1SQWA

Crystal structure of kd93, a novel protein expressed in the human pro
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
176
structure length
176
Chain Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Saccharomyces cerevisiae Nip7p homolog
publication title Crystal structure of KD93, a novel protein expressed in human hematopoietic stem/progenitor cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 53
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03657 UPF0113 UPF0113 PUA domain
A PF17833 UPF0113_N UPF0113 Pre-PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1sqwA02
3.10.450.220 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1sqwA01
1T5YA 1WXXA 1K8WA 2J5VA 2AB4A 1R3EA 2J5TA 2AS0A 2CX0A 2CWWA 1IT7A 1WXWA 2P38A 1J2BA 3LDFA 4DMGA 3D79A 1ZE1A 2B78A 1Q7HA 1IT8A 1IQ8A 1SGVA 2CX1A 2Q07A 3C0KA 3UAIA 3VSEA 1ZE2A 1ZL3A 4Q1TA 1R3FA 1SQWA 1ZS7A
chains in the Genus database with same CATH superfamily
2ZA4A 1M9GA 3BLZA 3LTBA 5BVBA 2IUKA 3KN4A 1GS3A 3FGYA 3FG1A 2J5VA 4WWUC 2XGNA 5IG3A 2ZHXB 1TU5A 2F5WA 2CHCA 4HOHA 2B1XB 3HIIA 2KAAA 4JRFA 6STDA 3CCU3 2GBWB 3LDFA 3UL6A 3ALAA 1U8CB 1AY7A 1E3VA 3ECFA 4MMZB 1B20A 1VQO3 4HM5B 4KFEA 4WFOA 2GU1A 3B4PA 4KVHA 4WYKB 1SGVA 3M6XA 2ML5A 3U97A 3DGYA 1ULIB 3NXJA 3U28A 1OCVA 2IY2A 2XGLA 3EF8A 3S28A 1FYSA 2F5MA 3N9HA 3CCJ3 4KFFA 3WMDA 3NUVA 1ZGXA 4HKVB 3X40A 3F8HA 5HGRA 2CFKA 3S67A 1QVG2 3PGBA 3HI7A 2E2VA 1I2FA 1WQLB 1VQ83 1JB2A 2W0QA 3PZWA 1GD3A 1GMRA 3K63A 1SIIA 2P0XA 4J8TA 1IT7A 3S27A 4PEJA 3S5CA 1O7MB 2KF3A 3X41A 3H3HA 5D82A 5BXQA 1I70A 1MWSA 2AUSA 3GZYB 3VGNA 3JUMA 1M1K4 3C0KA 7RNTA 3DM8A 2WGQA 1I0XA 5G1KA 3V99A 1YJW3 1I3FA 1YGEA 5CXOA 3X3YA 3CPOA 1JRQA 2E5OA 1FUSA 1MGWA 3B8LA 3GSPA 1FUWA 1BRGA 1IVXA 1GOYA 1ZS7A 2LYXA 1W01A 1RDSA 2CWVA 3Q3FA 1G02A 2XFSA 2BMQB 1BRNL 1MWUA 1T5YA 2W56B 1K9M4 3RNTA 4QWTA 1R3EA 3URPA 5IG4A 3G713 1X1WA 2GEYA 3MYTA 2F86B 1ZBOA 1MWTA 3CU3A 3T8UA 4WYKA 1CEWI 4BU4A 1BNRA 1IQYA 3CCL3 1UCLA 1I0VA 1HKXA 4MMXB 1CYUA 3DGOA 1CQSA 1W2B2 1QMAA 4HM2B 1RGKA 1SARA 5DRVA 5I97A 2OTJ3 3CC73 2CW9A 1AVLA 1RTUA 3CCR3 2WOHA 1ISKA 5M1AA 3NQZA 3I563 5KP4A 1VQ73 2ML6A 1UI8A 3MQKA 2KKUA 5JBSA 4H3UA 1RRHA 3NBJA 1MGRA 1GD4A 2HMMB 4XBYA 3UNLA 2FXTA 4EC6A 1W5ZA 3OV4A 1I2GA 3LXUX 1YGWA 1VQK3 3LWQA 3HJYA 3IPTA 3QK9A 5DREA 3F8XA 1YI23 4FMAA 3UB1A 1Q814 2BMOB 5IF6A 3D9RA 3OXAA 3X42A 3IMAB 1VQL3 1RGCA 4XB5A 3GZRA 3F14A 3X3XA 1JBTA 1JJ22 2CFGA 3MSOA 1TP6A 1AVKA 2JDIH 3QRDA 5CF1A 9RNTA 1F8NA 3DGNA 3I0YA 3SX1A 1ZE2A 1B2UA 4FMCA 4CJNA 3CD63 1FW7A 1KC84 3KE7A 1N9EA 4HM7B 4O8SA 4RNYA 3FF0A 3EB8A 1STDA 1UUGB 2W56A 1VQQA 4TZ4C 3Q90A 2YX9A 4DKIA 1IVWA 1N5HA 1NO3A 1B3SA 2GU3A 3HOHA 3S29A 3D3LA 4HM0B 1OACA 4N6LA 5ELJA 4BTXA 4Q53A 5ELUA 1CYVA 4L8OA 4ILFA 5M18A 1BSCA 4FMBA 1RGHA 3FH1A 1W00A 4J5KA 5AEUB 2H0HA 1VQ53 1JB5A 8RNTA 5LC7A 3AMOA 1BIRA 4FCZA 1B27A 3KZTA 3EC9A 5CF2A 5KP1A 3FG3A 2UGIA 3VSEA 1PFPA 1TFKA 3F9SA 3MG3A 2WO0A 1Q864 2KF4A 1A67A 1K41A 5IEPA 3LOYA 1BNSA 4HM4B 1FZUA 2MC8A 1UGHI 2FNQA 4O2HA 4R1KA 4EBGA 2EY4A 1IVUA 1VQ93 2CFWA 2CG0A 1A2VA 1W6YA 3AGOA 3G8ZA 3EBYA 1BSAA 1BANA 1WNHA 1UCJA 2KF6A 3PCSA 4LSOA 3GRDA 2XSOB 3EN8A 5D83A 2QEX3 1I3IA 2AADA 2OCTA 1BNFA 5EEOA 1ROVA 3KSPA 3CNXA 3NM2A 3FG4A 3NX0A 1EG9B 2XF3A 1WTHA 3DH2A 1LQGC 5AIFA 2SARA 2W9PA 4NPBA 5AIIA 1DMMA 2SBLA 1KQS2 3D79A 1O7GB 4I4KA 1Z1SA 3ZG0A 1QAKA 3M6WA 1AR0A 3BB9A 5EVHA 1N8R4 1JBSA 6RNTA 1LRAA 1UUWB 4LEHA 5KP3A 1JZDA 5AEWB 3UJMA 1HU9A 4HAAA 4K61A 1RN7A 3M8CA 5IG0A 1Q42A 4MMYB 5AYRB 1R4YA 4WHAA 5LC6A 1YHQ3 1L5GB 1W2ZA 5BU4A 3BNBA 3Q2PA 1OF5A 1XNEA 2HMLB 2Z6BA 3DY5A 4NHFA 3WOEB 4BTYA 1LOWA 3DMCA 4CDLA 4G1MB 4R9LA 3CC43 1FGQA 1YVBI 4N6OB 1BUJA 2HMKB 2AS0A 4STDA 1OGXA 1BUQA 1W6CA 1RN4A 1V57A 2P05A 3G16A 1WXWA 3MG2A 1QVF2 3N54B 3KFQC 1LOYA 4GSPA 2QGUA 4XBTA 4BTWA 3VF1A 2O3OA 2KRTA 1LQMB 2F98A 1O7WB 1LOXA 2V1LA 4N6UA 2XSHB 3BU4A 3HAXA 3HK4A 2PZVA 1C7HA 1GOUA 2RNTA 7GSPA 3G6E3 4KZ1A 4FR9A 3K0ZA 5IEOA 1RMSA 2GXFA 1QALA 1BRIA 2XR8B 2CFDA 1VQM3 5STDA 2R41A 3FLJA 4RZMA 3CCE3 1ASKA 3B4OA 3OWYA 2P09A 5JPPA 1RKYA 1Q7Y4 1VQ63 3STDA 1BRHA 3LZAA 3LYGA 2E2UA 1DETA 3J7Yd 3M6VA 1GSPA 2GSPA 4HZ9B 1BNGA 1SIHA 3CCM3 1K8A4 3MPHA 4O02B 1N8QA 2I9WA 2B78A 1YJ93 2CWUA 1STFI 2IMJA 2HOHA 3D4AA 3NHXA 1DMQA 3AMOB 4HVNA 3FSDA 1OHOA 5CK6A 1NNVA 1R3FA 1OH0A 1RGAA 3T0UA 1WMNA 1DMNA 1Q824 3WDGB 1AV4A 1GYBA 2DP9A 1O7NB 3ER7A 3HZPA 2OTL3 1BAOA 3PS8A 1RNBA 2LQVA 3D5IA 3DZLA 1RNTA 2OOVA 4IT7A 2AB4A 1QAFA 1OUNA 3TDGA 3E99A 2FRXA 1NJI4 1LNHA 3ZFZA 1VQP3 1BRKA 5G2GA 2OWPA 1LOVA 4ORLA 1BNJA 2IA7A 1JBRA 1EKMA 1PU4A 3ZG5A 3GZXB 1CH0A 4R80A 3VSYA 4OUQA 1S5AA 1IQ8A 1V58A 1W02A 3V92A 3PCRA 3AHWA 2JQ5A 5M19A 3WA3A 2BO9B 1Q9EA 1BVIA 5IENA 2W9QA 1JKGA 4X2OA 2Z76A 1M1XB 4MEIA 3LWPA 1JV2B 1O7HB 1JB4A 1T3BA 2OOVC 3G4S3 1IV9A 1S723 4CI2B 3SYUA 2HMJB 3K9MC 1BNEA 3AGNA 2M7OA 3RGRA 2QIYA 5IERA 5RNTA 3SLUA 3M65A 4R9KA 1B2SA 3EJVA 1R4CA 4CI1B 1V74A 4FMDA 1BNIA 2YFIB 2CWWA 3MWZA 1OF5B 1RCKA 5G1LA 1EEJA 2K0MA 4DMGA 3NM7A 1UOYA 1RGFA 4N6V0 1KD14 2BU4A 1IDPA 2CX1A 1ZX2A 1RRLA 3UAIA 2A15A 3LT8A 3EN1B 1ZL3A 4LZIA 5IG5A 6GSPA 1SQWA 1E3RA 3CC23 1TTOA 4KFDA 1B21A 1DVCA 4HZBB 2BT3A 1W6GA 2E2TA 4FCJA 1TRQA 1RCLA 1RSNA 3NV0B 1EQKA 1X1UA 5AIGA 1RJOA 1TIJA 2O9UX 3DGMA 3T8NA 1Q40A 4EV2A 2J5TA 3LTCA 1E97A 1I2EA 1FGTA 4EYCA 1BSBA 5D81A 3G0KA 3NBRA 1TE7A 1RGGA 2APOA 2KCDA 1D6YA 1GMQA 3U1WA 3WOFB 3CMA3 4HYZA 4RBNA 2F56A 3EX9A 3BIRA 3M4XA 2RCDA 2Z0TA 2UUGC 1UCKA 1LXEA 1SPUA 2KF5A 1OGZA 3CNMA 3MG1A 4IPBA 1JN5B 1O7PB 4NREA 3CXC2 3OWSA 4XM4A 3BNCA 1U5OA 1RN1A 1TFOA 1W7CA 1I8VA 2J8XB 4HM3B 3KKGA 5AIHA 1JNQA 2Y74A 3DXOA 4J9AA 2CFLA 2B24B 3SXXA 4EW5A 3SOYA 2BIRA 1T2IA 3SVAA 2CWTA 1GY5A 1LNIA 1QJGA 2D42A 2HMNB 3JVCA 3K5TA 3L0RA 1ROAA 3LT9A 4RNTA 1X1YA 4O3VA 2HVYA 2CG1A 3HIGA 2RBIA 3GAXA 2GBXB 3PXMA 1IK3A 3FKAA 1J2BA 3N8BA 2PNCA 4WP5A 3WA2X 4BIRA 2W6JH 3MHEA 1HYFA 3NBBA 5A0OB 3AHSA 3NQYA 2RSXA 1Q7HA 2ANEA 1GY6A 2ZDJA 4XDVA 1RGLA 2KXGA 3DUKA 3BNDA 1Y4KA 4GB5A 1D6ZA 1G96A 1W4NA 3OW22 1K734 1M904 3WR2A 4BL2A 1T2HA 3NV0A 4R4KA 1IQXA 1GY7A 2CIUA 1BRJA 1WK2A 3V98A 3WODG 4LMIA 3LWRA 2D1WA 1A2PA 1VZZA 3LMLA 4AEQA 1IYYA 1BGSA 4GL6A 1JKGB 1WXXA 4L8PA 1YNVX 3LWOA 3CCV3 4JF8A 4CPKA 1FA3A 5HOHA 2C4BA 5AYSC 3D5GA 4OVMA 3SOAA 4EXRA 1WMOA 1FUTA 3O8YA 4HJLB 4N6TA 5EQLA 1JN5A 1B2XA 2W04A 3MKIA 2ZL8A 3OWUA 1UGIA 1FGMA 1ZE1A 2C11A 1GOVA 4N6MA 1YJN3 1NB5I 3LH4A 1DE3A 1YIT3 4N6NB 2H0IA 2P0MA 3F40A 4TX4A 4KT3B 4Q1TA 1ZO2A 3UL5A 1US1A 1NDOB 3ZV0C 1DYUA 2CKFB 2HMOB 1MOLA 1OHPA 3CME3 2XRXB 1IV7A 1SJWA 3DGLA 3EE1A 1N5PA 4MJDA 4RNZA 1ULJB 1OPYA 1KWIA 4LYLB 3FF2A 4OK0A 1K8WA 3LJCA 3M6UA 2XEPA 1G0TA 1BU4A 1NWWA 4XBXA 3LTAA 2CX0A 5CLKA 4K90B 2RGQA 4K1UA 4N3VA 1KSIA 3JUPA 3FZWA 1GMPA 1S04A 2Y73A 1Q40B 4U13A 3LTDA 2IYJA 3JUQA 4LGQA 7STDA 1IT8A 3A76A 3RGAA 1AQZA 1NU3A 2MF7A 3EBTA 5TGNA 1DVDA 1VQN3 5AI1A 1X1XA 4GHOA 2BHMA 2F4YA 4IIAA 1BRSA 2CH9A 4ZM8A 2AAEA 1N9JA 1TUHA 2R4IA 4H61A 3ROBA 2QA43 1A2KA 1IU7A 3IUWA 2C10A 2H0GA 3K7CA 4HM1B 5BIRA 1K28A 4XDWA 4HM6B 1YIJ3 2XFTA 3FCSB 4L7KA 1BSEA 1UI7A 5IW9A 2P38A 1WMPA 1NB3I 4X2HA 3RDEA 2W03A 2K54A 5JPUA 2WGOA 4K1VA 2L4VA 3F7XA 3WHOA 3OX9A 4CCVA 1UDII 2Q07A 3KIIA 2YFLB 1RLSA 1A90A 2GEXA 3JUNA 3GWRA 4HBRA 1FGRA 4J5GA 2Z77A 5GSPA 3I553 3CCS3 1BSDA 2YFJB 1PYLA 3F7SA 1B2ZA 8CHOA 3LWVA 3IJEB 1OHSA 5FW5A 1D6UA 4AKZA 2OQEA 2RFRA 3EHCA 3KSED 1UW1A 3SEDA 1IVVA 3KCHA 1MWRA 2W2CA 2CK3H 1VQ43 2BMRB 4I5QA 2K3DA 3H51A 4BL3A 1LVNA 2FGTA 1FGOA 1YVSA 1UUVB 3HX8A 3JUOA 3PYJA 3B7CA 4HM8B 1EUIC 1BOXA 3Q1CA 3HJWA 3CCQ3 3X3ZA 1B2MA 4FCMA 1RGEA 3A5EA 1JZOA 2Z7AA 3GZBA 1UCIA 2UX0A 1HZ1A 2RFKA 3CPW2 2F99A 2L1SA 2BNGA 3EQQB 1EA2A 4EV5A 1MNLA 1TRPA 5FGOA 2IUJA 1TJDA 2STDA 2INXA 4AKYA 2OQEC 1RHLA 3BNEA 4CI3B 2WOFA 1C54A 2CC3A 2XH9A 1PY3A
chains in the Genus database with same CATH topology
3BLZA 1M9GA 3LTBA 5BVBA 2IUKA 3KN4A 1GS3A 3FGYA 3FG1A 2J5VA 4WWUC 2XGNA 5IG3A 1TU5A 2CHCA 2B1XB 3HIIA 4JRFA 6STDA 3CCU3 2GBWB 3LDFA 3UL6A 3ALAA 1U8CB 1E3VA 4MMZB 3ECFA 1VQO3 4HM5B 4KFEA 4WFOA 2GU1A 3B4PA 4KVHA 4WYKB 1SGVA 2ML5A 3U97A 1ULIB 3NXJA 1OCVA 2XGLA 3EF8A 3S28A 3N9HA 3CCJ3 4KFFA 3WMDA 3NUVA 4HKVB 3X40A 3F8HA 5HGRA 2CFKA 3S67A 1QVG2 3PGBA 3HI7A 2E2VA 1WQLB 1VQ83 1JB2A 2W0QA 3PZWA 1GD3A 3K63A 3S27A 1SIIA 2P0XA 4J8TA 1IT7A 4PEJA 3S5CA 1O7MB 3X41A 3H3HA 5D82A 5BXQA 3GZYB 3VGNA 3JUMA 1M1K4 3C0KA 3DM8A 2WGQA 1YJW3 3V99A 1YGEA 5CXOA 3X3YA 3CPOA 1JRQA 3B8LA 1FUWA 1IVXA 1ZS7A 2LYXA 1W01A 2CWVA 2XFSA 2BMQB 1T5YA 2W56B 1K9M4 4QWTA 1R3EA 5IG4A 3G713 2GEYA 3MYTA 2F86B 3CU3A 3T8UA 4WYKA 1CEWI 1IQYA 3CCL3 1HKXA 4MMXB 1CYUA 3DGOA 1CQSA 1W2B2 1QMAA 4HM2B 5DRVA 5I97A 2OTJ3 3CC73 2CW9A 1AVLA 3CCR3 2WOHA 1ISKA 3NQZA 3I563 5KP4A 1VQ73 2ML6A 1UI8A 5JBSA 4H3UA 1RRHA 3NBJA 4XBYA 1GD4A 2HMMB 3UNLA 2FXTA 4EC6A 1W5ZA 3OV4A 3LXUX 1VQK3 3QK9A 3IPTA 5DREA 3F8XA 1YI23 4FMAA 3UB1A 1Q814 2BMOB 5IF6A 3D9RA 3OXAA 3X42A 3IMAB 1VQL3 4XB5A 3GZRA 3F14A 3X3XA 1JJ22 2CFGA 3MSOA 1TP6A 1AVKA 2JDIH 3QRDA 5CF1A 1VQ93 1F8NA 3DGNA 3I0YA 3SX1A 1ZE2A 4FMCA 3CD63 1KC84 3KE7A 1N9EA 4HM7B 4O8SA 4RNYA 3FF0A 3EB8A 1STDA 2W56A 3Q90A 2YX9A 1IVWA 2GU3A 1N5HA 1NO3A 3S29A 3D3LA 4HM0B 1OACA 4N6LA 5ELJA 4BTXA 4Q53A 5ELUA 1CYVA 4L8OA 4FMBA 3FH1A 1W00A 5AEUB 1VQ53 1JB5A 5LC7A 3AMOA 4FCZA 3KZTA 3EC9A 5CF2A 5KP1A 3FG3A 3VSEA 1PFPA 1TFKA 3F9SA 3MG3A 2WO0A 1Q864 1A67A 1K41A 5IEPA 3LOYA 4HM4B 2MC8A 2FNQA 4O2HA 4R1KA 4EBGA 1IVUA 2CFWA 2CG0A 1A2VA 1W6YA 3G8ZA 3EBYA 1WNHA 3PCSA 4LSOA 3GRDA 2XSOB 3EN8A 5D83A 2QEX3 2OCTA 5EEOA 1ROVA 3KSPA 3CNXA 3NM2A 3FG4A 3NX0A 1EG9B 2XF3A 1WTHA 5AIFA 2W9PA 5AIIA 1DMMA 2SBLA 1KQS2 3D79A 1O7GB 4I4KA 1Z1SA 1QAKA 1AR0A 3BB9A 5EVHA 1N8R4 4LEHA 1UUWB 5KP3A 5AEWB 3UJMA 1HU9A 4K61A 1RN7A 3M8CA 5IG0A 1Q42A 4MMYB 5AYRB 4WHAA 5LC6A 1YHQ3 1L5GB 1W2ZA 3BNBA 3Q2PA 1OF5A 2HMLB 2Z6BA 3DY5A 4NHFA 3WOEB 4CDLA 4BTYA 3DMCA 4G1MB 4R9LA 3CC43 1FGQA 1YVBI 4N6OB 2HMKB 2AS0A 4STDA 1OGXA 1BUQA 1W6CA 2P05A 3G16A 1WXWA 3MG2A 1QVF2 3N54B 3KFQC 2QGUA 4XBTA 4BTWA 3VF1A 2O3OA 2KRTA 2F98A 1O7WB 1LOXA 2V1LA 4N6UA 2XSHB 3HK4A 2PZVA 1C7HA 3G6E3 4KZ1A 4FR9A 3K0ZA 5IEOA 2GXFA 1QALA 1VQM3 2XR8B 2CFDA 5STDA 3FLJA 4RZMA 3CCE3 1ASKA 3B4OA 3OWYA 2P09A 5JPPA 1RKYA 1Q7Y4 1VQ63 3STDA 3LZAA 3LYGA 2E2UA 3J7Yd 4HZ9B 1SIHA 3CCM3 1K8A4 3MPHA 4O02B 1N8QA 2I9WA 2B78A 1YJ93 2CWUA 1STFI 2IMJA 3NHXA 1DMQA 3AMOB 4HVNA 3FSDA 1OHOA 5CK6A 3T0UA 1R3FA 1OH0A 1WMNA 1DMNA 1Q824 3WDGB 1AV4A 1GYBA 1O7NB 3ER7A 3HZPA 2OTL3 3PS8A 2LQVA 3DZLA 2OOVA 4IT7A 2AB4A 1QAFA 1OUNA 3TDGA 3E99A 1NJI4 1LNHA 1VQP3 5G2GA 2OWPA 4ORLA 2IA7A 1EKMA 1PU4A 3GZXB 4R80A 3VSYA 4OUQA 1S5AA 1IQ8A 1W02A 3V92A 3PCRA 2JQ5A 3WA3A 2BO9B 5IENA 2W9QA 1JKGA 4X2OA 2Z76A 1M1XB 4MEIA 1JV2B 1O7HB 1JB4A 2OOVC 3G4S3 1IV9A 1S723 2HMJB 3K9MC 3RGRA 2M7OA 2QIYA 5IERA 3SLUA 4R9KA 3EJVA 1R4CA 4FMDA 1V74A 2YFIB 2CWWA 3MWZA 1OF5B 2K0MA 3NM7A 4DMGA 4N6V0 1KD14 1IDPA 2CX1A 1ZX2A 1RRLA 3UAIA 2A15A 3LT8A 3EN1B 1ZL3A 4LZIA 5IG5A 1SQWA 1E3RA 3CC23 4KFDA 1DVCA 4HZBB 2BT3A 1W6GA 2E2TA 4FCJA 3NV0B 1EQKA 5AIGA 1RJOA 1TIJA 2O9UX 3DGMA 3T8NA 1Q40A 4EV2A 2J5TA 3LTCA 1E97A 4EYCA 1FGTA 5D81A 3G0KA 3NBRA 2KCDA 1D6YA 3U1WA 3WOFB 3CMA3 4HYZA 4RBNA 3EX9A 2RCDA 4IPBA 1LXEA 1SPUA 3CNMA 1OGZA 3MG1A 4ZM8A 1JN5B 1O7PB 4NREA 3CXC2 3OWSA 4XM4A 3BNCA 1U5OA 1TFOA 1W7CA 4HM3B 3KKGA 5AIHA 1JNQA 2Y74A 3DXOA 4J9AA 2CFLA 2B24B 3SXXA 3SOYA 3SVAA 2CWTA 1GY5A 1QJGA 2D42A 3JVCA 2HMNB 3K5TA 3L0RA 3LT9A 1ROAA 4O3VA 2CG1A 3HIGA 3GAXA 2GBXB 3PXMA 1IK3A 3FKAA 1J2BA 3N8BA 2PNCA 4WP5A 3WA2X 2W6JH 3MHEA 3NBBA 5A0OB 3NQYA 2RSXA 1Q7HA 1GY6A 2ZDJA 4XDVA 2KXGA 3DUKA 3BNDA 1Y4KA 4GB5A 1D6ZA 1G96A 1W4NA 3OW22 1K734 1M904 3NV0A 4R4KA 1IQXA 1GY7A 2CIUA 3V98A 3WODG 4LMIA 2D1WA 1VZZA 3LMLA 4AEQA 4GL6A 1JKGB 1WXXA 4L8PA 3CCV3 4JF8A 1FA3A 5AYSC 3SOAA 4OVMA 4EXRA 1WMOA 3O8YA 4HJLB 4N6TA 5EQLA 1JN5A 2W04A 3OWUA 3MKIA 2ZL8A 1FGMA 1ZE1A 2C11A 4N6MA 1YJN3 1NB5I 3LH4A 1YIT3 4N6NB 2P0MA 3F40A 4TX4A 4Q1TA 1ZO2A 3UL5A 1US1A 1NDOB 1DYUA 2CKFB 2HMOB 1MOLA 1OHPA 3CME3 2XRXB 1IV7A 1SJWA 3DGLA 3EE1A 1N5PA 4MJDA 4RNZA 1ULJB 1OPYA 1KWIA 3FF2A 4OK0A 1K8WA 2XEPA 1NWWA 4XBXA 3LTAA 2CX0A 5CLKA 4K90B 2RGQA 4K1UA 4N3VA 1KSIA 3JUPA 3FZWA 4U13A 2Y73A 1Q40B 3LTDA 3JUQA 4LGQA 7STDA 1IT8A 3A76A 3RGAA 1NU3A 3EBTA 2MF7A 5TGNA 1DVDA 1VQN3 5AI1A 2BHMA 4IIAA 2CH9A 1N9JA 1TUHA 2R4IA 4H61A 3ROBA 2QA43 1A2KA 1IU7A 2C10A 3K7CA 4HM1B 1K28A 4XDWA 4HM6B 1YIJ3 2XFTA 3FCSB 4L7KA 1UI7A 5IW9A 2P38A 1WMPA 1NB3I 4X2HA 3RDEA 2W03A 2K54A 5JPUA 2WGOA 4K1VA 2L4VA 3F7XA 4CCVA 3OX9A 2Q07A 3KIIA 2YFLB 1A90A 2GEXA 3JUNA 3GWRA 4HBRA 1FGRA 2Z77A 3I553 3CCS3 2YFJB 3F7SA 8CHOA 3IJEB 1OHSA 5FW5A 1D6UA 4AKZA 2OQEA 2RFRA 3EHCA 3KSED 1UW1A 3SEDA 1IVVA 1VQ43 2W2CA 2CK3H 2BMRB 3H51A 1LVNA 2FGTA 1FGOA 1UUVB 3HX8A 3JUOA 3PYJA 3B7CA 4HM8B 3Q1CA 3CCQ3 3X3ZA 4FCMA 3GZBA 2Z7AA 2UX0A 3CPW2 2F99A 2BNGA 3EQQB 1EA2A 4EV5A 1MNLA 5FGOA 2IUJA 2STDA 2INXA 4AKYA 2OQEC 3BNEA 2WOFA 2CC3A 2XH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T5Y A;  1WXX A;  1K8W A;  2J5V A;  2AB4 A;  1R3E A;  2J5T A;  2AS0 A;  2CX0 A;  2CWW A;  1IT7 A;  1WXW A;  2P38 A;  1J2B A;  3LDF A;  4DMG A;  3D79 A;  1ZE1 A;  2B78 A;  1Q7H A;  1IT8 A;  1IQ8 A;  1SGV A;  2CX1 A;  2Q07 A;  3C0K A;  3UAI A;  3VSE A;  1ZE2 A;  1ZL3 A;  4Q1T A;  1R3F A;  1SQW A;  1ZS7 A; 
#chains in the Genus database with same CATH topology
 2ZA4 A;  1M9G A;  3BLZ A;  3LTB A;  5BVB A;  2IUK A;  3KN4 A;  1GS3 A;  3FGY A;  3FG1 A;  2J5V A;  4WWU C;  2XGN A;  5IG3 A;  2ZHX B;  1TU5 A;  2F5W A;  2CHC A;  4HOH A;  2B1X B;  3HII A;  2KAA A;  4JRF A;  6STD A;  3CCU 3;  2GBW B;  3LDF A;  3UL6 A;  3ALA A;  1U8C B;  1AY7 A;  1E3V A;  3ECF A;  4MMZ B;  1B20 A;  1VQO 3;  4HM5 B;  4KFE A;  4WFO A;  2GU1 A;  3B4P A;  4KVH A;  4WYK B;  1SGV A;  3M6X A;  2ML5 A;  3U97 A;  3DGY A;  1ULI B;  3NXJ A;  3U28 A;  1OCV A;  2IY2 A;  2XGL A;  3EF8 A;  3S28 A;  1FYS A;  2F5M A;  3N9H A;  3CCJ 3;  4KFF A;  3WMD A;  3NUV A;  1ZGX A;  4HKV B;  3X40 A;  3F8H A;  5HGR A;  2CFK A;  3S67 A;  1QVG 2;  3PGB A;  3HI7 A;  2E2V A;  1I2F A;  1WQL B;  1VQ8 3;  1JB2 A;  2W0Q A;  3PZW A;  1GD3 A;  1GMR A;  3K63 A;  1SII A;  2P0X A;  4J8T A;  1IT7 A;  3S27 A;  4PEJ A;  3S5C A;  1O7M B;  2KF3 A;  3X41 A;  3H3H A;  5D82 A;  5BXQ A;  1I70 A;  1MWS A;  2AUS A;  3GZY B;  3VGN A;  3JUM A;  1M1K 4;  3C0K A;  7RNT A;  3DM8 A;  2WGQ A;  1I0X A;  5G1K A;  3V99 A;  1YJW 3;  1I3F A;  1YGE A;  5CXO A;  3X3Y A;  3CPO A;  1JRQ A;  2E5O A;  1FUS A;  1MGW A;  3B8L A;  3GSP A;  1FUW A;  1BRG A;  1IVX A;  1GOY A;  1ZS7 A;  2LYX A;  1W01 A;  1RDS A;  2CWV A;  3Q3F A;  1G02 A;  2XFS A;  2BMQ B;  1BRN L;  1MWU A;  1T5Y A;  2W56 B;  1K9M 4;  3RNT A;  4QWT A;  1R3E A;  3URP A;  5IG4 A;  3G71 3;  1X1W A;  2GEY A;  3MYT A;  2F86 B;  1ZBO A;  1MWT A;  3CU3 A;  3T8U A;  4WYK A;  1CEW I;  4BU4 A;  1BNR A;  1IQY A;  3CCL 3;  1UCL A;  1I0V A;  1HKX A;  4MMX B;  1CYU A;  3DGO A;  1CQS A;  1W2B 2;  1QMA A;  4HM2 B;  1RGK A;  1SAR A;  5DRV A;  5I97 A;  2OTJ 3;  3CC7 3;  2CW9 A;  1AVL A;  1RTU A;  3CCR 3;  2WOH A;  1ISK A;  5M1A A;  3NQZ A;  3I56 3;  5KP4 A;  1VQ7 3;  2ML6 A;  1UI8 A;  3MQK A;  2KKU A;  5JBS A;  4H3U A;  1RRH A;  3NBJ A;  1MGR A;  1GD4 A;  2HMM B;  4XBY A;  3UNL A;  2FXT A;  4EC6 A;  1W5Z A;  3OV4 A;  1I2G A;  3LXU X;  1YGW A;  1VQK 3;  3LWQ A;  3HJY A;  3IPT A;  3QK9 A;  5DRE A;  3F8X A;  1YI2 3;  4FMA A;  3UB1 A;  1Q81 4;  2BMO B;  5IF6 A;  3D9R A;  3OXA A;  3X42 A;  3IMA B;  1VQL 3;  1RGC A;  4XB5 A;  3GZR A;  3F14 A;  3X3X A;  1JBT A;  1JJ2 2;  2CFG A;  3MSO A;  1TP6 A;  1AVK A;  2JDI H;  3QRD A;  5CF1 A;  9RNT A;  1F8N A;  3DGN A;  3I0Y A;  3SX1 A;  1ZE2 A;  1B2U A;  4FMC A;  4CJN A;  3CD6 3;  1FW7 A;  1KC8 4;  3KE7 A;  1N9E A;  4HM7 B;  4O8S A;  4RNY A;  3FF0 A;  3EB8 A;  1STD A;  1UUG B;  2W56 A;  1VQQ A;  4TZ4 C;  3Q90 A;  2YX9 A;  4DKI A;  1IVW A;  1N5H A;  1NO3 A;  1B3S A;  2GU3 A;  3HOH A;  3S29 A;  3D3L A;  4HM0 B;  1OAC A;  4N6L A;  5ELJ A;  4BTX A;  4Q53 A;  5ELU A;  1CYV A;  4L8O A;  4ILF A;  5M18 A;  1BSC A;  4FMB A;  1RGH A;  3FH1 A;  1W00 A;  4J5K A;  5AEU B;  2H0H A;  1VQ5 3;  1JB5 A;  8RNT A;  5LC7 A;  3AMO A;  1BIR A;  4FCZ A;  1B27 A;  3KZT A;  3EC9 A;  5CF2 A;  5KP1 A;  3FG3 A;  2UGI A;  3VSE A;  1PFP A;  1TFK A;  3F9S A;  3MG3 A;  2WO0 A;  1Q86 4;  2KF4 A;  1A67 A;  1K41 A;  5IEP A;  3LOY A;  1BNS A;  4HM4 B;  1FZU A;  2MC8 A;  1UGH I;  2FNQ A;  4O2H A;  4R1K A;  4EBG A;  2EY4 A;  1IVU A;  1VQ9 3;  2CFW A;  2CG0 A;  1A2V A;  1W6Y A;  3AGO A;  3G8Z A;  3EBY A;  1BSA A;  1BAN A;  1WNH A;  1UCJ A;  2KF6 A;  3PCS A;  4LSO A;  3GRD A;  2XSO B;  3EN8 A;  5D83 A;  2QEX 3;  1I3I A;  2AAD A;  2OCT A;  1BNF A;  5EEO A;  1ROV A;  3KSP A;  3CNX A;  3NM2 A;  3FG4 A;  3NX0 A;  1EG9 B;  2XF3 A;  1WTH A;  3DH2 A;  1LQG C;  5AIF A;  2SAR A;  2W9P A;  4NPB A;  5AII A;  1DMM A;  2SBL A;  1KQS 2;  3D79 A;  1O7G B;  4I4K A;  1Z1S A;  3ZG0 A;  1QAK A;  3M6W A;  1AR0 A;  3BB9 A;  5EVH A;  1N8R 4;  1JBS A;  6RNT A;  1LRA A;  1UUW B;  4LEH A;  5KP3 A;  1JZD A;  5AEW B;  3UJM A;  1HU9 A;  4HAA A;  4K61 A;  1RN7 A;  3M8C A;  5IG0 A;  1Q42 A;  4MMY B;  5AYR B;  1R4Y A;  4WHA A;  5LC6 A;  1YHQ 3;  1L5G B;  1W2Z A;  5BU4 A;  3BNB A;  3Q2P A;  1OF5 A;  1XNE A;  2HML B;  2Z6B A;  3DY5 A;  4NHF A;  3WOE B;  4BTY A;  1LOW A;  3DMC A;  4CDL A;  4G1M B;  4R9L A;  3CC4 3;  1FGQ A;  1YVB I;  4N6O B;  1BUJ A;  2HMK B;  2AS0 A;  4STD A;  1OGX A;  1BUQ A;  1W6C A;  1RN4 A;  1V57 A;  2P05 A;  3G16 A;  1WXW A;  3MG2 A;  1QVF 2;  3N54 B;  3KFQ C;  1LOY A;  4GSP A;  2QGU A;  4XBT A;  4BTW A;  3VF1 A;  2O3O A;  2KRT A;  1LQM B;  2F98 A;  1O7W B;  1LOX A;  2V1L A;  4N6U A;  2XSH B;  3BU4 A;  3HAX A;  3HK4 A;  2PZV A;  1C7H A;  1GOU A;  2RNT A;  7GSP A;  3G6E 3;  4KZ1 A;  4FR9 A;  3K0Z A;  5IEO A;  1RMS A;  2GXF A;  1QAL A;  1BRI A;  2XR8 B;  2CFD A;  1VQM 3;  5STD A;  2R41 A;  3FLJ A;  4RZM A;  3CCE 3;  1ASK A;  3B4O A;  3OWY A;  2P09 A;  5JPP A;  1RKY A;  1Q7Y 4;  1VQ6 3;  3STD A;  1BRH A;  3LZA A;  3LYG A;  2E2U A;  1DET A;  3J7Y d;  3M6V A;  1GSP A;  2GSP A;  4HZ9 B;  1BNG A;  1SIH A;  3CCM 3;  1K8A 4;  3MPH A;  4O02 B;  1N8Q A;  2I9W A;  2B78 A;  1YJ9 3;  2CWU A;  1STF I;  2IMJ A;  2HOH A;  3D4A A;  3NHX A;  1DMQ A;  3AMO B;  4HVN A;  3FSD A;  1OHO A;  5CK6 A;  1NNV A;  1R3F A;  1OH0 A;  1RGA A;  3T0U A;  1WMN A;  1DMN A;  1Q82 4;  3WDG B;  1AV4 A;  1GYB A;  2DP9 A;  1O7N B;  3ER7 A;  3HZP A;  2OTL 3;  1BAO A;  3PS8 A;  1RNB A;  2LQV A;  3D5I A;  3DZL A;  1RNT A;  2OOV A;  4IT7 A;  2AB4 A;  1QAF A;  1OUN A;  3TDG A;  3E99 A;  2FRX A;  1NJI 4;  1LNH A;  3ZFZ A;  1VQP 3;  1BRK A;  5G2G A;  2OWP A;  1LOV A;  4ORL A;  1BNJ A;  2IA7 A;  1JBR A;  1EKM A;  1PU4 A;  3ZG5 A;  3GZX B;  1CH0 A;  4R80 A;  3VSY A;  4OUQ A;  1S5A A;  1IQ8 A;  1V58 A;  1W02 A;  3V92 A;  3PCR A;  3AHW A;  2JQ5 A;  5M19 A;  3WA3 A;  2BO9 B;  1Q9E A;  1BVI A;  5IEN A;  2W9Q A;  1JKG A;  4X2O A;  2Z76 A;  1M1X B;  4MEI A;  3LWP A;  1JV2 B;  1O7H B;  1JB4 A;  1T3B A;  2OOV C;  3G4S 3;  1IV9 A;  1S72 3;  4CI2 B;  3SYU A;  2HMJ B;  3K9M C;  1BNE A;  3AGN A;  2M7O A;  3RGR A;  2QIY A;  5IER A;  5RNT A;  3SLU A;  3M65 A;  4R9K A;  1B2S A;  3EJV A;  1R4C A;  4CI1 B;  1V74 A;  4FMD A;  1BNI A;  2YFI B;  2CWW A;  3MWZ A;  1OF5 B;  1RCK A;  5G1L A;  1EEJ A;  2K0M A;  4DMG A;  3NM7 A;  1UOY A;  1RGF A;  4N6V 0;  1KD1 4;  2BU4 A;  1IDP A;  2CX1 A;  1ZX2 A;  1RRL A;  3UAI A;  2A15 A;  3LT8 A;  3EN1 B;  1ZL3 A;  4LZI A;  5IG5 A;  6GSP A;  1SQW A;  1E3R A;  3CC2 3;  1TTO A;  4KFD A;  1B21 A;  1DVC A;  4HZB B;  2BT3 A;  1W6G A;  2E2T A;  4FCJ A;  1TRQ A;  1RCL A;  1RSN A;  3NV0 B;  1EQK A;  1X1U A;  5AIG A;  1RJO A;  1TIJ A;  2O9U X;  3DGM A;  3T8N A;  1Q40 A;  4EV2 A;  2J5T A;  3LTC A;  1E97 A;  1I2E A;  1FGT A;  4EYC A;  1BSB A;  5D81 A;  3G0K A;  3NBR A;  1TE7 A;  1RGG A;  2APO A;  2KCD A;  1D6Y A;  1GMQ A;  3U1W A;  3WOF B;  3CMA 3;  4HYZ A;  4RBN A;  2F56 A;  3EX9 A;  3BIR A;  3M4X A;  2RCD A;  2Z0T A;  2UUG C;  1UCK A;  1LXE A;  1SPU A;  2KF5 A;  1OGZ A;  3CNM A;  3MG1 A;  4IPB A;  1JN5 B;  1O7P B;  4NRE A;  3CXC 2;  3OWS A;  4XM4 A;  3BNC A;  1U5O A;  1RN1 A;  1TFO A;  1W7C A;  1I8V A;  2J8X B;  4HM3 B;  3KKG A;  5AIH A;  1JNQ A;  2Y74 A;  3DXO A;  4J9A A;  2CFL A;  2B24 B;  3SXX A;  4EW5 A;  3SOY A;  2BIR A;  1T2I A;  3SVA A;  2CWT A;  1GY5 A;  1LNI A;  1QJG A;  2D42 A;  2HMN B;  3JVC A;  3K5T A;  3L0R A;  1ROA A;  3LT9 A;  4RNT A;  1X1Y A;  4O3V A;  2HVY A;  2CG1 A;  3HIG A;  2RBI A;  3GAX A;  2GBX B;  3PXM A;  1IK3 A;  3FKA A;  1J2B A;  3N8B A;  2PNC A;  4WP5 A;  3WA2 X;  4BIR A;  2W6J H;  3MHE A;  1HYF A;  3NBB A;  5A0O B;  3AHS A;  3NQY A;  2RSX A;  1Q7H A;  2ANE A;  1GY6 A;  2ZDJ A;  4XDV A;  1RGL A;  2KXG A;  3DUK A;  3BND A;  1Y4K A;  4GB5 A;  1D6Z A;  1G96 A;  1W4N A;  3OW2 2;  1K73 4;  1M90 4;  3WR2 A;  4BL2 A;  1T2H A;  3NV0 A;  4R4K A;  1IQX A;  1GY7 A;  2CIU A;  1BRJ A;  1WK2 A;  3V98 A;  3WOD G;  4LMI A;  3LWR A;  2D1W A;  1A2P A;  1VZZ A;  3LML A;  4AEQ A;  1IYY A;  1BGS A;  4GL6 A;  1JKG B;  1WXX A;  4L8P A;  1YNV X;  3LWO A;  3CCV 3;  4JF8 A;  4CPK A;  1FA3 A;  5HOH A;  2C4B A;  5AYS C;  3D5G A;  4OVM A;  3SOA A;  4EXR A;  1WMO A;  1FUT A;  3O8Y A;  4HJL B;  4N6T A;  5EQL A;  1JN5 A;  1B2X A;  2W04 A;  3MKI A;  2ZL8 A;  3OWU A;  1UGI A;  1FGM A;  1ZE1 A;  2C11 A;  1GOV A;  4N6M A;  1YJN 3;  1NB5 I;  3LH4 A;  1DE3 A;  1YIT 3;  4N6N B;  2H0I A;  2P0M A;  3F40 A;  4TX4 A;  4KT3 B;  4Q1T A;  1ZO2 A;  3UL5 A;  1US1 A;  1NDO B;  3ZV0 C;  1DYU A;  2CKF B;  2HMO B;  1MOL A;  1OHP A;  3CME 3;  2XRX B;  1IV7 A;  1SJW A;  3DGL A;  3EE1 A;  1N5P A;  4MJD A;  4RNZ A;  1ULJ B;  1OPY A;  1KWI A;  4LYL B;  3FF2 A;  4OK0 A;  1K8W A;  3LJC A;  3M6U A;  2XEP A;  1G0T A;  1BU4 A;  1NWW A;  4XBX A;  3LTA A;  2CX0 A;  5CLK A;  4K90 B;  2RGQ A;  4K1U A;  4N3V A;  1KSI A;  3JUP A;  3FZW A;  1GMP A;  1S04 A;  2Y73 A;  1Q40 B;  4U13 A;  3LTD A;  2IYJ A;  3JUQ A;  4LGQ A;  7STD A;  1IT8 A;  3A76 A;  3RGA A;  1AQZ A;  1NU3 A;  2MF7 A;  3EBT A;  5TGN A;  1DVD A;  1VQN 3;  5AI1 A;  1X1X A;  4GHO A;  2BHM A;  2F4Y A;  4IIA A;  1BRS A;  2CH9 A;  4ZM8 A;  2AAE A;  1N9J A;  1TUH A;  2R4I A;  4H61 A;  3ROB A;  2QA4 3;  1A2K A;  1IU7 A;  3IUW A;  2C10 A;  2H0G A;  3K7C A;  4HM1 B;  5BIR A;  1K28 A;  4XDW A;  4HM6 B;  1YIJ 3;  2XFT A;  3FCS B;  4L7K A;  1BSE A;  1UI7 A;  5IW9 A;  2P38 A;  1WMP A;  1NB3 I;  4X2H A;  3RDE A;  2W03 A;  2K54 A;  5JPU A;  2WGO A;  4K1V A;  2L4V A;  3F7X A;  3WHO A;  3OX9 A;  4CCV A;  1UDI I;  2Q07 A;  3KII A;  2YFL B;  1RLS A;  1A90 A;  2GEX A;  3JUN A;  3GWR A;  4HBR A;  1FGR A;  4J5G A;  2Z77 A;  5GSP A;  3I55 3;  3CCS 3;  1BSD A;  2YFJ B;  1PYL A;  3F7S A;  1B2Z A;  8CHO A;  3LWV A;  3IJE B;  1OHS A;  5FW5 A;  1D6U A;  4AKZ A;  2OQE A;  2RFR A;  3EHC A;  3KSE D;  1UW1 A;  3SED A;  1IVV A;  3KCH A;  1MWR A;  2W2C A;  2CK3 H;  1VQ4 3;  2BMR B;  4I5Q A;  2K3D A;  3H51 A;  4BL3 A;  1LVN A;  2FGT A;  1FGO A;  1YVS A;  1UUV B;  3HX8 A;  3JUO A;  3PYJ A;  3B7C A;  4HM8 B;  1EUI C;  1BOX A;  3Q1C A;  3HJW A;  3CCQ 3;  3X3Z A;  1B2M A;  4FCM A;  1RGE A;  3A5E A;  1JZO A;  2Z7A A;  3GZB A;  1UCI A;  2UX0 A;  1HZ1 A;  2RFK A;  3CPW 2;  2F99 A;  2L1S A;  2BNG A;  3EQQ B;  1EA2 A;  4EV5 A;  1MNL A;  1TRP A;  5FGO A;  2IUJ A;  1TJD A;  2STD A;  2INX A;  4AKY A;  2OQE C;  1RHL A;  3BNE A;  4CI3 B;  2WOF A;  1C54 A;  2CC3 A;  2XH9 A;  1PY3 A; 
#chains in the Genus database with same CATH homology
 3BLZ A;  1M9G A;  3LTB A;  5BVB A;  2IUK A;  3KN4 A;  1GS3 A;  3FGY A;  3FG1 A;  2J5V A;  4WWU C;  2XGN A;  5IG3 A;  1TU5 A;  2CHC A;  2B1X B;  3HII A;  4JRF A;  6STD A;  3CCU 3;  2GBW B;  3LDF A;  3UL6 A;  3ALA A;  1U8C B;  1E3V A;  4MMZ B;  3ECF A;  1VQO 3;  4HM5 B;  4KFE A;  4WFO A;  2GU1 A;  3B4P A;  4KVH A;  4WYK B;  1SGV A;  2ML5 A;  3U97 A;  1ULI B;  3NXJ A;  1OCV A;  2XGL A;  3EF8 A;  3S28 A;  3N9H A;  3CCJ 3;  4KFF A;  3WMD A;  3NUV A;  4HKV B;  3X40 A;  3F8H A;  5HGR A;  2CFK A;  3S67 A;  1QVG 2;  3PGB A;  3HI7 A;  2E2V A;  1WQL B;  1VQ8 3;  1JB2 A;  2W0Q A;  3PZW A;  1GD3 A;  3K63 A;  3S27 A;  1SII A;  2P0X A;  4J8T A;  1IT7 A;  4PEJ A;  3S5C A;  1O7M B;  3X41 A;  3H3H A;  5D82 A;  5BXQ A;  3GZY B;  3VGN A;  3JUM A;  1M1K 4;  3C0K A;  3DM8 A;  2WGQ A;  1YJW 3;  3V99 A;  1YGE A;  5CXO A;  3X3Y A;  3CPO A;  1JRQ A;  3B8L A;  1FUW A;  1IVX A;  1ZS7 A;  2LYX A;  1W01 A;  2CWV A;  2XFS A;  2BMQ B;  1T5Y A;  2W56 B;  1K9M 4;  4QWT A;  1R3E A;  5IG4 A;  3G71 3;  2GEY A;  3MYT A;  2F86 B;  3CU3 A;  3T8U A;  4WYK A;  1CEW I;  1IQY A;  3CCL 3;  1HKX A;  4MMX B;  1CYU A;  3DGO A;  1CQS A;  1W2B 2;  1QMA A;  4HM2 B;  5DRV A;  5I97 A;  2OTJ 3;  3CC7 3;  2CW9 A;  1AVL A;  3CCR 3;  2WOH A;  1ISK A;  3NQZ A;  3I56 3;  5KP4 A;  1VQ7 3;  2ML6 A;  1UI8 A;  5JBS A;  4H3U A;  1RRH A;  3NBJ A;  4XBY A;  1GD4 A;  2HMM B;  3UNL A;  2FXT A;  4EC6 A;  1W5Z A;  3OV4 A;  3LXU X;  1VQK 3;  3QK9 A;  3IPT A;  5DRE A;  3F8X A;  1YI2 3;  4FMA A;  3UB1 A;  1Q81 4;  2BMO B;  5IF6 A;  3D9R A;  3OXA A;  3X42 A;  3IMA B;  1VQL 3;  4XB5 A;  3GZR A;  3F14 A;  3X3X A;  1JJ2 2;  2CFG A;  3MSO A;  1TP6 A;  1AVK A;  2JDI H;  3QRD A;  5CF1 A;  1VQ9 3;  1F8N A;  3DGN A;  3I0Y A;  3SX1 A;  1ZE2 A;  4FMC A;  3CD6 3;  1KC8 4;  3KE7 A;  1N9E A;  4HM7 B;  4O8S A;  4RNY A;  3FF0 A;  3EB8 A;  1STD A;  2W56 A;  3Q90 A;  2YX9 A;  1IVW A;  2GU3 A;  1N5H A;  1NO3 A;  3S29 A;  3D3L A;  4HM0 B;  1OAC A;  4N6L A;  5ELJ A;  4BTX A;  4Q53 A;  5ELU A;  1CYV A;  4L8O A;  4FMB A;  3FH1 A;  1W00 A;  5AEU B;  1VQ5 3;  1JB5 A;  5LC7 A;  3AMO A;  4FCZ A;  3KZT A;  3EC9 A;  5CF2 A;  5KP1 A;  3FG3 A;  3VSE A;  1PFP A;  1TFK A;  3F9S A;  3MG3 A;  2WO0 A;  1Q86 4;  1A67 A;  1K41 A;  5IEP A;  3LOY A;  4HM4 B;  2MC8 A;  2FNQ A;  4O2H A;  4R1K A;  4EBG A;  1IVU A;  2CFW A;  2CG0 A;  1A2V A;  1W6Y A;  3G8Z A;  3EBY A;  1WNH A;  3PCS A;  4LSO A;  3GRD A;  2XSO B;  3EN8 A;  5D83 A;  2QEX 3;  2OCT A;  5EEO A;  1ROV A;  3KSP A;  3CNX A;  3NM2 A;  3FG4 A;  3NX0 A;  1EG9 B;  2XF3 A;  1WTH A;  5AIF A;  2W9P A;  5AII A;  1DMM A;  2SBL A;  1KQS 2;  3D79 A;  1O7G B;  4I4K A;  1Z1S A;  1QAK A;  1AR0 A;  3BB9 A;  5EVH A;  1N8R 4;  4LEH A;  1UUW B;  5KP3 A;  5AEW B;  3UJM A;  1HU9 A;  4K61 A;  1RN7 A;  3M8C A;  5IG0 A;  1Q42 A;  4MMY B;  5AYR B;  4WHA A;  5LC6 A;  1YHQ 3;  1L5G B;  1W2Z A;  3BNB A;  3Q2P A;  1OF5 A;  2HML B;  2Z6B A;  3DY5 A;  4NHF A;  3WOE B;  4CDL A;  4BTY A;  3DMC A;  4G1M B;  4R9L A;  3CC4 3;  1FGQ A;  1YVB I;  4N6O B;  2HMK B;  2AS0 A;  4STD A;  1OGX A;  1BUQ A;  1W6C A;  2P05 A;  3G16 A;  1WXW A;  3MG2 A;  1QVF 2;  3N54 B;  3KFQ C;  2QGU A;  4XBT A;  4BTW A;  3VF1 A;  2O3O A;  2KRT A;  2F98 A;  1O7W B;  1LOX A;  2V1L A;  4N6U A;  2XSH B;  3HK4 A;  2PZV A;  1C7H A;  3G6E 3;  4KZ1 A;  4FR9 A;  3K0Z A;  5IEO A;  2GXF A;  1QAL A;  1VQM 3;  2XR8 B;  2CFD A;  5STD A;  3FLJ A;  4RZM A;  3CCE 3;  1ASK A;  3B4O A;  3OWY A;  2P09 A;  5JPP A;  1RKY A;  1Q7Y 4;  1VQ6 3;  3STD A;  3LZA A;  3LYG A;  2E2U A;  3J7Y d;  4HZ9 B;  1SIH A;  3CCM 3;  1K8A 4;  3MPH A;  4O02 B;  1N8Q A;  2I9W A;  2B78 A;  1YJ9 3;  2CWU A;  1STF I;  2IMJ A;  3NHX A;  1DMQ A;  3AMO B;  4HVN A;  3FSD A;  1OHO A;  5CK6 A;  3T0U A;  1R3F A;  1OH0 A;  1WMN A;  1DMN A;  1Q82 4;  3WDG B;  1AV4 A;  1GYB A;  1O7N B;  3ER7 A;  3HZP A;  2OTL 3;  3PS8 A;  2LQV A;  3DZL A;  2OOV A;  4IT7 A;  2AB4 A;  1QAF A;  1OUN A;  3TDG A;  3E99 A;  1NJI 4;  1LNH A;  1VQP 3;  5G2G A;  2OWP A;  4ORL A;  2IA7 A;  1EKM A;  1PU4 A;  3GZX B;  4R80 A;  3VSY A;  4OUQ A;  1S5A A;  1IQ8 A;  1W02 A;  3V92 A;  3PCR A;  2JQ5 A;  3WA3 A;  2BO9 B;  5IEN A;  2W9Q A;  1JKG A;  4X2O A;  2Z76 A;  1M1X B;  4MEI A;  1JV2 B;  1O7H B;  1JB4 A;  2OOV C;  3G4S 3;  1IV9 A;  1S72 3;  2HMJ B;  3K9M C;  3RGR A;  2M7O A;  2QIY A;  5IER A;  3SLU A;  4R9K A;  3EJV A;  1R4C A;  4FMD A;  1V74 A;  2YFI B;  2CWW A;  3MWZ A;  1OF5 B;  2K0M A;  3NM7 A;  4DMG A;  4N6V 0;  1KD1 4;  1IDP A;  2CX1 A;  1ZX2 A;  1RRL A;  3UAI A;  2A15 A;  3LT8 A;  3EN1 B;  1ZL3 A;  4LZI A;  5IG5 A;  1SQW A;  1E3R A;  3CC2 3;  4KFD A;  1DVC A;  4HZB B;  2BT3 A;  1W6G A;  2E2T A;  4FCJ A;  3NV0 B;  1EQK A;  5AIG A;  1RJO A;  1TIJ A;  2O9U X;  3DGM A;  3T8N A;  1Q40 A;  4EV2 A;  2J5T A;  3LTC A;  1E97 A;  4EYC A;  1FGT A;  5D81 A;  3G0K A;  3NBR A;  2KCD A;  1D6Y A;  3U1W A;  3WOF B;  3CMA 3;  4HYZ A;  4RBN A;  3EX9 A;  2RCD A;  4IPB A;  1LXE A;  1SPU A;  3CNM A;  1OGZ A;  3MG1 A;  4ZM8 A;  1JN5 B;  1O7P B;  4NRE A;  3CXC 2;  3OWS A;  4XM4 A;  3BNC A;  1U5O A;  1TFO A;  1W7C A;  4HM3 B;  3KKG A;  5AIH A;  1JNQ A;  2Y74 A;  3DXO A;  4J9A A;  2CFL A;  2B24 B;  3SXX A;  3SOY A;  3SVA A;  2CWT A;  1GY5 A;  1QJG A;  2D42 A;  3JVC A;  2HMN B;  3K5T A;  3L0R A;  3LT9 A;  1ROA A;  4O3V A;  2CG1 A;  3HIG A;  3GAX A;  2GBX B;  3PXM A;  1IK3 A;  3FKA A;  1J2B A;  3N8B A;  2PNC A;  4WP5 A;  3WA2 X;  2W6J H;  3MHE A;  3NBB A;  5A0O B;  3NQY A;  2RSX A;  1Q7H A;  1GY6 A;  2ZDJ A;  4XDV A;  2KXG A;  3DUK A;  3BND A;  1Y4K A;  4GB5 A;  1D6Z A;  1G96 A;  1W4N A;  3OW2 2;  1K73 4;  1M90 4;  3NV0 A;  4R4K A;  1IQX A;  1GY7 A;  2CIU A;  3V98 A;  3WOD G;  4LMI A;  2D1W A;  1VZZ A;  3LML A;  4AEQ A;  4GL6 A;  1JKG B;  1WXX A;  4L8P A;  3CCV 3;  4JF8 A;  1FA3 A;  5AYS C;  3SOA A;  4OVM A;  4EXR A;  1WMO A;  3O8Y A;  4HJL B;  4N6T A;  5EQL A;  1JN5 A;  2W04 A;  3OWU A;  3MKI A;  2ZL8 A;  1FGM A;  1ZE1 A;  2C11 A;  4N6M A;  1YJN 3;  1NB5 I;  3LH4 A;  1YIT 3;  4N6N B;  2P0M A;  3F40 A;  4TX4 A;  4Q1T A;  1ZO2 A;  3UL5 A;  1US1 A;  1NDO B;  1DYU A;  2CKF B;  2HMO B;  1MOL A;  1OHP A;  3CME 3;  2XRX B;  1IV7 A;  1SJW A;  3DGL A;  3EE1 A;  1N5P A;  4MJD A;  4RNZ A;  1ULJ B;  1OPY A;  1KWI A;  3FF2 A;  4OK0 A;  1K8W A;  2XEP A;  1NWW A;  4XBX A;  3LTA A;  2CX0 A;  5CLK A;  4K90 B;  2RGQ A;  4K1U A;  4N3V A;  1KSI A;  3JUP A;  3FZW A;  4U13 A;  2Y73 A;  1Q40 B;  3LTD A;  3JUQ A;  4LGQ A;  7STD A;  1IT8 A;  3A76 A;  3RGA A;  1NU3 A;  3EBT A;  2MF7 A;  5TGN A;  1DVD A;  1VQN 3;  5AI1 A;  2BHM A;  4IIA A;  2CH9 A;  1N9J A;  1TUH A;  2R4I A;  4H61 A;  3ROB A;  2QA4 3;  1A2K A;  1IU7 A;  2C10 A;  3K7C A;  4HM1 B;  1K28 A;  4XDW A;  4HM6 B;  1YIJ 3;  2XFT A;  3FCS B;  4L7K A;  1UI7 A;  5IW9 A;  2P38 A;  1WMP A;  1NB3 I;  4X2H A;  3RDE A;  2W03 A;  2K54 A;  5JPU A;  2WGO A;  4K1V A;  2L4V A;  3F7X A;  4CCV A;  3OX9 A;  2Q07 A;  3KII A;  2YFL B;  1A90 A;  2GEX A;  3JUN A;  3GWR A;  4HBR A;  1FGR A;  2Z77 A;  3I55 3;  3CCS 3;  2YFJ B;  3F7S A;  8CHO A;  3IJE B;  1OHS A;  5FW5 A;  1D6U A;  4AKZ A;  2OQE A;  2RFR A;  3EHC A;  3KSE D;  1UW1 A;  3SED A;  1IVV A;  1VQ4 3;  2W2C A;  2CK3 H;  2BMR B;  3H51 A;  1LVN A;  2FGT A;  1FGO A;  1UUV B;  3HX8 A;  3JUO A;  3PYJ A;  3B7C A;  4HM8 B;  3Q1C A;  3CCQ 3;  3X3Z A;  4FCM A;  3GZB A;  2Z7A A;  2UX0 A;  3CPW 2;  2F99 A;  2BNG A;  3EQQ B;  1EA2 A;  4EV5 A;  1MNL A;  5FGO A;  2IUJ A;  2STD A;  2INX A;  4AKY A;  2OQE C;  3BNE A;  2WOF A;  2CC3 A;  2XH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...