2CX0A

Crystal structure of a pua domain (ape0525) from the aeropyrum pernix k1 (sulfate complex)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein APE0525
publication title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (sulfate complex)
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
total genus 50
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2cx0A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 2cx0A01
2J5VA 1SGVA 4DMGA 1ZL3A 1WXWA 2P38A 1T5YA 1IT8A 4Q1TA 1R3FA 1SQWA 2B78A 3LDFA 1R3EA 2CX1A 1ZE2A 2CWWA 1IQ8A 1WXXA 3UAIA 1J2BA 2J5TA 2AS0A 3VSEA 2Q07A 3D79A 1ZE1A 3C0KA 2CX0A 1ZS7A 1K8WA 1IT7A 1Q7HA 2AB4A
chains in the Genus database with same CATH superfamily
5JBSA 3DY5A 2Z76A 1O7PB 2CFKA 1TP6A 3ZG5A 2RSXA 4H3UA 4MMYB 1JN5B 1JN5A 4FMBA 4HZBB 1Q864 2GU1A 7STDA 4N6V0 3LWOA 3RDEA 2CG0A 4L8PA 2B78A 3MPHA 1FGQA 1B3SA 4FMCA 3CC73 1FGOA 1W00A 3SLUA 3FKAA 1UOYA 2GXFA 1TE7A 3CC23 4HM5B 2QEX3 4R9LA 2K0MA 3CCV3 4EV5A 1ZO2A 6RNTA 1JZDA 3FG1A 1IVXA 3OV4A 1YVSA 4KT3B 4L7KA 3CCQ3 1KC84 1IYYA 3PS8A 1FA3A 3DUKA 4KFFA 3LWQA 1UUVB 2LQVA 3BU4A 1BAOA 4WYKB 2CC3A 1A2VA 3CCE3 1ISKA 1CYVA 3I553 1MWUA 3ECFA 3NX0A 3DGMA 1X1XA 1I8VA 3CNMA 3Q2PA 5M19A 1V57A 3GZYB 1YJ93 1BNIA 2JDIH 5IEPA 3AGNA 5JPPA 1S723 2Q07A 1LOWA 1ZE1A 4N3VA 5AEUB 2CH9A 2HVYA 4WP5A 2APOA 3K7CA 4N6UA 2P0XA 3M6UA 4XBYA 5EQLA 4HAAA 1I2FA 2CKFB 3K0ZA 2HMKB 4KFDA 3DGNA 4STDA 2XRXB 3SX1A 5DREA 3V92A 3VSYA 4HM7B 3B7CA 2CG1A 3LTAA 5AIFA 4IIAA 2IUJA 4OVMA 1ROAA 2F98A 1NJI4 1B20A 1IDPA 1RMSA 1U5OA 1QVF2 2YX9A 1M1K4 1KWIA 2P38A 3LZAA 1IT8A 1WQLB 1YIJ3 1R3FA 2ML6A 2HMMB 1JBSA 3DGOA 5AIHA 4FCJA 3BNBA 3EC9A 3CNXA 1GS3A 1OCVA 5JPUA 4H61A 3G4S3 3G713 1OGXA 1MNLA 2MC8A 3X40A 2L4VA 1J2BA 3X42A 1Z1SA 4NHFA 2OWPA 2CWVA 3D4AA 1CYUA 1QALA 1UCKA 1B2MA 3B8LA 3KCHA 4BL2A 1EUIC 2YFLB 3Q1CA 2XFSA 3CMA3 2H0GA 2W56A 1TRQA 3M8CA 3S29A 1OUNA 2BU4A 3SVAA 5ELUA 3AHSA 3D5GA 4CI1B 2Z6BA 4J9AA 4N6OB 1BU4A 3CD63 2QGUA 2F56A 1FUSA 1O7HB 1W01A 4AEQA 1V58A 4HM3B 4BU4A 4LZIA 1WK2A 2RFRA 4K1UA 3OWSA 1DMMA 1M9GA 3MSOA 1TJDA 6GSPA 3FCSB 1RLSA 2BMOB 4XBXA 1E97A 3I563 3SOAA 5CLKA 5DRVA 3L0RA 2BHMA 1VQN3 1ZGXA 1OF5B 1JBRA 1U8CB 3U1WA 1N5HA 1GSPA 1K8WA 1B27A 3GZBA 1O7WB 1L5GB 1LOVA 3ZV0C 1RGEA 2I9WA 3CC43 2RCDA 1N5PA 4XB5A 1JB4A 1BOXA 2ZA4A 4WFOA 1QJGA 1RGGA 3N8BA 1WXWA 2CIUA 2RGQA 4JRFA 3T0UA 3UNLA 3LWVA 3D9RA 4R1KA 1F8NA 1QMAA 4EXRA 1IK3A 4FMAA 1BNJA 1JV2B 3NXJA 3B4PA 2CX1A 1Q42A 2W9PA 3A5EA 3GRDA 3K9MC 4GHOA 3X41A 1TRPA 4R4KA 3FG3A 1EA2A 3EX9A 2KF5A 1MGWA 1WMNA 4RNYA 3HI7A 2F86B 1YIT3 1VQL3 3F7XA 2STDA 3FLJA 4CCVA 1TU5A 1VQO3 3KN4A 3NQZA 1DVDA 5IG5A 3S5CA 4RBNA 3WOEB 2DP9A 1OPYA 2AAEA 4HZ9B 4LMIA 4I5QA 4L8OA 4FMDA 4BTYA 4CI2B 1SARA 3HJWA 2FXTA 1T2HA 2P0MA 4XDWA 5D82A 3HX8A 3JVCA 1N9EA 3OWUA 4RZMA 1Q9EA 3LT8A 1BNRA 1FYSA 1KQS2 1R3EA 4BIRA 3M6XA 1GMPA 2KF6A 1GY5A 4CJNA 3MG2A 5M18A 1YJN3 1B2XA 1K734 1JNQA 2BMQB 4LEHA 2A15A 2O9UX 3MG3A 1S04A 1I3IA 1RGKA 4HM4B 1RJOA 1JB2A 3AHWA 4HM8B 1PFPA 1EKMA 3VF1A 1AQZA 1BNSA 5LC7A 2W6JH 1JBTA 1VQ83 1O7GB 1UDII 3U97A 4HYZA 3UB1A 1I70A 1GMQA 1IVVA 2XSHB 3BIRA 4HKVB 4KZ1A 1BRGA 4AKYA 1I2EA 3MQKA 1W2B2 1IQXA 7GSPA 3RGAA 2BIRA 1IV9A 1Y4KA 2XSOB 2ZL8A 5KP4A 1T5YA 3LXUX 3WR2A 1RN7A 2CFWA 2J8XB 5HOHA 2AADA 1GY7A 3LTBA 1UCLA 2BNGA 5KP1A 1W4NA 3F14A 1BUQA 4KFEA 4GL6A 1FGMA 1JKGA 2XGNA 1B2ZA 3EE1A 3GZRA 2F5MA 1W7CA 8RNTA 5IG4A 2IA7A 2C11A 3LYGA 1YI23 5CF2A 3ALAA 3DZLA 1OGZA 1BRJA 3IMAB 3OXAA 3CME3 2XF3A 4N6TA 4X2OA 3DGLA 4J5KA 5AIIA 1FZUA 3IPTA 2E2TA 4HM2B 4HOHA 2FRXA 5D83A 3M4XA 4K1VA 2LYXA 3MYTA 2IYJA 4WHAA 3QRDA 3MWZA 4WWUC 4FCZA 2OOVC 1CEWI 4IT7A 4BTXA 3CPW2 1BANA 1JRQA 4IPBA 1O7NB 3FSDA 2CWUA 3D3LA 4X2HA 1YGEA 1BRNL 2RFKA 1T2IA 1MGRA 4AKZA 1Q7Y4 2GU3A 3FG4A 1PU4A 1GD3A 1NDOB 2FNQA 3ZG0A 1Q814 1QAKA 3NV0A 2B1XB 2OTL3 2K3DA 2W9QA 4O2HA 2W04A 1BRIA 2UGIA 1W6GA 1AY7A 5IF6A 3VSEA 2HMLB 3EQQB 1N8R4 1LNHA 2KKUA 1YNVX 5G1LA 4DKIA 1AR0A 1W6CA 1FUWA 3S28A 2CW9A 1STDA 2IY2A 3UL5A 3NBRA 1BGSA 1ZX2A 2W56B 4TX4A 4GSPA 3HJYA 1DVCA 1HYFA 5FW5A 2F4YA 2F5WA 4EYCA 1KD14 1BIRA 1LQMB 2D1WA 3CCU3 3EN1B 2F99A 3KSPA 3G0KA 1DE3A 4J8TA 1RGLA 1G02A 3UJMA 5M1AA 3M6WA 3HOHA 1M1XB 5IG0A 2V1LA 5BXQA 7RNTA 1VZZA 1WMPA 5IW9A 2IUKA 3FH1A 3JUOA 4CI3B 4R9KA 5IG3A 4G1MB 1BSCA 4N6NB 2KXGA 5HGRA 1O7MB 5G2GA 3FF2A 3T8UA 1TIJA 3KKGA 1VQ43 2BMRB 2P05A 1RRLA 1K8A4 3ER7A 1IQYA 3OWYA 2XFTA 2WO0A 2BO9B 4EC6A 2XR8B 1UCJA 1FGRA 3KSED 1ULIB 1M904 1K9M4 3LWRA 5AI1A 4HM6B 1GY6A 2WOFA 3GAXA 2M7OA 3EB8A 1BNFA 4O8SA 3LTCA 4OUQA 3B4OA 4FCMA 4KVHA 1EG9B 2H0IA 4XM4A 2HMJB 3CPOA 3O8YA 3LDFA 5LC6A 3SEDA 3DM8A 1Q824 2CWTA 1D6YA 1STFI 3QK9A 1IQ8A 2CWWA 3KFQC 1WXXA 3N9HA 1RRHA 1RN4A 1LXEA 1QAFA 3EF8A 3H51A 3PCSA 5TGNA 2UUGC 4HBRA 1FW7A 3LJCA 2AS0A 3D79A 2C10A 3AMOA 3LOYA 3G6E3 1DETA 1WTHA 2CFLA 1MOLA 1BNGA 2B24B 3JUMA 2WGQA 1NNVA 2QA43 4J5GA 4ZM8A 2YFJB 1RGAA 4LGQA 3HIIA 5BVBA 2ANEA 1GD4A 3ROBA 3NBJA 3CCL3 3J7Yd 1GOVA 1YHQ3 3G8ZA 5G1KA 2L1SA 1US1A 4CDLA 1D6ZA 4N6MA 3MG1A 1S5AA 3HK4A 4O02B 3CCM3 1OH0A 4Q53A 4I4KA 1X1WA 3KE7A 3IUWA 3V98A 1A90A 4HJLB 1MWRA 2KF3A 1B2UA 3PGBA 1DMQA 1OHSA 3WOFB 1BRSA 2J5TA 2E2VA 1IV7A 3EBTA 3DGYA 4MEIA 1ASKA 2BT3A 2YFIB 3NUVA 5AIGA 3FF0A 2MF7A 2HMOB 1UGIA 3PYJA 2CX0A 3Q90A 2OOVA 3BLZA 5IEOA 2P09A 1HZ1A 2Z7AA 3SXXA 4LYLB 1Q7HA 1CH0A 2SARA 1RGHA 2FGTA 1LRAA 2GEXA 1VQM3 2E5OA 1GMRA 3TDGA 2AUSA 1MWSA 3F8XA 2H0HA 5CK6A 3CCJ3 3RGRA 1NB3I 1BVIA 1SQWA 3I0YA 3CCR3 1W6YA 3CXC2 1NU3A 1UI7A 2RBIA 3NHXA 3UAIA 1JKGB 1R4YA 2RNTA 3BNCA 4CPKA 2INXA 3BNEA 3EBYA 3X3YA 1N8QA 1A67A 3C0KA 1BSAA 1ROVA 5STDA 1WMOA 1LNIA 3DXOA 1RTUA 3N54B 2GBXB 4ORLA 2KAAA 4OK0A 1BSBA 2AB4A 5AYSC 1VQP3 3WHOA 1I2GA 3M6VA 2J5VA 1BSDA 1FUTA 1RSNA 4DMGA 1RNTA 4WYKA 3GZXB 2D42A 1IVWA 1JJ22 1AVLA 3S67A 1I0VA 1SJWA 2Y73A 2OQEC 2Z77A 4MJDA 1LVNA 1VQQA 2ZHXB 3K5TA 1HKXA 1PY3A 5GSPA 2UX0A 3OW22 1VQ53 1YVBI 5EEOA 1TUHA 4BL3A 1ZE2A 5BIRA 1BUJA 1E3VA 1C54A 3NV0B 1B21A 3JUQA 1LOXA 1NO3A 1KSIA 1E3RA 1VQ93 2CFDA 3F8HA 4RNZA 5A0OB 1TFOA 1SPUA 3BNDA 3F40A 1ZS7A 2Z0TA 2SBLA 1V74A 2KRTA 4NREA 2W2CA 2IMJA 4XBTA 1A2KA 3LH4A 4QWTA 4LSOA 5D81A 1SIIA 1UI8A 1W02A 3FGYA 1NB5I 5KP3A 3BB9A 4XDVA 2HOHA 1VQK3 3U28A 1DMNA 4GB5A 2PZVA 2E2UA 3WODG 3LMLA 2XGLA 3HZPA 3JUPA 3WDGB 3S27A 1OHOA 4NPBA 3NM2A 5AEWB 3X3XA 1Q40B 1Q40A 5I97A 5RNTA 2CK3H 3A76A 1X1UA 3SOYA 2GSPA 2ZDJA 3ZFZA 1B2SA 3K63A 3URPA 1RCKA 4EW5A 4MMXB 1N9JA 2O3OA 3DMCA 1VQ73 4FR9A 2W03A 3IJEB 2KF4A 9RNTA 3NQYA 1EQKA 3NM7A 3JUNA 1FGTA 4HVNA 3F9SA 3PXMA 1DYUA 3CCS3 1ZBOA 1TFKA 3HIGA 1I3FA 3E99A 3WA2X 1C7HA 4R80A 3PCRA 3VGNA 5AYRB 2XEPA 3X3ZA 4Q1TA 4HM1B 5BU4A 2OTJ3 1T3BA 1AV4A 3EN8A 2WOHA 1BNEA 3G16A 5CXOA 1UUWB 4K61A 1UCIA 1JB5A 5ELJA 1BRKA 1UGHI 3KZTA 1I0XA 1OHPA 1RCLA 1XNEA 1R4CA 1SIHA 2GBWB 1AVKA 3DH2A 4K90B 1RDSA 3WMDA 1RKYA 4EV2A 5FGOA 3AGOA 3EHCA 1GOUA 3KIIA 1IU7A 2OCTA 2K54A 1MWTA 1PYLA 3SYUA 5IENA 1GOYA 2PNCA 1BSEA 1OF5A 1QVG2 2Y74A 4MMZB 1LQGC 3LT9A 3AMOB 1LOYA 1RNBA 1CQSA 1YGWA 3CU3A 1IT7A 1D6UA 3LTDA 3T8NA 3D5IA 8CHOA 1YJW3 4TZ4C 1NWWA 1TTOA 1WNHA 2GEYA 2W0QA 3RNTA 1RN1A 4PEJA 1VQ63 2R4IA 5EVHA 3Q3FA 1SGVA 1IVUA 1BRHA 1GYBA 1OACA 1RGCA 4JF8A 2C4BA 1ZL3A 3NBBA 1K41A 2JQ5A 1RGFA 3M65A 2XH9A 1W2ZA 2KCDA 3MKIA 1K28A 1W5ZA 1UUGB 1UW1A 4U13A 3HAXA 6STDA 1X1YA 3PZWA 4O3VA 3GSPA 4RNTA 2CFGA 2R41A 3STDA 4HM0B 3FZWA 3F7SA 1G0TA 1A2PA 3GWRA 2HMNB 4ILFA 1G96A 1RHLA 3MHEA 4EBGA 3UL6A 3V99A 3OX9A 4BTWA 1EEJA 1ULJB 3LWPA 2QIYA 3EJVA 2ML5A 1JZOA 1HU9A 3WA3A 2EY4A 5CF1A 4N6LA 2OQEA 2WGOA 5IERA 2CHCA 3H3HA
chains in the Genus database with same CATH topology
2J5VA 1SGVA 4DMGA 1ZL3A 1WXWA 2P38A 1T5YA 1IT8A 4Q1TA 1R3FA 1SQWA 2B78A 3LDFA 1R3EA 2CX1A 1ZE2A 2CWWA 1IQ8A 1WXXA 3UAIA 1J2BA 2J5TA 2AS0A 3VSEA 2Q07A 3D79A 1ZE1A 3C0KA 2CX0A 1ZS7A 1K8WA 1IT7A 1Q7HA 2AB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5V A;  1SGV A;  4DMG A;  1ZL3 A;  1WXW A;  2P38 A;  1T5Y A;  1IT8 A;  4Q1T A;  1R3F A;  1SQW A;  2B78 A;  3LDF A;  1R3E A;  2CX1 A;  1ZE2 A;  2CWW A;  1IQ8 A;  1WXX A;  3UAI A;  1J2B A;  2J5T A;  2AS0 A;  3VSE A;  2Q07 A;  3D79 A;  1ZE1 A;  3C0K A;  2CX0 A;  1ZS7 A;  1K8W A;  1IT7 A;  1Q7H A;  2AB4 A; 
#chains in the Genus database with same CATH topology
 5JBS A;  3DY5 A;  2Z76 A;  1O7P B;  2CFK A;  1TP6 A;  3ZG5 A;  2RSX A;  4H3U A;  4MMY B;  1JN5 B;  1JN5 A;  4FMB A;  4HZB B;  1Q86 4;  2GU1 A;  7STD A;  4N6V 0;  3LWO A;  3RDE A;  2CG0 A;  4L8P A;  2B78 A;  3MPH A;  1FGQ A;  1B3S A;  4FMC A;  3CC7 3;  1FGO A;  1W00 A;  3SLU A;  3FKA A;  1UOY A;  2GXF A;  1TE7 A;  3CC2 3;  4HM5 B;  2QEX 3;  4R9L A;  2K0M A;  3CCV 3;  4EV5 A;  1ZO2 A;  6RNT A;  1JZD A;  3FG1 A;  1IVX A;  3OV4 A;  1YVS A;  4KT3 B;  4L7K A;  3CCQ 3;  1KC8 4;  1IYY A;  3PS8 A;  1FA3 A;  3DUK A;  4KFF A;  3LWQ A;  1UUV B;  2LQV A;  3BU4 A;  1BAO A;  4WYK B;  2CC3 A;  1A2V A;  3CCE 3;  1ISK A;  1CYV A;  3I55 3;  1MWU A;  3ECF A;  3NX0 A;  3DGM A;  1X1X A;  1I8V A;  3CNM A;  3Q2P A;  5M19 A;  1V57 A;  3GZY B;  1YJ9 3;  1BNI A;  2JDI H;  5IEP A;  3AGN A;  5JPP A;  1S72 3;  2Q07 A;  1LOW A;  1ZE1 A;  4N3V A;  5AEU B;  2CH9 A;  2HVY A;  4WP5 A;  2APO A;  3K7C A;  4N6U A;  2P0X A;  3M6U A;  4XBY A;  5EQL A;  4HAA A;  1I2F A;  2CKF B;  3K0Z A;  2HMK B;  4KFD A;  3DGN A;  4STD A;  2XRX B;  3SX1 A;  5DRE A;  3V92 A;  3VSY A;  4HM7 B;  3B7C A;  2CG1 A;  3LTA A;  5AIF A;  4IIA A;  2IUJ A;  4OVM A;  1ROA A;  2F98 A;  1NJI 4;  1B20 A;  1IDP A;  1RMS A;  1U5O A;  1QVF 2;  2YX9 A;  1M1K 4;  1KWI A;  2P38 A;  3LZA A;  1IT8 A;  1WQL B;  1YIJ 3;  1R3F A;  2ML6 A;  2HMM B;  1JBS A;  3DGO A;  5AIH A;  4FCJ A;  3BNB A;  3EC9 A;  3CNX A;  1GS3 A;  1OCV A;  5JPU A;  4H61 A;  3G4S 3;  3G71 3;  1OGX A;  1MNL A;  2MC8 A;  3X40 A;  2L4V A;  1J2B A;  3X42 A;  1Z1S A;  4NHF A;  2OWP A;  2CWV A;  3D4A A;  1CYU A;  1QAL A;  1UCK A;  1B2M A;  3B8L A;  3KCH A;  4BL2 A;  1EUI C;  2YFL B;  3Q1C A;  2XFS A;  3CMA 3;  2H0G A;  2W56 A;  1TRQ A;  3M8C A;  3S29 A;  1OUN A;  2BU4 A;  3SVA A;  5ELU A;  3AHS A;  3D5G A;  4CI1 B;  2Z6B A;  4J9A A;  4N6O B;  1BU4 A;  3CD6 3;  2QGU A;  2F56 A;  1FUS A;  1O7H B;  1W01 A;  4AEQ A;  1V58 A;  4HM3 B;  4BU4 A;  4LZI A;  1WK2 A;  2RFR A;  4K1U A;  3OWS A;  1DMM A;  1M9G A;  3MSO A;  1TJD A;  6GSP A;  3FCS B;  1RLS A;  2BMO B;  4XBX A;  1E97 A;  3I56 3;  3SOA A;  5CLK A;  5DRV A;  3L0R A;  2BHM A;  1VQN 3;  1ZGX A;  1OF5 B;  1JBR A;  1U8C B;  3U1W A;  1N5H A;  1GSP A;  1K8W A;  1B27 A;  3GZB A;  1O7W B;  1L5G B;  1LOV A;  3ZV0 C;  1RGE A;  2I9W A;  3CC4 3;  2RCD A;  1N5P A;  4XB5 A;  1JB4 A;  1BOX A;  2ZA4 A;  4WFO A;  1QJG A;  1RGG A;  3N8B A;  1WXW A;  2CIU A;  2RGQ A;  4JRF A;  3T0U A;  3UNL A;  3LWV A;  3D9R A;  4R1K A;  1F8N A;  1QMA A;  4EXR A;  1IK3 A;  4FMA A;  1BNJ A;  1JV2 B;  3NXJ A;  3B4P A;  2CX1 A;  1Q42 A;  2W9P A;  3A5E A;  3GRD A;  3K9M C;  4GHO A;  3X41 A;  1TRP A;  4R4K A;  3FG3 A;  1EA2 A;  3EX9 A;  2KF5 A;  1MGW A;  1WMN A;  4RNY A;  3HI7 A;  2F86 B;  1YIT 3;  1VQL 3;  3F7X A;  2STD A;  3FLJ A;  4CCV A;  1TU5 A;  1VQO 3;  3KN4 A;  3NQZ A;  1DVD A;  5IG5 A;  3S5C A;  4RBN A;  3WOE B;  2DP9 A;  1OPY A;  2AAE A;  4HZ9 B;  4LMI A;  4I5Q A;  4L8O A;  4FMD A;  4BTY A;  4CI2 B;  1SAR A;  3HJW A;  2FXT A;  1T2H A;  2P0M A;  4XDW A;  5D82 A;  3HX8 A;  3JVC A;  1N9E A;  3OWU A;  4RZM A;  1Q9E A;  3LT8 A;  1BNR A;  1FYS A;  1KQS 2;  1R3E A;  4BIR A;  3M6X A;  1GMP A;  2KF6 A;  1GY5 A;  4CJN A;  3MG2 A;  5M18 A;  1YJN 3;  1B2X A;  1K73 4;  1JNQ A;  2BMQ B;  4LEH A;  2A15 A;  2O9U X;  3MG3 A;  1S04 A;  1I3I A;  1RGK A;  4HM4 B;  1RJO A;  1JB2 A;  3AHW A;  4HM8 B;  1PFP A;  1EKM A;  3VF1 A;  1AQZ A;  1BNS A;  5LC7 A;  2W6J H;  1JBT A;  1VQ8 3;  1O7G B;  1UDI I;  3U97 A;  4HYZ A;  3UB1 A;  1I70 A;  1GMQ A;  1IVV A;  2XSH B;  3BIR A;  4HKV B;  4KZ1 A;  1BRG A;  4AKY A;  1I2E A;  3MQK A;  1W2B 2;  1IQX A;  7GSP A;  3RGA A;  2BIR A;  1IV9 A;  1Y4K A;  2XSO B;  2ZL8 A;  5KP4 A;  1T5Y A;  3LXU X;  3WR2 A;  1RN7 A;  2CFW A;  2J8X B;  5HOH A;  2AAD A;  1GY7 A;  3LTB A;  1UCL A;  2BNG A;  5KP1 A;  1W4N A;  3F14 A;  1BUQ A;  4KFE A;  4GL6 A;  1FGM A;  1JKG A;  2XGN A;  1B2Z A;  3EE1 A;  3GZR A;  2F5M A;  1W7C A;  8RNT A;  5IG4 A;  2IA7 A;  2C11 A;  3LYG A;  1YI2 3;  5CF2 A;  3ALA A;  3DZL A;  1OGZ A;  1BRJ A;  3IMA B;  3OXA A;  3CME 3;  2XF3 A;  4N6T A;  4X2O A;  3DGL A;  4J5K A;  5AII A;  1FZU A;  3IPT A;  2E2T A;  4HM2 B;  4HOH A;  2FRX A;  5D83 A;  3M4X A;  4K1V A;  2LYX A;  3MYT A;  2IYJ A;  4WHA A;  3QRD A;  3MWZ A;  4WWU C;  4FCZ A;  2OOV C;  1CEW I;  4IT7 A;  4BTX A;  3CPW 2;  1BAN A;  1JRQ A;  4IPB A;  1O7N B;  3FSD A;  2CWU A;  3D3L A;  4X2H A;  1YGE A;  1BRN L;  2RFK A;  1T2I A;  1MGR A;  4AKZ A;  1Q7Y 4;  2GU3 A;  3FG4 A;  1PU4 A;  1GD3 A;  1NDO B;  2FNQ A;  3ZG0 A;  1Q81 4;  1QAK A;  3NV0 A;  2B1X B;  2OTL 3;  2K3D A;  2W9Q A;  4O2H A;  2W04 A;  1BRI A;  2UGI A;  1W6G A;  1AY7 A;  5IF6 A;  3VSE A;  2HML B;  3EQQ B;  1N8R 4;  1LNH A;  2KKU A;  1YNV X;  5G1L A;  4DKI A;  1AR0 A;  1W6C A;  1FUW A;  3S28 A;  2CW9 A;  1STD A;  2IY2 A;  3UL5 A;  3NBR A;  1BGS A;  1ZX2 A;  2W56 B;  4TX4 A;  4GSP A;  3HJY A;  1DVC A;  1HYF A;  5FW5 A;  2F4Y A;  2F5W A;  4EYC A;  1KD1 4;  1BIR A;  1LQM B;  2D1W A;  3CCU 3;  3EN1 B;  2F99 A;  3KSP A;  3G0K A;  1DE3 A;  4J8T A;  1RGL A;  1G02 A;  3UJM A;  5M1A A;  3M6W A;  3HOH A;  1M1X B;  5IG0 A;  2V1L A;  5BXQ A;  7RNT A;  1VZZ A;  1WMP A;  5IW9 A;  2IUK A;  3FH1 A;  3JUO A;  4CI3 B;  4R9K A;  5IG3 A;  4G1M B;  1BSC A;  4N6N B;  2KXG A;  5HGR A;  1O7M B;  5G2G A;  3FF2 A;  3T8U A;  1TIJ A;  3KKG A;  1VQ4 3;  2BMR B;  2P05 A;  1RRL A;  1K8A 4;  3ER7 A;  1IQY A;  3OWY A;  2XFT A;  2WO0 A;  2BO9 B;  4EC6 A;  2XR8 B;  1UCJ A;  1FGR A;  3KSE D;  1ULI B;  1M90 4;  1K9M 4;  3LWR A;  5AI1 A;  4HM6 B;  1GY6 A;  2WOF A;  3GAX A;  2M7O A;  3EB8 A;  1BNF A;  4O8S A;  3LTC A;  4OUQ A;  3B4O A;  4FCM A;  4KVH A;  1EG9 B;  2H0I A;  4XM4 A;  2HMJ B;  3CPO A;  3O8Y A;  3LDF A;  5LC6 A;  3SED A;  3DM8 A;  1Q82 4;  2CWT A;  1D6Y A;  1STF I;  3QK9 A;  1IQ8 A;  2CWW A;  3KFQ C;  1WXX A;  3N9H A;  1RRH A;  1RN4 A;  1LXE A;  1QAF A;  3EF8 A;  3H51 A;  3PCS A;  5TGN A;  2UUG C;  4HBR A;  1FW7 A;  3LJC A;  2AS0 A;  3D79 A;  2C10 A;  3AMO A;  3LOY A;  3G6E 3;  1DET A;  1WTH A;  2CFL A;  1MOL A;  1BNG A;  2B24 B;  3JUM A;  2WGQ A;  1NNV A;  2QA4 3;  4J5G A;  4ZM8 A;  2YFJ B;  1RGA A;  4LGQ A;  3HII A;  5BVB A;  2ANE A;  1GD4 A;  3ROB A;  3NBJ A;  3CCL 3;  3J7Y d;  1GOV A;  1YHQ 3;  3G8Z A;  5G1K A;  2L1S A;  1US1 A;  4CDL A;  1D6Z A;  4N6M A;  3MG1 A;  1S5A A;  3HK4 A;  4O02 B;  3CCM 3;  1OH0 A;  4Q53 A;  4I4K A;  1X1W A;  3KE7 A;  3IUW A;  3V98 A;  1A90 A;  4HJL B;  1MWR A;  2KF3 A;  1B2U A;  3PGB A;  1DMQ A;  1OHS A;  3WOF B;  1BRS A;  2J5T A;  2E2V A;  1IV7 A;  3EBT A;  3DGY A;  4MEI A;  1ASK A;  2BT3 A;  2YFI B;  3NUV A;  5AIG A;  3FF0 A;  2MF7 A;  2HMO B;  1UGI A;  3PYJ A;  2CX0 A;  3Q90 A;  2OOV A;  3BLZ A;  5IEO A;  2P09 A;  1HZ1 A;  2Z7A A;  3SXX A;  4LYL B;  1Q7H A;  1CH0 A;  2SAR A;  1RGH A;  2FGT A;  1LRA A;  2GEX A;  1VQM 3;  2E5O A;  1GMR A;  3TDG A;  2AUS A;  1MWS A;  3F8X A;  2H0H A;  5CK6 A;  3CCJ 3;  3RGR A;  1NB3 I;  1BVI A;  1SQW A;  3I0Y A;  3CCR 3;  1W6Y A;  3CXC 2;  1NU3 A;  1UI7 A;  2RBI A;  3NHX A;  3UAI A;  1JKG B;  1R4Y A;  2RNT A;  3BNC A;  4CPK A;  2INX A;  3BNE A;  3EBY A;  3X3Y A;  1N8Q A;  1A67 A;  3C0K A;  1BSA A;  1ROV A;  5STD A;  1WMO A;  1LNI A;  3DXO A;  1RTU A;  3N54 B;  2GBX B;  4ORL A;  2KAA A;  4OK0 A;  1BSB A;  2AB4 A;  5AYS C;  1VQP 3;  3WHO A;  1I2G A;  3M6V A;  2J5V A;  1BSD A;  1FUT A;  1RSN A;  4DMG A;  1RNT A;  4WYK A;  3GZX B;  2D42 A;  1IVW A;  1JJ2 2;  1AVL A;  3S67 A;  1I0V A;  1SJW A;  2Y73 A;  2OQE C;  2Z77 A;  4MJD A;  1LVN A;  1VQQ A;  2ZHX B;  3K5T A;  1HKX A;  1PY3 A;  5GSP A;  2UX0 A;  3OW2 2;  1VQ5 3;  1YVB I;  5EEO A;  1TUH A;  4BL3 A;  1ZE2 A;  5BIR A;  1BUJ A;  1E3V A;  1C54 A;  3NV0 B;  1B21 A;  3JUQ A;  1LOX A;  1NO3 A;  1KSI A;  1E3R A;  1VQ9 3;  2CFD A;  3F8H A;  4RNZ A;  5A0O B;  1TFO A;  1SPU A;  3BND A;  3F40 A;  1ZS7 A;  2Z0T A;  2SBL A;  1V74 A;  2KRT A;  4NRE A;  2W2C A;  2IMJ A;  4XBT A;  1A2K A;  3LH4 A;  4QWT A;  4LSO A;  5D81 A;  1SII A;  1UI8 A;  1W02 A;  3FGY A;  1NB5 I;  5KP3 A;  3BB9 A;  4XDV A;  2HOH A;  1VQK 3;  3U28 A;  1DMN A;  4GB5 A;  2PZV A;  2E2U A;  3WOD G;  3LML A;  2XGL A;  3HZP A;  3JUP A;  3WDG B;  3S27 A;  1OHO A;  4NPB A;  3NM2 A;  5AEW B;  3X3X A;  1Q40 B;  1Q40 A;  5I97 A;  5RNT A;  2CK3 H;  3A76 A;  1X1U A;  3SOY A;  2GSP A;  2ZDJ A;  3ZFZ A;  1B2S A;  3K63 A;  3URP A;  1RCK A;  4EW5 A;  4MMX B;  1N9J A;  2O3O A;  3DMC A;  1VQ7 3;  4FR9 A;  2W03 A;  3IJE B;  2KF4 A;  9RNT A;  3NQY A;  1EQK A;  3NM7 A;  3JUN A;  1FGT A;  4HVN A;  3F9S A;  3PXM A;  1DYU A;  3CCS 3;  1ZBO A;  1TFK A;  3HIG A;  1I3F A;  3E99 A;  3WA2 X;  1C7H A;  4R80 A;  3PCR A;  3VGN A;  5AYR B;  2XEP A;  3X3Z A;  4Q1T A;  4HM1 B;  5BU4 A;  2OTJ 3;  1T3B A;  1AV4 A;  3EN8 A;  2WOH A;  1BNE A;  3G16 A;  5CXO A;  1UUW B;  4K61 A;  1UCI A;  1JB5 A;  5ELJ A;  1BRK A;  1UGH I;  3KZT A;  1I0X A;  1OHP A;  1RCL A;  1XNE A;  1R4C A;  1SIH A;  2GBW B;  1AVK A;  3DH2 A;  4K90 B;  1RDS A;  3WMD A;  1RKY A;  4EV2 A;  5FGO A;  3AGO A;  3EHC A;  1GOU A;  3KII A;  1IU7 A;  2OCT A;  2K54 A;  1MWT A;  1PYL A;  3SYU A;  5IEN A;  1GOY A;  2PNC A;  1BSE A;  1OF5 A;  1QVG 2;  2Y74 A;  4MMZ B;  1LQG C;  3LT9 A;  3AMO B;  1LOY A;  1RNB A;  1CQS A;  1YGW A;  3CU3 A;  1IT7 A;  1D6U A;  3LTD A;  3T8N A;  3D5I A;  8CHO A;  1YJW 3;  4TZ4 C;  1NWW A;  1TTO A;  1WNH A;  2GEY A;  2W0Q A;  3RNT A;  1RN1 A;  4PEJ A;  1VQ6 3;  2R4I A;  5EVH A;  3Q3F A;  1SGV A;  1IVU A;  1BRH A;  1GYB A;  1OAC A;  1RGC A;  4JF8 A;  2C4B A;  1ZL3 A;  3NBB A;  1K41 A;  2JQ5 A;  1RGF A;  3M65 A;  2XH9 A;  1W2Z A;  2KCD A;  3MKI A;  1K28 A;  1W5Z A;  1UUG B;  1UW1 A;  4U13 A;  3HAX A;  6STD A;  1X1Y A;  3PZW A;  4O3V A;  3GSP A;  4RNT A;  2CFG A;  2R41 A;  3STD A;  4HM0 B;  3FZW A;  3F7S A;  1G0T A;  1A2P A;  3GWR A;  2HMN B;  4ILF A;  1G96 A;  1RHL A;  3MHE A;  4EBG A;  3UL6 A;  3V99 A;  3OX9 A;  4BTW A;  1EEJ A;  1ULJ B;  3LWP A;  2QIY A;  3EJV A;  2ML5 A;  1JZO A;  1HU9 A;  3WA3 A;  2EY4 A;  5CF1 A;  4N6L A;  2OQE A;  2WGO A;  5IER A;  2CHC A;  3H3H A; 
#chains in the Genus database with same CATH homology
 2J5V A;  1SGV A;  4DMG A;  1ZL3 A;  1WXW A;  2P38 A;  1T5Y A;  1IT8 A;  4Q1T A;  1R3F A;  1SQW A;  2B78 A;  3LDF A;  1R3E A;  2CX1 A;  1ZE2 A;  2CWW A;  1IQ8 A;  1WXX A;  3UAI A;  1J2B A;  2J5T A;  2AS0 A;  3VSE A;  2Q07 A;  3D79 A;  1ZE1 A;  3C0K A;  2CX0 A;  1ZS7 A;  1K8W A;  1IT7 A;  1Q7H A;  2AB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...