2CX0A

Crystal structure of a pua domain (ape0525) from the aeropyrum pernix k1 (sulfate complex)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (sulfate complex)
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein APE0525
total genus 50
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2cx0A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 2cx0A01
1ZS7A 2AB4A 1IQ8A 3D79A 1IT8A 3UAIA 1WXWA 1ZE1A 1IT7A 1T5YA 2CX1A 2Q07A 1R3FA 3C0KA 1SGVA 1ZL3A 4DMGA 1Q7HA 1J2BA 2CWWA 2J5TA 2B78A 1K8WA 1WXXA 2P38A 1ZE2A 4Q1TA 2J5VA 3LDFA 1SQWA 2CX0A 2AS0A 1R3EA 3VSEA
chains in the Genus database with same CATH superfamily
1BNGA 1BRKA 2W0QA 1GD3A 1RCKA 1GY6A 2JDIH 1KD14 1BSCA 1X1YA 1GOUA 2BMOB 3K0ZA 3MWZA 2P0XA 5IW9A 3UAIA 4HM6B 1E97A 1TRQA 3F7XA 4HBRA 4STDA 4WFOA 2OTJ3 1N8R4 1TFKA 2XSHB 1OCVA 2D1WA 5G1KA 3U97A 1EG9B 4HM2B 2K3DA 1V57A 1J2BA 1MGWA 4NHFA 2OOVA 1W2B2 1N5HA 2QA43 2WGQA 2SBLA 3DMCA 4LGQA 1STDA 3FF2A 3S27A 2F4YA 3SXXA 2AAEA 2XEPA 1LNIA 3CCV3 3H3HA 4CI3B 1WNHA 1WMOA 3D4AA 1O7GB 4K1VA 3K5TA 4XBXA 3GSPA 3WOEB 1Q40B 1GSPA 1OF5B 1OGZA 3F14A 5ELUA 1RJOA 1KQS2 3T0UA 3ZFZA 2K0MA 3EF8A 1EA2A 3CPOA 4RNYA 4XDWA 2W56A 4HKVB 5BXQA 2ZL8A 1BRHA 1DYUA 2ZHXB 1UDII 1RRHA 2LYXA 5CF1A 3EHCA 1C54A 1VQ43 3V98A 2FRXA 1LQGC 2RFRA 1OUNA 1U8CB 1BOXA 1QVF2 2C11A 4KVHA 4NPBA 4KFDA 2W9PA 2Z6BA 4O8SA 2QEX3 2W6JH 1G96A 1RGCA 3AMOB 4O2HA 4H61A 3WOFB 1W02A 3RNTA 3WA3A 1FGQA 4N6V0 3SVAA 1IK3A 3LH4A 1IT7A 3K7CA 3QRDA 1MGRA 1YNVX 2O3OA 2V1LA 1NNVA 1B3SA 1DMNA 3GZRA 3PZWA 1K8A4 2K54A 1NB3I 1VQ73 1O7MB 2CC3A 1W6CA 1W00A 1LXEA 3S67A 2J5TA 5JPPA 2HMMB 2KF3A 1IYYA 1MWSA 3GRDA 4XDVA 1JZDA 3OWSA 3JUOA 5AEWB 5AYSC 4N6OB 1JB2A 3SLUA 1UCLA 3MSOA 1DE3A 3B7CA 1BSEA 2IA7A 2B24B 5D82A 1I3FA 1RGAA 3DGOA 1S723 3VSEA 1SIIA 1EQKA 2D42A 1IDPA 4GL6A 1BRSA 4HM5B 3RDEA 2XH9A 3D3LA 3CCQ3 3MYTA 1IVUA 1OF5A 1X1UA 4XBTA 3N9HA 1JV2B 1HU9A 4MMXB 3CCU3 4K61A 1RGFA 3WA2X 3PYJA 4J5KA 2E2VA 4LMIA 2QIYA 3ROBA 1FA3A 2GU3A 4BIRA 1SGVA 3BNBA 2UX0A 3GWRA 1D6UA 3M4XA 1LRAA 1FGMA 4AKYA 5AIGA 4CPKA 4R9LA 1K734 2B1XB 1ZBOA 1NU3A 4Q1TA 1QAKA 2ML5A 4EBGA 4HJLB 3LWPA 1LOXA 2AS0A 2FGTA 1CQSA 2HMOB 3FCSB 3NX0A 4ORLA 3X40A 1UGHI 1R3EA 2IY2A 5IG4A 2CWUA 1MNLA 3NBBA 1GS3A 1B2MA 5LC7A 5M19A 1YVSA 3EC9A 3LWOA 3B4OA 1GMPA 1O7WB 3URPA 2Q07A 2INXA 1TTOA 4TZ4C 2IYJA 3GZXB 4CCVA 3JUNA 1BRNL 3PCRA 1YIJ3 1NO3A 2XFSA 1Q42A 1Q864 4XM4A 2RCDA 2W9QA 2GBXB 2GXFA 3BNDA 3MHEA 1K8WA 3OXAA 5DRVA 5STDA 1L5GB 1AQZA 3FG1A 1Q824 3VF1A 1UW1A 2CG0A 3KCHA 4WYKA 1IVVA 3CNXA 3DM8A 3LTBA 2KKUA 4EV5A 1YJ93 4N6MA 1SQWA 3G0KA 1SPUA 2CX0A 1V74A 2Z77A 1YI23 1TE7A 1DMQA 3S5CA 2J8XB 4BU4A 3CXC2 5G1LA 2QGUA 3UL5A 4J8TA 5CF2A 3JUMA 1M1K4 2MF7A 4L8PA 3WHOA 3X3XA 3AHWA 2GEYA 3ZG5A 3IJEB 3CCJ3 3KFQC 2APOA 2ML6A 3AMOA 1VQK3 1T5YA 2CFKA 3H51A 3NBRA 3EBTA 1RLSA 4N6UA 4CJNA 1HKXA 3CCS3 3LTDA 4KFEA 1I2FA 1JBRA 5IEPA 1BRIA 2CW9A 3MKIA 4GB5A 4HZBB 3AHSA 1VQ63 1I2EA 3LXUX 3D9RA 3BLZA 3CC73 5AYRB 2CFWA 1VQL3 5IG5A 1XNEA 2E5OA 3UB1A 3EN8A 1ULIB 3SEDA 4RNTA 5G2GA 1GY5A 4BTWA 2UUGC 4FCMA 3NV0A 3K9MC 1RN7A 1LQMB 4OUQA 1TU5A 1UUWB 4J9AA 1E3VA 2F99A 4FMDA 1LOVA 1SJWA 3VGNA 1BUJA 1JKGB 3OWUA 1AY7A 3Q2PA 4FCZA 4JRFA 1WMNA 1ASKA 1JN5A 2ZDJA 4R4KA 4WP5A 3I563 2OWPA 3LOYA 1US1A 4RZMA 1DVCA 1I8VA 2O9UX 3KIIA 3OWYA 3Q1CA 1UGIA 1STFI 2CFLA 3LYGA 1Q7HA 1UCKA 1RGLA 1WQLB 3MQKA 3CCE3 4K90B 2B78A 2HMLB 1K28A 5D81A 4WHAA 3KKGA 1LOYA 1A90A 4GHOA 5AIIA 4R1KA 3LZAA 3EJVA 4R9KA 4HVNA 3JUQA 1YGWA 7STDA 1LNHA 1TIJA 2CWTA 5CLKA 3STDA 1PYLA 1CH0A 4N3VA 1TRPA 1ZS7A 1Q9EA 2RNTA 1UUVB 5IENA 1BSDA 2LQVA 1VQO3 4CI2B 2PZVA 3ALAA 2WO0A 8CHOA 1BGSA 1IT8A 3AGOA 2P0MA 3BIRA 2RSXA 1NDOB 2Y74A 3KSED 2IUJA 1AVLA 4N6NB 3I553 1B2SA 1FGRA 4TX4A 3B8LA 2BU4A 3FZWA 3D5IA 3UNLA 3L0RA 3CCR3 1VQN3 1B2ZA 5IF6A 2CWWA 1BU4A 4FCJA 3SOAA 3FH1A 2BHMA 1RSNA 1T2IA 3HI7A 4I4KA 4LEHA 3LJCA 1RGKA 3CCL3 1JBTA 1BIRA 1N5PA 2YFLB 2HVYA 1W7CA 2Z76A 3NHXA 3ZG0A 1JN5B 1FYSA 4FMCA 1RKYA 1IQXA 1E3RA 4EW5A 1M904 2CKFB 1U5OA 4L7KA 3I0YA 1KWIA 2L4VA 2KF6A 3LWRA 5KP3A 3FSDA 1GY7A 2FXTA 3X42A 3QK9A 3NV0B 1AR0A 3F8XA 4IT7A 2FNQA 1Q814 2GSPA 4QWTA 2Z0TA 2XFTA 2JQ5A 1FUSA 1RGGA 2HMKB 3FG3A 3NBJA 3CC43 3C0KA 3HJWA 4X2OA 1UCIA 1RNTA 2YX9A 2H0GA 3LT8A 3T8UA 4CDLA 6STDA 1D6ZA 3F9SA 1N9EA 1EKMA 2BO9B 1C7HA 1BRGA 1YIT3 1UI7A 3LTCA 1X1XA 3G713 4MJDA 1JJ22 2C4BA 4BTXA 4K1UA 1A2PA 4X2HA 3BNCA 1JB4A 1NWWA 1VQQA 1YVBI 4N6TA 1EEJA 4HM3B 1WK2A 5D83A 1VQ93 4O3VA 3NXJA 5AEUB 3CCM3 2P05A 4FMAA 3LWVA 2KCDA 1BNFA 1G02A 2F98A 3M6VA 1BAOA 3AGNA 1W2ZA 1RCLA 1SARA 2AADA 3HIIA 1WTHA 2UGIA 3PXMA 3G8ZA 4HM7B 3X3ZA 3F8HA 1FZUA 3CME3 1B20A 4XB5A 1OACA 3O8YA 3EX9A 1ZX2A 1BSAA 1BSBA 3DXOA 3MPHA 3HX8A 2W04A 2ANEA 1A2VA 2STDA 3IUWA 5A0OB 2MC8A 5EVHA 3F40A 1FGOA 4BTYA 4G1MB 1ZGXA 1RN1A 4KZ1A 2CHCA 1M9GA 1S5AA 3B4PA 5RNTA 2OQEC 2M7OA 1Q7Y4 3RGAA 2F56A 1FGTA 4GSPA 2IUKA 1JRQA 4LYLB 5AIHA 3VSYA 2YFJB 3S28A 2F5WA 4HM4B 1TJDA 1F8NA 4H3UA 1BNSA 3GAXA 2KF5A 3NUVA 2ZA4A 1R3FA 2WOHA 1OHPA 2KRTA 2RGQA 7RNTA 1B21A 3HIGA 1QMAA 1GMQA 3MG3A 1MWRA 4AKZA 5BIRA 3BB9A 3GZBA 1R4CA 3Q3FA 1V58A 1RRLA 4MMZB 3WMDA 3U28A 1CEWI 1JZOA 1O7PB 1HYFA 1IU7A 4RBNA 1T2HA 3EQQB 1EUIC 1UUGB 5JPUA 1NB5I 1MWTA 1UI8A 3FG4A 4R80A 2AB4A 2Y73A 1IQ8A 2OOVC 3JVCA 1BNEA 4KFFA 1R4YA 3LTAA 4RNZA 1O7NB 1GMRA 3DZLA 3SX1A 4HAAA 1JB5A 1ZE1A 5KP4A 2BMRB 5HGRA 1OH0A 3M8CA 3UJMA 2WOFA 2R4IA 3M6XA 4L8OA 4OK0A 1NJI4 2E2UA 4HOHA 4MEIA 1ROAA 2HMNB 1WMPA 1D6YA 4OVMA 3J7Yd 1O7HB 2XGLA 2F86B 2W03A 3EB8A 1BNRA 1B27A 2KAAA 3KSPA 1OHSA 1YHQ3 3HAXA 1UOYA 2H0IA 2Z7AA 1Z1SA 1W5ZA 2CFGA 4ZM8A 1ISKA 3DGMA 4JF8A 4WWUC 3Q90A 1W6GA 1IV7A 1MOLA 1KC84 1OPYA 3JUPA 1GOVA 2CFDA 1W01A 1I3IA 3X3YA 2A15A 2HMJB 2IMJA 4U13A 3TDGA 2XRXB 3KE7A 2SARA 4I5QA 5JBSA 2CK3H 5EQLA 5KP1A 1A67A 1VZZA 1W4NA 3A76A 5CK6A 1RNBA 1WXWA 1BUQA 3DY5A 2CX1A 1YGEA 3ER7A 2H0HA 1KSIA 2P09A 3E99A 1TP6A 4WYKB 4XBYA 1MWUA 1VQ53 1GD4A 3FF0A 3NQZA 1B2XA 4HZ9B 3MG1A 3CD63 4HM0B 4HYZA 4NREA 3NM7A 6GSPA 1K41A 1OGXA 1IV9A 3V99A 1ROVA 2CIUA 2W56B 3LT9A 1BVIA 1BANA 4IPBA 2BT3A 2L1SA 5IEOA 2J5VA 3LDFA 1N8QA 2R41A 1B2UA 1S04A 1IQYA 1UCJA 4O02B 4PEJA 3WODG 1BNIA 2GEXA 4Q53A 1CYVA 3BU4A 5IERA 3G16A 1I0XA 1QAFA 1Q40A 1YJN3 1CYUA 5BVBA 1ZO2A 3A5EA 1G0TA 4ILFA 1T3BA 2WGOA 3HK4A 3HOHA 1GOYA 2I9WA 2BMQB 4EV2A 3KZTA 3F7SA 3MG2A 1FUTA 3LMLA 3CU3A 1ZL3A 2HOHA 1RGEA 3DH2A 3PGBA 8RNTA 1JBSA 2DP9A 1PFPA 3ZV0C 1RGHA 1RN4A 1X1WA 2GBWB 4IIAA 5IG3A 5M18A 3IPTA 2CG1A 5DREA 1RHLA 1DETA 4LZIA 3FKAA 9RNTA 1RDSA 3DGLA 3V92A 1TFOA 4FR9A 1I70A 3G6E3 5AIFA 5M1AA 2XGNA 2CWVA 3UL6A 2KXGA 4EC6A 1QALA 3WR2A 3N8BA 3BNEA 5CXOA 4BL3A 1IVWA 1SIHA 1A2KA 1JKGA 4EXRA 3CC23 1RTUA 1DVDA 1RMSA 5BU4A 3EE1A 1ULJB 4HM8B 3M6UA 1PU4A 1N9JA 5I97A 5TGNA 1YJW3 1PY3A 3M6WA 2KF4A 2RFKA 4DMGA 3G4S3 3PCSA 3OX9A 4KT3B 3HZPA 2CH9A 5HOHA 1M1XB 1WXXA 2XSOB 3FLJA 3ECFA 4FMBA 2P38A 1I2GA 3RGRA 1HZ1A 3SYUA 3T8NA 3NM2A 1QJGA 3OW22 1LOWA 3D5GA 5FGOA 3CNMA 4N6LA 7GSPA 3X41A 1BNJA 2E2TA 4CI1B 3N54B 3SOYA 1W6YA 1VQM3 2W2CA 2OTL3 4AEQA 2BIRA 1AVKA 3EN1B 3CMA3 3EBYA 3GZYB 1DMMA 4BL2A 1QVG2 3FGYA 1I0VA 4LSOA 3D79A 3HJYA 4DKIA 4EYCA 6RNTA 1LVNA 3K63A 3WDGB 3DUKA 4J5GA 2YFIB 1FUWA 1FW7A 5ELJA 5EEOA 2XR8B 2OQEA 3IMAB 2OCTA 3OV4A 2XF3A 5AI1A 3PS8A 1JNQA 1BRJA 2C10A 2RBIA 3S29A 1GYBA 2EY4A 1K9M4 1OHOA 1Y4KA 1ZE2A 2AUSA 1IVXA 5FW5A 3DGYA 1VQ83 4MMYB 1VQP3 3DGNA 3NQYA 1TUHA 2PNCA 1AV4A 2BNGA 2F5MA 2GU1A 4HM1B 5GSPA 3KN4A 3U1WA 5LC6A 3CPW2 3M65A 3LWQA 5IG0A
chains in the Genus database with same CATH topology
1ZS7A 2AB4A 1IQ8A 3D79A 1IT8A 3UAIA 1WXWA 1ZE1A 1IT7A 1T5YA 2CX1A 2Q07A 1R3FA 3C0KA 1SGVA 1ZL3A 4DMGA 1Q7HA 1J2BA 2CWWA 2J5TA 2B78A 1K8WA 1WXXA 2P38A 1ZE2A 4Q1TA 2J5VA 3LDFA 1SQWA 2CX0A 2AS0A 1R3EA 3VSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZS7 A;  2AB4 A;  1IQ8 A;  3D79 A;  1IT8 A;  3UAI A;  1WXW A;  1ZE1 A;  1IT7 A;  1T5Y A;  2CX1 A;  2Q07 A;  1R3F A;  3C0K A;  1SGV A;  1ZL3 A;  4DMG A;  1Q7H A;  1J2B A;  2CWW A;  2J5T A;  2B78 A;  1K8W A;  1WXX A;  2P38 A;  1ZE2 A;  4Q1T A;  2J5V A;  3LDF A;  1SQW A;  2CX0 A;  2AS0 A;  1R3E A;  3VSE A; 
#chains in the Genus database with same CATH topology
 1BNG A;  1BRK A;  2W0Q A;  1GD3 A;  1RCK A;  1GY6 A;  2JDI H;  1KD1 4;  1BSC A;  1X1Y A;  1GOU A;  2BMO B;  3K0Z A;  3MWZ A;  2P0X A;  5IW9 A;  3UAI A;  4HM6 B;  1E97 A;  1TRQ A;  3F7X A;  4HBR A;  4STD A;  4WFO A;  2OTJ 3;  1N8R 4;  1TFK A;  2XSH B;  1OCV A;  2D1W A;  5G1K A;  3U97 A;  1EG9 B;  4HM2 B;  2K3D A;  1V57 A;  1J2B A;  1MGW A;  4NHF A;  2OOV A;  1W2B 2;  1N5H A;  2QA4 3;  2WGQ A;  2SBL A;  3DMC A;  4LGQ A;  1STD A;  3FF2 A;  3S27 A;  2F4Y A;  3SXX A;  2AAE A;  2XEP A;  1LNI A;  3CCV 3;  3H3H A;  4CI3 B;  1WNH A;  1WMO A;  3D4A A;  1O7G B;  4K1V A;  3K5T A;  4XBX A;  3GSP A;  3WOE B;  1Q40 B;  1GSP A;  1OF5 B;  1OGZ A;  3F14 A;  5ELU A;  1RJO A;  1KQS 2;  3T0U A;  3ZFZ A;  2K0M A;  3EF8 A;  1EA2 A;  3CPO A;  4RNY A;  4XDW A;  2W56 A;  4HKV B;  5BXQ A;  2ZL8 A;  1BRH A;  1DYU A;  2ZHX B;  1UDI I;  1RRH A;  2LYX A;  5CF1 A;  3EHC A;  1C54 A;  1VQ4 3;  3V98 A;  2FRX A;  1LQG C;  2RFR A;  1OUN A;  1U8C B;  1BOX A;  1QVF 2;  2C11 A;  4KVH A;  4NPB A;  4KFD A;  2W9P A;  2Z6B A;  4O8S A;  2QEX 3;  2W6J H;  1G96 A;  1RGC A;  3AMO B;  4O2H A;  4H61 A;  3WOF B;  1W02 A;  3RNT A;  3WA3 A;  1FGQ A;  4N6V 0;  3SVA A;  1IK3 A;  3LH4 A;  1IT7 A;  3K7C A;  3QRD A;  1MGR A;  1YNV X;  2O3O A;  2V1L A;  1NNV A;  1B3S A;  1DMN A;  3GZR A;  3PZW A;  1K8A 4;  2K54 A;  1NB3 I;  1VQ7 3;  1O7M B;  2CC3 A;  1W6C A;  1W00 A;  1LXE A;  3S67 A;  2J5T A;  5JPP A;  2HMM B;  2KF3 A;  1IYY A;  1MWS A;  3GRD A;  4XDV A;  1JZD A;  3OWS A;  3JUO A;  5AEW B;  5AYS C;  4N6O B;  1JB2 A;  3SLU A;  1UCL A;  3MSO A;  1DE3 A;  3B7C A;  1BSE A;  2IA7 A;  2B24 B;  5D82 A;  1I3F A;  1RGA A;  3DGO A;  1S72 3;  3VSE A;  1SII A;  1EQK A;  2D42 A;  1IDP A;  4GL6 A;  1BRS A;  4HM5 B;  3RDE A;  2XH9 A;  3D3L A;  3CCQ 3;  3MYT A;  1IVU A;  1OF5 A;  1X1U A;  4XBT A;  3N9H A;  1JV2 B;  1HU9 A;  4MMX B;  3CCU 3;  4K61 A;  1RGF A;  3WA2 X;  3PYJ A;  4J5K A;  2E2V A;  4LMI A;  2QIY A;  3ROB A;  1FA3 A;  2GU3 A;  4BIR A;  1SGV A;  3BNB A;  2UX0 A;  3GWR A;  1D6U A;  3M4X A;  1LRA A;  1FGM A;  4AKY A;  5AIG A;  4CPK A;  4R9L A;  1K73 4;  2B1X B;  1ZBO A;  1NU3 A;  4Q1T A;  1QAK A;  2ML5 A;  4EBG A;  4HJL B;  3LWP A;  1LOX A;  2AS0 A;  2FGT A;  1CQS A;  2HMO B;  3FCS B;  3NX0 A;  4ORL A;  3X40 A;  1UGH I;  1R3E A;  2IY2 A;  5IG4 A;  2CWU A;  1MNL A;  3NBB A;  1GS3 A;  1B2M A;  5LC7 A;  5M19 A;  1YVS A;  3EC9 A;  3LWO A;  3B4O A;  1GMP A;  1O7W B;  3URP A;  2Q07 A;  2INX A;  1TTO A;  4TZ4 C;  2IYJ A;  3GZX B;  4CCV A;  3JUN A;  1BRN L;  3PCR A;  1YIJ 3;  1NO3 A;  2XFS A;  1Q42 A;  1Q86 4;  4XM4 A;  2RCD A;  2W9Q A;  2GBX B;  2GXF A;  3BND A;  3MHE A;  1K8W A;  3OXA A;  5DRV A;  5STD A;  1L5G B;  1AQZ A;  3FG1 A;  1Q82 4;  3VF1 A;  1UW1 A;  2CG0 A;  3KCH A;  4WYK A;  1IVV A;  3CNX A;  3DM8 A;  3LTB A;  2KKU A;  4EV5 A;  1YJ9 3;  4N6M A;  1SQW A;  3G0K A;  1SPU A;  2CX0 A;  1V74 A;  2Z77 A;  1YI2 3;  1TE7 A;  1DMQ A;  3S5C A;  2J8X B;  4BU4 A;  3CXC 2;  5G1L A;  2QGU A;  3UL5 A;  4J8T A;  5CF2 A;  3JUM A;  1M1K 4;  2MF7 A;  4L8P A;  3WHO A;  3X3X A;  3AHW A;  2GEY A;  3ZG5 A;  3IJE B;  3CCJ 3;  3KFQ C;  2APO A;  2ML6 A;  3AMO A;  1VQK 3;  1T5Y A;  2CFK A;  3H51 A;  3NBR A;  3EBT A;  1RLS A;  4N6U A;  4CJN A;  1HKX A;  3CCS 3;  3LTD A;  4KFE A;  1I2F A;  1JBR A;  5IEP A;  1BRI A;  2CW9 A;  3MKI A;  4GB5 A;  4HZB B;  3AHS A;  1VQ6 3;  1I2E A;  3LXU X;  3D9R A;  3BLZ A;  3CC7 3;  5AYR B;  2CFW A;  1VQL 3;  5IG5 A;  1XNE A;  2E5O A;  3UB1 A;  3EN8 A;  1ULI B;  3SED A;  4RNT A;  5G2G A;  1GY5 A;  4BTW A;  2UUG C;  4FCM A;  3NV0 A;  3K9M C;  1RN7 A;  1LQM B;  4OUQ A;  1TU5 A;  1UUW B;  4J9A A;  1E3V A;  2F99 A;  4FMD A;  1LOV A;  1SJW A;  3VGN A;  1BUJ A;  1JKG B;  3OWU A;  1AY7 A;  3Q2P A;  4FCZ A;  4JRF A;  1WMN A;  1ASK A;  1JN5 A;  2ZDJ A;  4R4K A;  4WP5 A;  3I56 3;  2OWP A;  3LOY A;  1US1 A;  4RZM A;  1DVC A;  1I8V A;  2O9U X;  3KII A;  3OWY A;  3Q1C A;  1UGI A;  1STF I;  2CFL A;  3LYG A;  1Q7H A;  1UCK A;  1RGL A;  1WQL B;  3MQK A;  3CCE 3;  4K90 B;  2B78 A;  2HML B;  1K28 A;  5D81 A;  4WHA A;  3KKG A;  1LOY A;  1A90 A;  4GHO A;  5AII A;  4R1K A;  3LZA A;  3EJV A;  4R9K A;  4HVN A;  3JUQ A;  1YGW A;  7STD A;  1LNH A;  1TIJ A;  2CWT A;  5CLK A;  3STD A;  1PYL A;  1CH0 A;  4N3V A;  1TRP A;  1ZS7 A;  1Q9E A;  2RNT A;  1UUV B;  5IEN A;  1BSD A;  2LQV A;  1VQO 3;  4CI2 B;  2PZV A;  3ALA A;  2WO0 A;  8CHO A;  1BGS A;  1IT8 A;  3AGO A;  2P0M A;  3BIR A;  2RSX A;  1NDO B;  2Y74 A;  3KSE D;  2IUJ A;  1AVL A;  4N6N B;  3I55 3;  1B2S A;  1FGR A;  4TX4 A;  3B8L A;  2BU4 A;  3FZW A;  3D5I A;  3UNL A;  3L0R A;  3CCR 3;  1VQN 3;  1B2Z A;  5IF6 A;  2CWW A;  1BU4 A;  4FCJ A;  3SOA A;  3FH1 A;  2BHM A;  1RSN A;  1T2I A;  3HI7 A;  4I4K A;  4LEH A;  3LJC A;  1RGK A;  3CCL 3;  1JBT A;  1BIR A;  1N5P A;  2YFL B;  2HVY A;  1W7C A;  2Z76 A;  3NHX A;  3ZG0 A;  1JN5 B;  1FYS A;  4FMC A;  1RKY A;  1IQX A;  1E3R A;  4EW5 A;  1M90 4;  2CKF B;  1U5O A;  4L7K A;  3I0Y A;  1KWI A;  2L4V A;  2KF6 A;  3LWR A;  5KP3 A;  3FSD A;  1GY7 A;  2FXT A;  3X42 A;  3QK9 A;  3NV0 B;  1AR0 A;  3F8X A;  4IT7 A;  2FNQ A;  1Q81 4;  2GSP A;  4QWT A;  2Z0T A;  2XFT A;  2JQ5 A;  1FUS A;  1RGG A;  2HMK B;  3FG3 A;  3NBJ A;  3CC4 3;  3C0K A;  3HJW A;  4X2O A;  1UCI A;  1RNT A;  2YX9 A;  2H0G A;  3LT8 A;  3T8U A;  4CDL A;  6STD A;  1D6Z A;  3F9S A;  1N9E A;  1EKM A;  2BO9 B;  1C7H A;  1BRG A;  1YIT 3;  1UI7 A;  3LTC A;  1X1X A;  3G71 3;  4MJD A;  1JJ2 2;  2C4B A;  4BTX A;  4K1U A;  1A2P A;  4X2H A;  3BNC A;  1JB4 A;  1NWW A;  1VQQ A;  1YVB I;  4N6T A;  1EEJ A;  4HM3 B;  1WK2 A;  5D83 A;  1VQ9 3;  4O3V A;  3NXJ A;  5AEU B;  3CCM 3;  2P05 A;  4FMA A;  3LWV A;  2KCD A;  1BNF A;  1G02 A;  2F98 A;  3M6V A;  1BAO A;  3AGN A;  1W2Z A;  1RCL A;  1SAR A;  2AAD A;  3HII A;  1WTH A;  2UGI A;  3PXM A;  3G8Z A;  4HM7 B;  3X3Z A;  3F8H A;  1FZU A;  3CME 3;  1B20 A;  4XB5 A;  1OAC A;  3O8Y A;  3EX9 A;  1ZX2 A;  1BSA A;  1BSB A;  3DXO A;  3MPH A;  3HX8 A;  2W04 A;  2ANE A;  1A2V A;  2STD A;  3IUW A;  5A0O B;  2MC8 A;  5EVH A;  3F40 A;  1FGO A;  4BTY A;  4G1M B;  1ZGX A;  1RN1 A;  4KZ1 A;  2CHC A;  1M9G A;  1S5A A;  3B4P A;  5RNT A;  2OQE C;  2M7O A;  1Q7Y 4;  3RGA A;  2F56 A;  1FGT A;  4GSP A;  2IUK A;  1JRQ A;  4LYL B;  5AIH A;  3VSY A;  2YFJ B;  3S28 A;  2F5W A;  4HM4 B;  1TJD A;  1F8N A;  4H3U A;  1BNS A;  3GAX A;  2KF5 A;  3NUV A;  2ZA4 A;  1R3F A;  2WOH A;  1OHP A;  2KRT A;  2RGQ A;  7RNT A;  1B21 A;  3HIG A;  1QMA A;  1GMQ A;  3MG3 A;  1MWR A;  4AKZ A;  5BIR A;  3BB9 A;  3GZB A;  1R4C A;  3Q3F A;  1V58 A;  1RRL A;  4MMZ B;  3WMD A;  3U28 A;  1CEW I;  1JZO A;  1O7P B;  1HYF A;  1IU7 A;  4RBN A;  1T2H A;  3EQQ B;  1EUI C;  1UUG B;  5JPU A;  1NB5 I;  1MWT A;  1UI8 A;  3FG4 A;  4R80 A;  2AB4 A;  2Y73 A;  1IQ8 A;  2OOV C;  3JVC A;  1BNE A;  4KFF A;  1R4Y A;  3LTA A;  4RNZ A;  1O7N B;  1GMR A;  3DZL A;  3SX1 A;  4HAA A;  1JB5 A;  1ZE1 A;  5KP4 A;  2BMR B;  5HGR A;  1OH0 A;  3M8C A;  3UJM A;  2WOF A;  2R4I A;  3M6X A;  4L8O A;  4OK0 A;  1NJI 4;  2E2U A;  4HOH A;  4MEI A;  1ROA A;  2HMN B;  1WMP A;  1D6Y A;  4OVM A;  3J7Y d;  1O7H B;  2XGL A;  2F86 B;  2W03 A;  3EB8 A;  1BNR A;  1B27 A;  2KAA A;  3KSP A;  1OHS A;  1YHQ 3;  3HAX A;  1UOY A;  2H0I A;  2Z7A A;  1Z1S A;  1W5Z A;  2CFG A;  4ZM8 A;  1ISK A;  3DGM A;  4JF8 A;  4WWU C;  3Q90 A;  1W6G A;  1IV7 A;  1MOL A;  1KC8 4;  1OPY A;  3JUP A;  1GOV A;  2CFD A;  1W01 A;  1I3I A;  3X3Y A;  2A15 A;  2HMJ B;  2IMJ A;  4U13 A;  3TDG A;  2XRX B;  3KE7 A;  2SAR A;  4I5Q A;  5JBS A;  2CK3 H;  5EQL A;  5KP1 A;  1A67 A;  1VZZ A;  1W4N A;  3A76 A;  5CK6 A;  1RNB A;  1WXW A;  1BUQ A;  3DY5 A;  2CX1 A;  1YGE A;  3ER7 A;  2H0H A;  1KSI A;  2P09 A;  3E99 A;  1TP6 A;  4WYK B;  4XBY A;  1MWU A;  1VQ5 3;  1GD4 A;  3FF0 A;  3NQZ A;  1B2X A;  4HZ9 B;  3MG1 A;  3CD6 3;  4HM0 B;  4HYZ A;  4NRE A;  3NM7 A;  6GSP A;  1K41 A;  1OGX A;  1IV9 A;  3V99 A;  1ROV A;  2CIU A;  2W56 B;  3LT9 A;  1BVI A;  1BAN A;  4IPB A;  2BT3 A;  2L1S A;  5IEO A;  2J5V A;  3LDF A;  1N8Q A;  2R41 A;  1B2U A;  1S04 A;  1IQY A;  1UCJ A;  4O02 B;  4PEJ A;  3WOD G;  1BNI A;  2GEX A;  4Q53 A;  1CYV A;  3BU4 A;  5IER A;  3G16 A;  1I0X A;  1QAF A;  1Q40 A;  1YJN 3;  1CYU A;  5BVB A;  1ZO2 A;  3A5E A;  1G0T A;  4ILF A;  1T3B A;  2WGO A;  3HK4 A;  3HOH A;  1GOY A;  2I9W A;  2BMQ B;  4EV2 A;  3KZT A;  3F7S A;  3MG2 A;  1FUT A;  3LML A;  3CU3 A;  1ZL3 A;  2HOH A;  1RGE A;  3DH2 A;  3PGB A;  8RNT A;  1JBS A;  2DP9 A;  1PFP A;  3ZV0 C;  1RGH A;  1RN4 A;  1X1W A;  2GBW B;  4IIA A;  5IG3 A;  5M18 A;  3IPT A;  2CG1 A;  5DRE A;  1RHL A;  1DET A;  4LZI A;  3FKA A;  9RNT A;  1RDS A;  3DGL A;  3V92 A;  1TFO A;  4FR9 A;  1I70 A;  3G6E 3;  5AIF A;  5M1A A;  2XGN A;  2CWV A;  3UL6 A;  2KXG A;  4EC6 A;  1QAL A;  3WR2 A;  3N8B A;  3BNE A;  5CXO A;  4BL3 A;  1IVW A;  1SIH A;  1A2K A;  1JKG A;  4EXR A;  3CC2 3;  1RTU A;  1DVD A;  1RMS A;  5BU4 A;  3EE1 A;  1ULJ B;  4HM8 B;  3M6U A;  1PU4 A;  1N9J A;  5I97 A;  5TGN A;  1YJW 3;  1PY3 A;  3M6W A;  2KF4 A;  2RFK A;  4DMG A;  3G4S 3;  3PCS A;  3OX9 A;  4KT3 B;  3HZP A;  2CH9 A;  5HOH A;  1M1X B;  1WXX A;  2XSO B;  3FLJ A;  3ECF A;  4FMB A;  2P38 A;  1I2G A;  3RGR A;  1HZ1 A;  3SYU A;  3T8N A;  3NM2 A;  1QJG A;  3OW2 2;  1LOW A;  3D5G A;  5FGO A;  3CNM A;  4N6L A;  7GSP A;  3X41 A;  1BNJ A;  2E2T A;  4CI1 B;  3N54 B;  3SOY A;  1W6Y A;  1VQM 3;  2W2C A;  2OTL 3;  4AEQ A;  2BIR A;  1AVK A;  3EN1 B;  3CMA 3;  3EBY A;  3GZY B;  1DMM A;  4BL2 A;  1QVG 2;  3FGY A;  1I0V A;  4LSO A;  3D79 A;  3HJY A;  4DKI A;  4EYC A;  6RNT A;  1LVN A;  3K63 A;  3WDG B;  3DUK A;  4J5G A;  2YFI B;  1FUW A;  1FW7 A;  5ELJ A;  5EEO A;  2XR8 B;  2OQE A;  3IMA B;  2OCT A;  3OV4 A;  2XF3 A;  5AI1 A;  3PS8 A;  1JNQ A;  1BRJ A;  2C10 A;  2RBI A;  3S29 A;  1GYB A;  2EY4 A;  1K9M 4;  1OHO A;  1Y4K A;  1ZE2 A;  2AUS A;  1IVX A;  5FW5 A;  3DGY A;  1VQ8 3;  4MMY B;  1VQP 3;  3DGN A;  3NQY A;  1TUH A;  2PNC A;  1AV4 A;  2BNG A;  2F5M A;  2GU1 A;  4HM1 B;  5GSP A;  3KN4 A;  3U1W A;  5LC6 A;  3CPW 2;  3M65 A;  3LWQ A;  5IG0 A; 
#chains in the Genus database with same CATH homology
 1ZS7 A;  2AB4 A;  1IQ8 A;  3D79 A;  1IT8 A;  3UAI A;  1WXW A;  1ZE1 A;  1IT7 A;  1T5Y A;  2CX1 A;  2Q07 A;  1R3F A;  3C0K A;  1SGV A;  1ZL3 A;  4DMG A;  1Q7H A;  1J2B A;  2CWW A;  2J5T A;  2B78 A;  1K8W A;  1WXX A;  2P38 A;  1ZE2 A;  4Q1T A;  2J5V A;  3LDF A;  1SQW A;  2CX0 A;  2AS0 A;  1R3E A;  3VSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...