2CX0A

Crystal structure of a pua domain (ape0525) from the aeropyrum pernix k1 (sulfate complex)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein APE0525
publication title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (sulfate complex)
rcsb
source organism Aeropyrum pernix
total genus 50
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2cx0A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 2cx0A01
1Q7HA 1SGVA 4DMGA 2AB4A 1T5YA 1IQ8A 1R3FA 1ZL3A 1ZS7A 3VSEA 2J5TA 2CX1A 2B78A 4Q1TA 1IT8A 1WXXA 1ZE2A 1R3EA 2AS0A 2P38A 2CX0A 3LDFA 1K8WA 3D79A 1J2BA 1SQWA 2J5VA 2CWWA 2Q07A 1IT7A 1ZE1A 3UAIA 1WXWA 3C0KA
chains in the Genus database with same CATH superfamily
4IPBA 2CG0A 1O7MB 1BRKA 1OHPA 1WMPA 3S67A 3DGMA 2V1LA 3AMOB 4FMAA 2W0QA 1N5HA 4RNTA 1IYYA 2J5TA 2B78A 1JN5B 1LOWA 3G8ZA 4X2HA 1MWSA 1X1YA 2GU3A 2CH9A 2F5MA 1JBRA 1UCKA 1JKGA 3S27A 3CC73 4ILFA 1JBSA 3FF0A 4BL2A 3F7SA 4LGQA 2INXA 3DY5A 1ZGXA 2E2TA 3GAXA 2YFLB 1UCJA 4N6TA 3DUKA 1EG9B 4FCZA 4HZBB 3K7CA 1WMNA 4FCJA 1BU4A 3RDEA 3SXXA 3UL6A 5G2GA 3DMCA 1Q40A 4XDVA 1PU4A 4RNZA 1VQO3 4RNYA 1UDII 5CF1A 1BRJA 1CYVA 1YHQ3 3M65A 1DVDA 2XRXB 3ZV0C 4BU4A 3PCRA 2F5WA 2ML5A 3PGBA 2BNGA 1IVWA 4K90B 1CYUA 1NB3I 2C10A 3D3LA 3L0RA 2RCDA 2B24B 3LMLA 4IT7A 8RNTA 3CCU3 3CCL3 2KAAA 3V92A 1GY5A 1TU5A 4XBXA 4CI1B 3NUVA 1T3BA 5BU4A 3FKAA 3I553 2LYXA 3NV0A 1RGGA 3KE7A 3PCSA 4LEHA 5AEWB 1W6CA 4EC6A 3NXJA 4CJNA 2CC3A 4MMZB 1MWRA 3EX9A 4HM5B 2CFGA 3F9SA 3KKGA 2MC8A 3G6E3 1OACA 1SIHA 2PZVA 3D79A 1QVF2 1QALA 5IERA 2H0IA 4LMIA 2C4BA 1B27A 2ZL8A 1W6GA 1JZOA 3S29A 4BTWA 3EBTA 3DZLA 2BMOB 2Y74A 3T8UA 2P0XA 1A2VA 2K0MA 1QMAA 2XR8B 4KT3B 1WNHA 4N6MA 1Q42A 3FCSB 3MSOA 3BNEA 1M1K4 7RNTA 5AYRB 3BB9A 1N9JA 1B2ZA 1W5ZA 1WTHA 1X1WA 1BNIA 3TDGA 2ZA4A 3WA3A 4MJDA 1YGEA 1R3EA 1DMQA 1V57A 4MMYB 2QA43 4KFEA 1XNEA 5KP4A 3B4OA 1D6ZA 4N3VA 4BL3A 4XBTA 1BSDA 4N6V0 1V74A 4GL6A 3CC23 1I2EA 1FGQA 2J8XB 3LT8A 1KD14 1KC84 1GMRA 1I2GA 3KZTA 3CCQ3 2HMNB 5KP1A 4CI2B 4FCMA 4H61A 2OQEC 1BRIA 1NU3A 5EQLA 3FSDA 3X42A 2CHCA 2KRTA 1OHSA 1R3FA 1IDPA 2GBXB 3PZWA 5CK6A 1A2KA 8CHOA 1OF5B 5G1LA 2HOHA 3DGYA 4AKZA 1EA2A 4Q1TA 2RGQA 2STDA 5D82A 1HYFA 2IA7A 3URPA 1O7NB 1MNLA 1RLSA 2OOVC 2RBIA 2H0GA 2L4VA 2W56B 3U1WA 1BUJA 1MOLA 3PS8A 1RDSA 2P09A 3MG3A 2ZDJA 1LQMB 1E3RA 3LWRA 1PFPA 2Z76A 5IG4A 1JZDA 1RRLA 2CWVA 1VQ43 4L8PA 5ELJA 3SEDA 2PNCA 1W02A 3DGOA 1RGLA 1LOYA 3KIIA 3STDA 1VQM3 4FMCA 2IUKA 3O8YA 1IQXA 3NQYA 5STDA 3BLZA 1STFI 1IQYA 3N54B 2KF3A 4O2HA 3UNLA 4LSOA 3FZWA 1B2MA 4RZMA 1Z1SA 5D83A 2Z0TA 2F86B 1PYLA 1AQZA 3CCV3 1AVLA 1LVNA 3EC9A 1BNEA 4GSPA 4O3VA 5EVHA 1RGAA 4N6LA 3IPTA 1ASKA 3EN8A 1ULIB 1WXXA 1GOUA 1NDOB 3CMA3 5IEOA 1RGCA 2CFDA 5D81A 1UCLA 1FGTA 4WWUC 4H3UA 3CPOA 3VSYA 4OUQA 1ULJB 2KCDA 1LNIA 1BNGA 3GRDA 4K1VA 1TTOA 2GEXA 3N9HA 2OTL3 4JRFA 3B7CA 1IT7A 2E5OA 3HIGA 3CCJ3 3G0KA 3MG1A 5AIHA 1IV7A 3UJMA 1G0TA 4J9AA 4CPKA 1Q7HA 1K41A 1FZUA 1VQN3 2Z6BA 1VQ83 2FRXA 3GZXB 1ZL3A 3D9RA 1JN5A 2GBWB 4TZ4C 4EBGA 2GU1A 4WP5A 3IJEB 3ER7A 1W2ZA 1RHLA 2KF5A 5AYSC 2F4YA 3D4AA 1UI7A 3DGLA 3EE1A 4PEJA 3M6WA 2HMLB 3WR2A 3F40A 2H0HA 3SLUA 1RKYA 3AGOA 1EKMA 2R4IA 1MWUA 4WYKB 1AY7A 5AIIA 3B8LA 1Q864 4XB5A 3N8BA 4ZM8A 1BVIA 3LDFA 2OWPA 1EUIC 2R41A 1RGFA 3FG4A 1I2FA 2OQEA 1OHOA 1GOYA 1UUWB 3VF1A 3HX8A 1MGRA 5FGOA 1OH0A 2CKFB 2MF7A 1W7CA 4HZ9B 6GSPA 3UAIA 4CDLA 1VQ93 1N5PA 1TUHA 1YVSA 3CCS3 1VQ63 1A90A 4HAAA 1I8VA 4HM2B 3LOYA 2OOVA 3ZFZA 3RGRA 5CLKA 1FA3A 3GZBA 1F8NA 5BIRA 3NQZA 1M1XB 1YVBI 2UX0A 5HOHA 2DP9A 2B1XB 4Q53A 1RGHA 1IV9A 1JKGB 1OPYA 3U97A 1RN7A 3LH4A 1GSPA 2CW9A 3I563 4HVNA 1K28A 5IG5A 1YI23 4O8SA 1TE7A 2WOFA 5ELUA 3CC43 1GMPA 4R1KA 1OUNA 2XFTA 5CXOA 3JUNA 2KF4A 3LZAA 1ZX2A 3OXAA 3OWUA 3QK9A 1BNSA 1JJ22 1YJ93 1E3VA 1VQK3 1SQWA 1BSBA 2CWUA 1GMQA 5AEUB 3AHWA 1Q40B 1TRPA 1V58A 2BT3A 5IEPA 3CCE3 2W9PA 1UOYA 1JNQA 1I70A 4I5QA 3ZG0A 2EY4A 3Q90A 1DMMA 3MWZA 3CME3 3JUPA 1UUVB 2W03A 3M6UA 1BGSA 3LYGA 4N6NB 3M6VA 1X1XA 3MHEA 4HM0B 5AI1A 2XEPA 1D6UA 2ANEA 2I9WA 1RTUA 2BHMA 3G16A 1EQKA 2K3DA 3DGNA 4LZIA 1SPUA 4KFDA 3DXOA 1IVVA 3NV0B 4HJLB 3WMDA 1NJI4 2RFRA 2CWTA 7STDA 3FGYA 1M904 5IW9A 1YJW3 1E97A 3EQQB 1R4CA 1A2PA 1TJDA 2ML6A 3BIRA 4J5GA 1RGEA 2J5VA 1LOVA 3H51A 1UCIA 1SJWA 1TRQA 2GSPA 3M4XA 3HOHA 5IF6A 1QAKA 7GSPA 1TIJA 1OF5A 1KSIA 3LTCA 3HAXA 4U13A 1T2IA 2FXTA 3K5TA 1BIRA 1AV4A 3ECFA 1GS3A 1RJOA 1S5AA 2P0MA 1VQ73 4LYLB 1BRGA 1A67A 3SVAA 3BU4A 3WOEB 5TGNA 2YFIB 2OTJ3 2IY2A 2JDIH 2AUSA 2O3OA 4J8TA 1BRNL 5M18A 2KKUA 5M19A 4NREA 1M9GA 3EF8A 2FGTA 2KF6A 3CPW2 1W2B2 2P05A 1Q7Y4 3MQKA 3M8CA 1QJGA 2UGIA 1NB5I 2UUGC 4K1UA 3OWYA 3CD63 3KCHA 3VSEA 1DYUA 1PY3A 3G713 5LC6A 5IG3A 4J5KA 1VQ53 2WGQA 3WODG 1ZS7A 3LWPA 1ZO2A 2C11A 2FNQA 1B2SA 3M6XA 4HYZA 1GD4A 4KVHA 3T8NA 1STDA 2GXFA 3CNXA 1JB5A 1B2XA 1FGOA 1SIIA 2JQ5A 3RGAA 5RNTA 2W6JH 3NHXA 3WA2X 1JV2B 3NM2A 5DREA 2CFWA 3ROBA 1CQSA 2GEYA 3NBJA 1FW7A 1K8A4 2QIYA 1TFOA 1RRHA 2SARA 1BOXA 2A15A 1O7WB 2KXGA 1NO3A 1D6YA 1US1A 2AAEA 2LQVA 1JB2A 2M7OA 2XGLA 4KFFA 4R9KA 5KP3A 4HKVB 1CEWI 3BNCA 4EV5A 1VQP3 5FW5A 1R4YA 1ZE1A 4MMXB 1GOVA 3CCM3 1HU9A 2BMQB 1SGVA 3GZYB 2AB4A 2YFJB 3LJCA 3GSPA 3AMOA 4O02B 5GSPA 4QWTA 1O7HB 1N8QA 3A76A 1OGZA 3D5IA 2HVYA 1DMNA 5EEOA 5BXQA 6RNTA 1W01A 3JVCA 1DETA 2XSOB 3CNMA 4STDA 3X40A 4WYKA 1CH0A 2XF3A 1VQL3 3S28A 1OCVA 1KWIA 1X1UA 3OV4A 4BTYA 4L8OA 1BNJA 2CX0A 1LQGC 1W4NA 2BMRB 4CCVA 5IENA 1VZZA 3V99A 5JBSA 3EN1B 2OCTA 3D5GA 3UB1A 4R9LA 3K63A 1IVXA 1W6YA 4CI3B 1LNHA 3KN4A 3LXUX 3LWVA 3OX9A 4L7KA 3SYUA 4EW5A 4IIAA 3NBRA 3Q1CA 3OW22 4DKIA 2RFKA 3IUWA 4I4KA 4NHFA 3JUQA 2Z77A 5G1KA 1RSNA 3T0UA 1ISKA 3F14A 5HGRA 4BTXA 1IT8A 1BNFA 3ALAA 4HM4B 3FH1A 4XBYA 2W2CA 1L5GB 4WFOA 3LT9A 3VGNA 3V98A 3K9MC 5I97A 2L1SA 1ZE2A 2CFKA 1ROAA 3BNDA 2ZHXB 2HMKB 4HM1B 6STDA 1EEJA 4XDWA 2P38A 1UGIA 3EHCA 1O7PB 1HKXA 1Q9EA 3F8XA 4RBNA 4NPBA 2D1WA 1UUGB 2CFLA 2WOHA 3IMAB 1C7HA 3KFQC 1NNVA 3LTBA 3FLJA 4FR9A 3K0ZA 3LTAA 1LXEA 3DM8A 1BSAA 1U5OA 3MKIA 1RMSA 3RNTA 1WK2A 3EJVA 3WHOA 2CK3H 2XFSA 4FMBA 2IMJA 3Q3FA 4HOHA 1OGXA 1YIT3 1FGMA 1GYBA 2XSHB 5IG0A 3B4PA 1WMOA 3MG2A 5DRVA 1Q824 4R4KA 3U28A 1RCLA 2BU4A 1UW1A 4OK0A 2APOA 1RNTA 3GWRA 4HM8B 2AADA 1TFKA 4EV2A 5JPPA 4K61A 2QGUA 3X41A 1I0VA 4OVMA 1O7GB 2F99A 2BO9B 1BAOA 1GY7A 1G96A 1SARA 4EXRA 1I3IA 2SBLA 3FG1A 1RN1A 3C0KA 1JBTA 4HM7B 3SX1A 1JB4A 4DMGA 5A0OB 1T5YA 1IQ8A 1ZBOA 1FUTA 1B20A 4XM4A 1YNVX 1QAFA 3JUOA 2W9QA 4X2OA 3FG3A 3A5EA 9RNTA 2CG1A 2CX1A 1B21A 1IK3A 1DE3A 1N8R4 4N6OB 1GD3A 2RSXA 4FMDA 4JF8A 1W00A 1RNBA 2W56A 2E2VA 3WOFB 1BSEA 1KQS2 2Z7AA 4N6UA 3EB8A 1MGWA 2AS0A 1B2UA 2HMMB 2O9UX 2YX9A 3ZG5A 2WO0A 1AR0A 5AIGA 3KSPA 1J2BA 2E2UA 2HMOB 3EBYA 3HJWA 2BIRA 3HZPA 1YJN3 2D42A 3BNBA 2IYJA 1FUSA 4AKYA 3I0YA 1AVKA 3F7XA 2F56A 1UGHI 5M1AA 3AHSA 2Y73A 3OWSA 4GHOA 3J7Yd 4AEQA 3AGNA 3CXC2 3CCR3 2XH9A 1S04A 3DH2A 1N9EA 4KZ1A 3H3HA 3NBBA 1UI8A 1S723 1LRAA 3SOYA 1BANA 3F8HA 2QEX3 1ROVA 1FYSA 1DVCA 3G4S3 1K9M4 3PYJA 5LC7A 4WHAA 1MWTA 2HMJB 3MPHA 1WQLB 1K8WA 3HK4A 3FF2A 4R80A 1YGWA 3GZRA 3SOAA 4ORLA 1VQQA 3UL5A 2F98A 3E99A 4BIRA 1RGKA 1RN4A 5CF2A 1TP6A 4G1MB 1GY6A 2WGOA 1Y4KA 5AIFA 1FGRA 1C54A 3S5CA 1HZ1A 3JUMA 1RCKA 1T2HA 1I0XA 1BRSA 1JRQA 3HJYA 2RNTA 3HIIA 3NM7A 5BVBA 3X3XA 3LWQA 4MEIA 4EYCA 1U8CB 1G02A 4GB5A 3KSED 3MYTA 3X3ZA 3CU3A 3X3YA 1YIJ3 1QVG2 3Q2PA 2IUJA 4HM6B 2K54A 2XGNA 3LTDA 1BRHA 3QRDA 1FUWA 3WDGB 1Q814 1BSCA 1IVUA 4TX4A 4HM3B 1NWWA 3NX0A 1BUQA 3PXMA 3LWOA 4HBRA 1I3FA 2CWWA 1B3SA 2CIUA 1K734 1LOXA 2Q07A 5JPUA 1IU7A 1BNRA 2W04A 1WXWA 3HI7A
chains in the Genus database with same CATH topology
1Q7HA 1SGVA 4DMGA 2AB4A 1T5YA 1IQ8A 1R3FA 1ZL3A 1ZS7A 3VSEA 2J5TA 2CX1A 2B78A 4Q1TA 1IT8A 1WXXA 1ZE2A 1R3EA 2AS0A 2P38A 2CX0A 3LDFA 1K8WA 3D79A 1J2BA 1SQWA 2J5VA 2CWWA 2Q07A 1IT7A 1ZE1A 3UAIA 1WXWA 3C0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7H A;  1SGV A;  4DMG A;  2AB4 A;  1T5Y A;  1IQ8 A;  1R3F A;  1ZL3 A;  1ZS7 A;  3VSE A;  2J5T A;  2CX1 A;  2B78 A;  4Q1T A;  1IT8 A;  1WXX A;  1ZE2 A;  1R3E A;  2AS0 A;  2P38 A;  2CX0 A;  3LDF A;  1K8W A;  3D79 A;  1J2B A;  1SQW A;  2J5V A;  2CWW A;  2Q07 A;  1IT7 A;  1ZE1 A;  3UAI A;  1WXW A;  3C0K A; 
#chains in the Genus database with same CATH topology
 4IPB A;  2CG0 A;  1O7M B;  1BRK A;  1OHP A;  1WMP A;  3S67 A;  3DGM A;  2V1L A;  3AMO B;  4FMA A;  2W0Q A;  1N5H A;  4RNT A;  1IYY A;  2J5T A;  2B78 A;  1JN5 B;  1LOW A;  3G8Z A;  4X2H A;  1MWS A;  1X1Y A;  2GU3 A;  2CH9 A;  2F5M A;  1JBR A;  1UCK A;  1JKG A;  3S27 A;  3CC7 3;  4ILF A;  1JBS A;  3FF0 A;  4BL2 A;  3F7S A;  4LGQ A;  2INX A;  3DY5 A;  1ZGX A;  2E2T A;  3GAX A;  2YFL B;  1UCJ A;  4N6T A;  3DUK A;  1EG9 B;  4FCZ A;  4HZB B;  3K7C A;  1WMN A;  4FCJ A;  1BU4 A;  3RDE A;  3SXX A;  3UL6 A;  5G2G A;  3DMC A;  1Q40 A;  4XDV A;  1PU4 A;  4RNZ A;  1VQO 3;  4RNY A;  1UDI I;  5CF1 A;  1BRJ A;  1CYV A;  1YHQ 3;  3M65 A;  1DVD A;  2XRX B;  3ZV0 C;  4BU4 A;  3PCR A;  2F5W A;  2ML5 A;  3PGB A;  2BNG A;  1IVW A;  4K90 B;  1CYU A;  1NB3 I;  2C10 A;  3D3L A;  3L0R A;  2RCD A;  2B24 B;  3LML A;  4IT7 A;  8RNT A;  3CCU 3;  3CCL 3;  2KAA A;  3V92 A;  1GY5 A;  1TU5 A;  4XBX A;  4CI1 B;  3NUV A;  1T3B A;  5BU4 A;  3FKA A;  3I55 3;  2LYX A;  3NV0 A;  1RGG A;  3KE7 A;  3PCS A;  4LEH A;  5AEW B;  1W6C A;  4EC6 A;  3NXJ A;  4CJN A;  2CC3 A;  4MMZ B;  1MWR A;  3EX9 A;  4HM5 B;  2CFG A;  3F9S A;  3KKG A;  2MC8 A;  3G6E 3;  1OAC A;  1SIH A;  2PZV A;  3D79 A;  1QVF 2;  1QAL A;  5IER A;  2H0I A;  4LMI A;  2C4B A;  1B27 A;  2ZL8 A;  1W6G A;  1JZO A;  3S29 A;  4BTW A;  3EBT A;  3DZL A;  2BMO B;  2Y74 A;  3T8U A;  2P0X A;  1A2V A;  2K0M A;  1QMA A;  2XR8 B;  4KT3 B;  1WNH A;  4N6M A;  1Q42 A;  3FCS B;  3MSO A;  3BNE A;  1M1K 4;  7RNT A;  5AYR B;  3BB9 A;  1N9J A;  1B2Z A;  1W5Z A;  1WTH A;  1X1W A;  1BNI A;  3TDG A;  2ZA4 A;  3WA3 A;  4MJD A;  1YGE A;  1R3E A;  1DMQ A;  1V57 A;  4MMY B;  2QA4 3;  4KFE A;  1XNE A;  5KP4 A;  3B4O A;  1D6Z A;  4N3V A;  4BL3 A;  4XBT A;  1BSD A;  4N6V 0;  1V74 A;  4GL6 A;  3CC2 3;  1I2E A;  1FGQ A;  2J8X B;  3LT8 A;  1KD1 4;  1KC8 4;  1GMR A;  1I2G A;  3KZT A;  3CCQ 3;  2HMN B;  5KP1 A;  4CI2 B;  4FCM A;  4H61 A;  2OQE C;  1BRI A;  1NU3 A;  5EQL A;  3FSD A;  3X42 A;  2CHC A;  2KRT A;  1OHS A;  1R3F A;  1IDP A;  2GBX B;  3PZW A;  5CK6 A;  1A2K A;  8CHO A;  1OF5 B;  5G1L A;  2HOH A;  3DGY A;  4AKZ A;  1EA2 A;  4Q1T A;  2RGQ A;  2STD A;  5D82 A;  1HYF A;  2IA7 A;  3URP A;  1O7N B;  1MNL A;  1RLS A;  2OOV C;  2RBI A;  2H0G A;  2L4V A;  2W56 B;  3U1W A;  1BUJ A;  1MOL A;  3PS8 A;  1RDS A;  2P09 A;  3MG3 A;  2ZDJ A;  1LQM B;  1E3R A;  3LWR A;  1PFP A;  2Z76 A;  5IG4 A;  1JZD A;  1RRL A;  2CWV A;  1VQ4 3;  4L8P A;  5ELJ A;  3SED A;  2PNC A;  1W02 A;  3DGO A;  1RGL A;  1LOY A;  3KII A;  3STD A;  1VQM 3;  4FMC A;  2IUK A;  3O8Y A;  1IQX A;  3NQY A;  5STD A;  3BLZ A;  1STF I;  1IQY A;  3N54 B;  2KF3 A;  4O2H A;  3UNL A;  4LSO A;  3FZW A;  1B2M A;  4RZM A;  1Z1S A;  5D83 A;  2Z0T A;  2F86 B;  1PYL A;  1AQZ A;  3CCV 3;  1AVL A;  1LVN A;  3EC9 A;  1BNE A;  4GSP A;  4O3V A;  5EVH A;  1RGA A;  4N6L A;  3IPT A;  1ASK A;  3EN8 A;  1ULI B;  1WXX A;  1GOU A;  1NDO B;  3CMA 3;  5IEO A;  1RGC A;  2CFD A;  5D81 A;  1UCL A;  1FGT A;  4WWU C;  4H3U A;  3CPO A;  3VSY A;  4OUQ A;  1ULJ B;  2KCD A;  1LNI A;  1BNG A;  3GRD A;  4K1V A;  1TTO A;  2GEX A;  3N9H A;  2OTL 3;  4JRF A;  3B7C A;  1IT7 A;  2E5O A;  3HIG A;  3CCJ 3;  3G0K A;  3MG1 A;  5AIH A;  1IV7 A;  3UJM A;  1G0T A;  4J9A A;  4CPK A;  1Q7H A;  1K41 A;  1FZU A;  1VQN 3;  2Z6B A;  1VQ8 3;  2FRX A;  3GZX B;  1ZL3 A;  3D9R A;  1JN5 A;  2GBW B;  4TZ4 C;  4EBG A;  2GU1 A;  4WP5 A;  3IJE B;  3ER7 A;  1W2Z A;  1RHL A;  2KF5 A;  5AYS C;  2F4Y A;  3D4A A;  1UI7 A;  3DGL A;  3EE1 A;  4PEJ A;  3M6W A;  2HML B;  3WR2 A;  3F40 A;  2H0H A;  3SLU A;  1RKY A;  3AGO A;  1EKM A;  2R4I A;  1MWU A;  4WYK B;  1AY7 A;  5AII A;  3B8L A;  1Q86 4;  4XB5 A;  3N8B A;  4ZM8 A;  1BVI A;  3LDF A;  2OWP A;  1EUI C;  2R41 A;  1RGF A;  3FG4 A;  1I2F A;  2OQE A;  1OHO A;  1GOY A;  1UUW B;  3VF1 A;  3HX8 A;  1MGR A;  5FGO A;  1OH0 A;  2CKF B;  2MF7 A;  1W7C A;  4HZ9 B;  6GSP A;  3UAI A;  4CDL A;  1VQ9 3;  1N5P A;  1TUH A;  1YVS A;  3CCS 3;  1VQ6 3;  1A90 A;  4HAA A;  1I8V A;  4HM2 B;  3LOY A;  2OOV A;  3ZFZ A;  3RGR A;  5CLK A;  1FA3 A;  3GZB A;  1F8N A;  5BIR A;  3NQZ A;  1M1X B;  1YVB I;  2UX0 A;  5HOH A;  2DP9 A;  2B1X B;  4Q53 A;  1RGH A;  1IV9 A;  1JKG B;  1OPY A;  3U97 A;  1RN7 A;  3LH4 A;  1GSP A;  2CW9 A;  3I56 3;  4HVN A;  1K28 A;  5IG5 A;  1YI2 3;  4O8S A;  1TE7 A;  2WOF A;  5ELU A;  3CC4 3;  1GMP A;  4R1K A;  1OUN A;  2XFT A;  5CXO A;  3JUN A;  2KF4 A;  3LZA A;  1ZX2 A;  3OXA A;  3OWU A;  3QK9 A;  1BNS A;  1JJ2 2;  1YJ9 3;  1E3V A;  1VQK 3;  1SQW A;  1BSB A;  2CWU A;  1GMQ A;  5AEU B;  3AHW A;  1Q40 B;  1TRP A;  1V58 A;  2BT3 A;  5IEP A;  3CCE 3;  2W9P A;  1UOY A;  1JNQ A;  1I70 A;  4I5Q A;  3ZG0 A;  2EY4 A;  3Q90 A;  1DMM A;  3MWZ A;  3CME 3;  3JUP A;  1UUV B;  2W03 A;  3M6U A;  1BGS A;  3LYG A;  4N6N B;  3M6V A;  1X1X A;  3MHE A;  4HM0 B;  5AI1 A;  2XEP A;  1D6U A;  2ANE A;  2I9W A;  1RTU A;  2BHM A;  3G16 A;  1EQK A;  2K3D A;  3DGN A;  4LZI A;  1SPU A;  4KFD A;  3DXO A;  1IVV A;  3NV0 B;  4HJL B;  3WMD A;  1NJI 4;  2RFR A;  2CWT A;  7STD A;  3FGY A;  1M90 4;  5IW9 A;  1YJW 3;  1E97 A;  3EQQ B;  1R4C A;  1A2P A;  1TJD A;  2ML6 A;  3BIR A;  4J5G A;  1RGE A;  2J5V A;  1LOV A;  3H51 A;  1UCI A;  1SJW A;  1TRQ A;  2GSP A;  3M4X A;  3HOH A;  5IF6 A;  1QAK A;  7GSP A;  1TIJ A;  1OF5 A;  1KSI A;  3LTC A;  3HAX A;  4U13 A;  1T2I A;  2FXT A;  3K5T A;  1BIR A;  1AV4 A;  3ECF A;  1GS3 A;  1RJO A;  1S5A A;  2P0M A;  1VQ7 3;  4LYL B;  1BRG A;  1A67 A;  3SVA A;  3BU4 A;  3WOE B;  5TGN A;  2YFI B;  2OTJ 3;  2IY2 A;  2JDI H;  2AUS A;  2O3O A;  4J8T A;  1BRN L;  5M18 A;  2KKU A;  5M19 A;  4NRE A;  1M9G A;  3EF8 A;  2FGT A;  2KF6 A;  3CPW 2;  1W2B 2;  2P05 A;  1Q7Y 4;  3MQK A;  3M8C A;  1QJG A;  2UGI A;  1NB5 I;  2UUG C;  4K1U A;  3OWY A;  3CD6 3;  3KCH A;  3VSE A;  1DYU A;  1PY3 A;  3G71 3;  5LC6 A;  5IG3 A;  4J5K A;  1VQ5 3;  2WGQ A;  3WOD G;  1ZS7 A;  3LWP A;  1ZO2 A;  2C11 A;  2FNQ A;  1B2S A;  3M6X A;  4HYZ A;  1GD4 A;  4KVH A;  3T8N A;  1STD A;  2GXF A;  3CNX A;  1JB5 A;  1B2X A;  1FGO A;  1SII A;  2JQ5 A;  3RGA A;  5RNT A;  2W6J H;  3NHX A;  3WA2 X;  1JV2 B;  3NM2 A;  5DRE A;  2CFW A;  3ROB A;  1CQS A;  2GEY A;  3NBJ A;  1FW7 A;  1K8A 4;  2QIY A;  1TFO A;  1RRH A;  2SAR A;  1BOX A;  2A15 A;  1O7W B;  2KXG A;  1NO3 A;  1D6Y A;  1US1 A;  2AAE A;  2LQV A;  1JB2 A;  2M7O A;  2XGL A;  4KFF A;  4R9K A;  5KP3 A;  4HKV B;  1CEW I;  3BNC A;  4EV5 A;  1VQP 3;  5FW5 A;  1R4Y A;  1ZE1 A;  4MMX B;  1GOV A;  3CCM 3;  1HU9 A;  2BMQ B;  1SGV A;  3GZY B;  2AB4 A;  2YFJ B;  3LJC A;  3GSP A;  3AMO A;  4O02 B;  5GSP A;  4QWT A;  1O7H B;  1N8Q A;  3A76 A;  1OGZ A;  3D5I A;  2HVY A;  1DMN A;  5EEO A;  5BXQ A;  6RNT A;  1W01 A;  3JVC A;  1DET A;  2XSO B;  3CNM A;  4STD A;  3X40 A;  4WYK A;  1CH0 A;  2XF3 A;  1VQL 3;  3S28 A;  1OCV A;  1KWI A;  1X1U A;  3OV4 A;  4BTY A;  4L8O A;  1BNJ A;  2CX0 A;  1LQG C;  1W4N A;  2BMR B;  4CCV A;  5IEN A;  1VZZ A;  3V99 A;  5JBS A;  3EN1 B;  2OCT A;  3D5G A;  3UB1 A;  4R9L A;  3K63 A;  1IVX A;  1W6Y A;  4CI3 B;  1LNH A;  3KN4 A;  3LXU X;  3LWV A;  3OX9 A;  4L7K A;  3SYU A;  4EW5 A;  4IIA A;  3NBR A;  3Q1C A;  3OW2 2;  4DKI A;  2RFK A;  3IUW A;  4I4K A;  4NHF A;  3JUQ A;  2Z77 A;  5G1K A;  1RSN A;  3T0U A;  1ISK A;  3F14 A;  5HGR A;  4BTX A;  1IT8 A;  1BNF A;  3ALA A;  4HM4 B;  3FH1 A;  4XBY A;  2W2C A;  1L5G B;  4WFO A;  3LT9 A;  3VGN A;  3V98 A;  3K9M C;  5I97 A;  2L1S A;  1ZE2 A;  2CFK A;  1ROA A;  3BND A;  2ZHX B;  2HMK B;  4HM1 B;  6STD A;  1EEJ A;  4XDW A;  2P38 A;  1UGI A;  3EHC A;  1O7P B;  1HKX A;  1Q9E A;  3F8X A;  4RBN A;  4NPB A;  2D1W A;  1UUG B;  2CFL A;  2WOH A;  3IMA B;  1C7H A;  3KFQ C;  1NNV A;  3LTB A;  3FLJ A;  4FR9 A;  3K0Z A;  3LTA A;  1LXE A;  3DM8 A;  1BSA A;  1U5O A;  3MKI A;  1RMS A;  3RNT A;  1WK2 A;  3EJV A;  3WHO A;  2CK3 H;  2XFS A;  4FMB A;  2IMJ A;  3Q3F A;  4HOH A;  1OGX A;  1YIT 3;  1FGM A;  1GYB A;  2XSH B;  5IG0 A;  3B4P A;  1WMO A;  3MG2 A;  5DRV A;  1Q82 4;  4R4K A;  3U28 A;  1RCL A;  2BU4 A;  1UW1 A;  4OK0 A;  2APO A;  1RNT A;  3GWR A;  4HM8 B;  2AAD A;  1TFK A;  4EV2 A;  5JPP A;  4K61 A;  2QGU A;  3X41 A;  1I0V A;  4OVM A;  1O7G B;  2F99 A;  2BO9 B;  1BAO A;  1GY7 A;  1G96 A;  1SAR A;  4EXR A;  1I3I A;  2SBL A;  3FG1 A;  1RN1 A;  3C0K A;  1JBT A;  4HM7 B;  3SX1 A;  1JB4 A;  4DMG A;  5A0O B;  1T5Y A;  1IQ8 A;  1ZBO A;  1FUT A;  1B20 A;  4XM4 A;  1YNV X;  1QAF A;  3JUO A;  2W9Q A;  4X2O A;  3FG3 A;  3A5E A;  9RNT A;  2CG1 A;  2CX1 A;  1B21 A;  1IK3 A;  1DE3 A;  1N8R 4;  4N6O B;  1GD3 A;  2RSX A;  4FMD A;  4JF8 A;  1W00 A;  1RNB A;  2W56 A;  2E2V A;  3WOF B;  1BSE A;  1KQS 2;  2Z7A A;  4N6U A;  3EB8 A;  1MGW A;  2AS0 A;  1B2U A;  2HMM B;  2O9U X;  2YX9 A;  3ZG5 A;  2WO0 A;  1AR0 A;  5AIG A;  3KSP A;  1J2B A;  2E2U A;  2HMO B;  3EBY A;  3HJW A;  2BIR A;  3HZP A;  1YJN 3;  2D42 A;  3BNB A;  2IYJ A;  1FUS A;  4AKY A;  3I0Y A;  1AVK A;  3F7X A;  2F56 A;  1UGH I;  5M1A A;  3AHS A;  2Y73 A;  3OWS A;  4GHO A;  3J7Y d;  4AEQ A;  3AGN A;  3CXC 2;  3CCR 3;  2XH9 A;  1S04 A;  3DH2 A;  1N9E A;  4KZ1 A;  3H3H A;  3NBB A;  1UI8 A;  1S72 3;  1LRA A;  3SOY A;  1BAN A;  3F8H A;  2QEX 3;  1ROV A;  1FYS A;  1DVC A;  3G4S 3;  1K9M 4;  3PYJ A;  5LC7 A;  4WHA A;  1MWT A;  2HMJ B;  3MPH A;  1WQL B;  1K8W A;  3HK4 A;  3FF2 A;  4R80 A;  1YGW A;  3GZR A;  3SOA A;  4ORL A;  1VQQ A;  3UL5 A;  2F98 A;  3E99 A;  4BIR A;  1RGK A;  1RN4 A;  5CF2 A;  1TP6 A;  4G1M B;  1GY6 A;  2WGO A;  1Y4K A;  5AIF A;  1FGR A;  1C54 A;  3S5C A;  1HZ1 A;  3JUM A;  1RCK A;  1T2H A;  1I0X A;  1BRS A;  1JRQ A;  3HJY A;  2RNT A;  3HII A;  3NM7 A;  5BVB A;  3X3X A;  3LWQ A;  4MEI A;  4EYC A;  1U8C B;  1G02 A;  4GB5 A;  3KSE D;  3MYT A;  3X3Z A;  3CU3 A;  3X3Y A;  1YIJ 3;  1QVG 2;  3Q2P A;  2IUJ A;  4HM6 B;  2K54 A;  2XGN A;  3LTD A;  1BRH A;  3QRD A;  1FUW A;  3WDG B;  1Q81 4;  1BSC A;  1IVU A;  4TX4 A;  4HM3 B;  1NWW A;  3NX0 A;  1BUQ A;  3PXM A;  3LWO A;  4HBR A;  1I3F A;  2CWW A;  1B3S A;  2CIU A;  1K73 4;  1LOX A;  2Q07 A;  5JPU A;  1IU7 A;  1BNR A;  2W04 A;  1WXW A;  3HI7 A; 
#chains in the Genus database with same CATH homology
 1Q7H A;  1SGV A;  4DMG A;  2AB4 A;  1T5Y A;  1IQ8 A;  1R3F A;  1ZL3 A;  1ZS7 A;  3VSE A;  2J5T A;  2CX1 A;  2B78 A;  4Q1T A;  1IT8 A;  1WXX A;  1ZE2 A;  1R3E A;  2AS0 A;  2P38 A;  2CX0 A;  3LDF A;  1K8W A;  3D79 A;  1J2B A;  1SQW A;  2J5V A;  2CWW A;  2Q07 A;  1IT7 A;  1ZE1 A;  3UAI A;  1WXW A;  3C0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...