A;  1WTH A;  1RLS A;  2LQV A;  2W9P A;  4K90 B;  2P09 A;  2HMN B;  4R80 A;  1IYY A;  1OPY A;  5A0O B;  2KAA A;  2QA4 3;  3D5I A;  1Z1S A;  3SOA A;  4GHO A;  2Z0T A;  3Q2P A;  2MF7 A;  1O7M B;  2E2U A;  3AMO A;  4CJN A;  3K5T A;  2MC8 A;  3G8Z A;  4MMY B;  9RNT A;  3HAX A;  4XBY A;  7GSP A;  2HVY A;  6RNT A;  5FW5 A;  4BTX A;  1JZO A;  3CU3 A;  3M65 A;  3M6X A;  2BMQ B;  1W00 A;  1STD A;  2ZHX B;  3FZW A;  3A5E A;  4AKZ A;  1MWU A;  1NB3 I;  3I0Y A;  3JUN A;  1B20 A;  4HVN A;  4LGQ A;  1XNE A;  2OWP A;  3EQQ B;  5AIG A;  1I3I A;  4HM7 B;  4N3V A;  4N6U A;  5ELU A;  5BU4 A;  3X3X A;  1MNL A;  2EY4 A;  1LRA A;  1RNB A;  2SBL A;  3DY5 A;  1EEJ A;  8CHO A;  2OTJ 3;  4OUQ A;  1N5H A;  2HMK B;  5I97 A;  2AB4 A;  1QAK A;  2CH9 A;  2HMM B;  1GD3 A;  1RTU A;  3KZT A;  3I55 3;  3FKA A;  4O3V A;  3DXO A;  1IT7 A;  1FYS A;  1UDI I;  3LWQ A;  2CC3 A;  2CIU A;  3L0R A;  3SLU A;  1VQ6 3;  4J5K A;  1JNQ A;  2AAE A;  2L4V A;  1JZD A;  4KT3 B;  1BSD A;  1W02 A;  1UGI A;  3CD6 3;  5DRE A;  3U28 A;  1FUS A;  1Q9E A;  1X1Y A;  1CYV A;  1VQO 3;  1C54 A;  1LOX A;  3PZW A;  3CPW 2;  4N6M A;  4JF8 A;  5STD A;  5AEU B;  3LWO A;  3EX9 A;  3ZG0 A;  3K0Z A;  1IV7 A;  1JJ2 2;  1B2Z A;  4I5Q A;  4WP5 A;  1IQY A;  1T5Y A;  3ZG5 A;  2XFS A;  2BU4 A;  2F99 A;  3SXX A;  3B8L A;  1GS3 A;  1UCL A;  1RCK A;  2FNQ A;  2JDI H;  2GBX B;  2BMO B;  3G71 3;  1IV9 A;  1VQM 3;  3C0K A;  3LWR A;  1BSE A;  1C7H A;  2KCD A;  3FF2 A;  5AI1 A;  5ELJ A;  1BRS A;  5D83 A;  5EQL A;  1YJN 3;  3LTC A;  2CFK A;  3EB8 A;  2XSO B;  2W56 B;  3CNM A;  1TIJ A;  4WWU C;  7STD A;  1TTO A;  2CWU A;  2B78 A;  1BSA A;  1RJO A;  3AGO A;  5JPP A;  1IVW A;  3HIG A;  1UCI A;  2R4I A;  5BVB A;  3S29 A;  3AMO B;  3LWP A;  4G1M B;  5AIF A;  3LTB A;  5M1A A;  3HOH A;  4ILF A;  3F40 A;  1ROA A;  1K28 A;  4HM1 B;  3CCS 3;  3ZFZ A;  3EN1 B;  4EW5 A;  4FCZ A;  1LOV A;  2BO9 B;  3NV0 A;  1ZBO A;  1BVI A;  2W2C A;  3TDG A;  3LOY A;  4BTW A;  3SYU A;  3NBJ A;  3OWS A;  3WA3 A;  4EYC A;  1VQ7 3;  1B21 A;  1FGT A;  1GYB A;  1RGA A;  1RGL A;  1OF5 B;  2O3O A;  3JUQ A;  4KFF A;  2GEX A;  1ZGX A;  3F7X A;  4L8O A;  5GSP A;  1OHP A;  1FA3 A;  3N9H A;  3O8Y A;  4XM4 A;  4XDW A;  3PYJ A;  1NWW A;  2BIR A;  3DM8 A;  1AVL A;  3D79 A;  4H61 A;  2ANE A;  1E3R A;  1K73 4;  4N6O B;  5CK6 A;  2GU1 A;  2QGU A;  1DE3 A;  1BAO A;  5TGN A;  1EQK A;  1BNE A;  2LYX A;  3EE1 A;  3T8N A;  6STD A;  3VSE A;  2RBI A;  1O7N B;  5KP3 A;  1VQ4 3;  1BRH A;  2I9W A;  3G0K A;  1N9J A;  3E99 A;  3KII A;  5EVH A;  3S5C A;  1RNT A;  2F98 A;  1I2F A;  3U97 A;  3F8H A;  4EV2 A;  1GMP A;  5LC6 A;  4RNY A;  3OXA A;  5AYS C;  1FUW A;  3CNX A;  3CC2 3;  1UCJ A;  1IK3 A;  3B4P A;  3CC7 3;  3GRD A;  3F8X A;  1YVB I;  1DYU A;  1CH0 A;  1A2K A;  1GMQ A;  4KZ1 A;  3CCQ 3;  1B3S A;  1I3F A;  1BNF A;  2BT3 A;  5IEO A;  3U1W A;  1TJD A;  5IF6 A;  1W6G A;  3M6W A;  1CQS A;  1JRQ A;  2BNG A;  4CI2 B;  2F86 B;  3MHE A;  2STD A;  2W6J H;  3MWZ A;  2Y74 A;  5JPU A;  1YHQ 3;  1S5A A;  4L7K A;  1YI2 3;  1QAL A;  1KD1 4;  1SAR A;  3STD A;  2XF3 A;  1CYU A;  4FCM A;  3D4A A;  3S28 A;  1KQS 2;  3OV4 A;  1PY3 A;  4DMG A;  3NQZ A;  3NQY A;  3M4X A;  5DRV A;  1RN4 A;  1ULJ B;  3H3H A;  3V92 A;  1K9M 4;  4FMD A;  1UUG B;  1N8R 4;  1BRN L;  5IG0 A;  1IDP A;  1PU4 A;  1TFO A;  1KC8 4;  3SX1 A;  2XFT A;  3JUO A;  1K41 A;  2CWV A;  2RFR A;  4R9L A;  2HMO B;  1VZZ A;  4KFE A;  4ZM8 A;  1QAF A;  2Z6B A;  5M19 A;  1W2Z A;  4FR9 A;  1YJW 3;  2CFD A;  2D42 A;  1RMS A;  1SJW A;  5CXO A;  3UL5 A;  3LT9 A;  5IEN A;  1JKG B;  4BIR A;  2W04 A;  3Q90 A;  2APO A;  4Q1T A;  3NM2 A;  1BUJ A;  2P0X A;  2ZA4 A;  3NM7 A;  2ZDJ A;  4KFD A;  1IVX A;  3RGR A;  3S67 A;  1DVD A;  1I8V A;  2P0M A;  4FMA A;  4K1V A;  5LC7 A;  4WHA A;  2GSP A;  2PNC A;  1TP6 A;  4Q53 A;  1NNV A;  3T8U A;  3X41 A;  4BTY A;  1OCV A;  3VSY A;  2C4B A;  3ECF A;  2A15 A;  1GY7 A;  3BU4 A;  3ROB A;  3IUW A;  4WFO A;  3DZL A;  1O7G B;  1TUH A;  2CKF B;  5AII A;  1RDS A;  1YIT 3;  4BL2 A;  1VQ8 3;  4X2H A;  2M7O A;  3BLZ A;  5CLK A;  4CI1 B;  7RNT A;  1RGF A;  1T3B A;  4RZM A;  3CCV 3;  4BU4 A;  3DGM A;  3FGY A;  4N6N B;  1WQL B;  1JBS A;  4LZI A;  1IVU A;  1R4C A;  1RGH A;  2KRT A;  2O9U X;  1MWT A;  1G02 A;  1UI8 A;  1W6Y A;  1X1X A;  2KF6 A;  3KE7 A;  4ORL A;  1I70 A;  4HBR A;  2K3D A;  3NBB A;  3JUM A;  3LJC A;  2H0G A;  3H51 A;  3PGB A;  3UNL A;  5IG3 A;  3FF0 A;  1R4Y A;  3A76 A;  4EXR A;  5IG5 A;  1S72 3;  3MG1 A;  3MYT A;  2XH9 A;  4HM6 B;  4HYZ A;  3KKG A;  1B2M A;  2K54 A;  1EUI C;  1FW7 A;  2CX1 A;  1BIR A;  1M1X B;  4FCJ A;  1AVK A;  1HU9 A;  3AHS A;  3K9M C;  4R1K A;  1R3E A;  4TX4 A;  5D82 A;  1ROV A;  2E2V A;  3RDE A;  1VQ5 3;  1RN1 A;  2ML6 A;  1Q81 4;  1SII A;  2B24 B;  1NJI 4;  3HK4 A;  5EEO A;  2ML5 A;  1RCL A;  2C11 A;  2UGI A;  4NPB A;  4HM0 B;  5BIR A;  1RKY A;  3MSO A;  1UGH I;  1NB5 I;  2YFL B;  1UUW B;  1Q40 A;  3GAX A;  3J7Y d;  3ER7 A;  2WGQ A;  1TU5 A;  2DP9 A;  1LQM B;  1AQZ A;  2IA7 A;  3HX8 A;  1FGM A;  2KF4 A;  2CW9 A;  2C10 A;  4HM2 B;  3IJE B;  1JN5 A;  2OQE C;  5FGO A;  2ZL8 A;  1GMR A;  2W03 A;  2CG1 A;  1B2S A;  1YGW A;  4HZ9 B;  1VQN 3;  1JBR A;  1BUQ A;  1LXE A;  1RRH A;  4DKI A;  2CG0 A;  2QIY A;  3DGN A;  4R4K A;  3Q1C A;  1W6C A;  1YGE A;  3EF8 A;  4LSO A;  2XGN A;  1STF I;  2CK3 H;  1RSN A;  3LZA A;  3D5G A;  4OVM A;  3KN4 A;  3WOD G;  4QWT A;  3CCJ 3;  3WOE B;  1RN7 A;  1J2B A;  2GEY A;  2B1X B;  1OHO A;  1TRQ A;  1IQX A;  1X1U A;  3WA2 X;  1I2E A;  3WDG B;  5HOH A;  1LQG C;  4EV5 A;  4RBN A;  3WR2 A;  3HII A;  3IPT A;  5RNT A;  5KP4 A;  1GSP A;  1UUV B;  4HM8 B;  2F5M A;  1FGR A;  2Y73 A;  1A2P A;  4WYK A;  1SGV A;  3LYG A;  3UAI A;  1WK2 A;  4HKV B;  2Q07 A;  2KKU A;  1YIJ 3;  2E5O A;  2KF3 A;  1JB5 A;  3EC9 A;  3MG3 A;  3QK9 A;  4MMX B;  1TFK A;  1SPU A;  4STD A;  1MGR A;  1D6Z A;  1KWI A;  2KF5 A;  1DET A;  1E3V A;  3RNT A;  4OK0 A;  3FG1 A;  3CCM 3;  2XRX B;  3D3L A;  3MG2 A;  5AIH A;  4GB5 A;  4CI3 B;  3HJW A;  3BND A;  3DUK A;  4L8P A;  4RNZ A;  4EC6 A;  1OH0 A;  1FUT A;  2AUS A;  1Q7Y 4;  3CC4 3;  3CCR 3;  1W01 A;  3NX0 A;  1AV4 A;  2WOF A;  1GD4 A;  3BB9 A;  1Q40 B;  3GZR A;  1IU7 A;  2INX A;  2XEP A;  4HOH A;  1OGX A;  3NV0 B;  3DGL A;  3NUV A;  4J8T A;  4XBX A;  3X3Z A;  3I56 3;  3EJV A;  3M6U A;  3LML A;  3UL6 A;  1BRK A;  2GBW B;  1L5G B;  2CX0 A;  1ZL3 A;  1D6Y A;  1OUN A;  3N8B A;  4JRF A;  4LMI A;  1JN5 B;  1Q82 4;  1DMQ A;  5G2G A;  1Y4K A;  2IY2 A;  2OCT A;  2XR8 B;  3MPH A;  1US1 A;  3G4S 3;  4CDL A;  1DVC A;  1I0X A;  3UJM A;  3DH2 A;  3PXM A;  3CXC 2;  2CWW A;  3N54 B;  1YVS A;  4EBG A;  2CFG A;  3FCS B;  3IMA B;  1YJ9 3;  1BSC A;  1BNS A;  1UOY A;  2P05 A;  3SOY A;  1BAN A;  1ASK A;  2J5T A;  1FGQ A;  1BRJ A;  2HML B;  4H3U A;  3SVA A;  1QVF 2;  1HZ1 A;  2OOV C;  3BNE A;  3F9S A;  2CFL A;  4RNT A;  1ZS7 A;  1B2X A;  1EA2 A;  3CPO A;  8RNT A;  3K63 A;  1MGW A;  2W56 A;  4LEH A;  1BNR A;  2SAR A;  3VGN A;  2BHM A;  4WYK B;  1QVG 2;  4N6T A;  3NBR A;  1ISK A;  1BU4 A;  1TE7 A;  1O7H B;  2FGT A;  3DGY A;  4PEJ A;  5G1L A;  5AYR B;  3JVC A;  4XDV A;  3X42 A;  2V1L A;  1RGK A;  3KFQ C;  4HAA A;  4MMZ B;  1JB4 A;  4N6L A;  2J5V A;  1GY6 A;  1WNH A;  5IG4 A;  3HJY A;  6GSP A;  1T2H A;  3B4O A;  3M6V A;  3EHC A;  4HM3 B;  1BNI A;  3SED A;  3FSD A;  1NO3 A;  4N6V 0;  1JBT A;  1GOU A;  2UX0 A;  2QEX 3;  1B2U A;  4NHF A;  2BMR B;  2YFI B;  3CCU 3;  2YFJ B;  3OWY A;  4IIA A;  1S04 A;  3K7C A;  3S27 A;  1YNV X;  1OF5 A;  3PCR A;  1FGO A;  2RCD A;  4K1U A;  1Q7H A;  2CWT A;  3FH1 A;  2FRX A;  3GWR A;  3KSP A;  3JUP A;  4NRE A;  1LNH A;  2AAD A;  1Q42 A;  2W0Q A;  5BXQ A;  4CCV A;  1IQ8 A;  1A67 A;  1RGC A;  2H0I A;  3OWU A;  1B27 A;  4BL3 A;  4AKY A;  4O2H A;  3LTD A;  5AEW B;  5IEP A;  2AS0 A;  1GOY A;  3WOF B;  1K8W A;  1LOY A;  1O7W B;  1ZX2 A;  1MOL A;  1V58 A;  3X40 A;  3CCL 3;  2RGQ A;  2IUJ A;  1RHL A;  1VQ9 3;  1GY5 A;  4HJL B;  1V57 A;  2Z7A A;  3D9R A;  4HM5 B;  4O02 B;  2OQE A;  1SQW A;  2RFK A;  1JV2 B;  1U8C B;  3T0U A;  1BOX A;  4MJD A;  3LWV A;  1DMM A;  4IT7 A;  3EN8 A;  3X3Y A;  1QJG A;  3AHW A;  4MEI A;  1N5P A;  3EBT A;  3GZB A;  3HI7 A;  2R41 A;  3HZP A;  3QRD A;  3OX9 A;  1WMP A;  4CPK A;  2WO0 A;  2HMJ B;  3GZY B;  1RGE A;  2IYJ A;  3BIR A;  2FXT A;  2J8X B;  4I4K A;  3OW2 2;  1W2B 2;  2HOH A;  2OTL 3;  5KP1 A;  2K0M A;  4TZ4 C;  2D1W A;  4GL6 A;  1MWS A;  3KSE D;  1N8Q A;  4K61 A;  1I2G A;  2KXG A;  1TRP A;  5JBS A;  1OGZ A;  1DMN A;  3BNB A;  3RGA A;  5CF2 A;  2PZV A;  4X2O A;  2JQ5 A;  4J9A A;  1BRI A;  1PYL A;  2XGL A;  1HKX A;  4LYL B;  3Q3F A;  1G96 A;  1EKM A;  1R3F A;  4R9K A;  3WMD A;  1W5Z A;  3DMC A;  3F7S A;  1LNI A;  1PFP A;  3WHO A;  2Z77 A;  1NU3 A;  1SIH A;  1UW1 A;  1W4N A;  1M90 4;  3PS8 A;  1BNG A;  1WXX A; 
#chains in the Genus database with same CATH homology
 1ZS7 A;  1Q7H A;  3C0K A;  1SGV A;  2CX0 A;  3UAI A;  1ZL3 A;  1ZE1 A;  1WXW A;  2CX1 A;  2AB4 A;  2Q07 A;  1IQ8 A;  2B78 A;  1R3E A;  1IT7 A;  3D79 A;  2AS0 A;  1K8W A;  3LDF A;  2J5V A;  2P38 A;  2CWW A;  1ZE2 A;  4Q1T A;  1J2B A;  1IT8 A;  1R3F A;  3VSE A;  2J5T A;  1SQW A;  1T5Y A;  1WXX A;  4DMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...