1SQWA

Crystal structure of kd93, a novel protein expressed in the human pro
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
176
structure length
176
Chain Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Saccharomyces cerevisiae Nip7p homolog
publication title Crystal structure of KD93, a novel protein expressed in human hematopoietic stem/progenitor cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03657 UPF0113 UPF0113 PUA domain
A PF17833 UPF0113_N UPF0113 Pre-PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1sqwA02
3.10.450.220 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1sqwA01
4DMGA 1J2BA 4Q1TA 1IT8A 1SGVA 2CX0A 2AB4A 1WXWA 1ZS7A 3LDFA 2AS0A 3VSEA 1K8WA 1SQWA 2B78A 1T5YA 2P38A 2J5VA 1WXXA 1R3EA 2Q07A 3C0KA 1IQ8A 1Q7HA 3D79A 1IT7A 1R3FA 1ZE1A 2J5TA 3UAIA 2CWWA 2CX1A 1ZL3A 1ZE2A
chains in the Genus database with same CATH superfamily
3NBJA 1N9EA 1RNBA 2KKUA 1BU4A 4EV5A 2BHMA 1RN4A 2FXTA 1ZX2A 3EBTA 5ELUA 4G1MB 4RNTA 2F86B 2GU1A 1T5YA 2Y73A 2O3OA 3JUQA 2HMNB 1JB4A 2IY2A 3RDEA 1R3EA 5LC7A 2QIYA 2Q07A 4XDVA 1B2MA 1BANA 3NUVA 1JBTA 2IA7A 3DH2A 3CME3 3ALAA 4BL3A 1FUWA 2H0IA 2HVYA 3Q2PA 3CCM3 3JUOA 3LZAA 1DVCA 4HM2B 2RFKA 2R4IA 3F7XA 1I2EA 4MMXB 9RNTA 3Q90A 1CEWI 1TIJA 1Z1SA 3UAIA 1QMAA 3SOYA 4ZM8A 2Z76A 1BRSA 2OTL3 2IYJA 1BIRA 2RSXA 6GSPA 5D81A 1UGIA 2M7OA 1Q824 3LTCA 1V57A 5D83A 3V98A 1W00A 3LT9A 2GEYA 2CFLA 1QALA 5KP4A 1EA2A 2B78A 1IQXA 3GZYB 4JF8A 4CDLA 3BIRA 1DYUA 1MNLA 2H0GA 3B4OA 4H3UA 4J5KA 2OQEA 1NO3A 4GL6A 1YGWA 3KFQC 3D4AA 2GEXA 3CC73 2XSHB 3MPHA 2LQVA 1LVNA 3ECFA 1FGRA 2BMOB 4BU4A 1LXEA 2XRXB 5FW5A 1IV9A 1X1XA 1I3FA 4HKVB 3VSYA 1S723 3K63A 3SYUA 2FNQA 1D6UA 1OHOA 1WMOA 5BIRA 3EF8A 2KRTA 4HM5B 3F8HA 3X40A 1RRHA 2D1WA 1D6YA 4J9AA 4EV2A 4XDWA 2PNCA 3E99A 5TGNA 1O7NB 1N8QA 2AS0A 4BL2A 3SX1A 5ELJA 1W5ZA 1AQZA 2W03A 1BSCA 2HMOB 3BNCA 3NHXA 4GHOA 4H61A 2BMQB 4AEQA 4BTWA 2OQEC 1VQO3 4O02B 5AYSC 5AIHA 1FGOA 2V1LA 1W01A 3CC23 1TUHA 1MGRA 3EHCA 1YJN3 1STDA 2IUKA 4STDA 4CPKA 1BSBA 1R3FA 1B21A 1VQ83 1OHPA 3LXUX 2STDA 1JKGB 1VQL3 2ZDJA 2W2CA 1LOWA 2UUGC 1RGGA 3BU4A 1BNJA 4XB5A 4L8PA 2C4BA 2K54A 5KP1A 1DVDA 1YVBI 4FMAA 3DGYA 3LWRA 3GRDA 3MHEA 3ROBA 1R4CA 1LOVA 2RNTA 4U13A 1PFPA 3M6WA 3Q3FA 3DMCA 4IT7A 4N3VA 2RGQA 2CG1A 2HOHA 1TFKA 3EBYA 4FCJA 4HJLB 5JPPA 3HAXA 1K9M4 2WOFA 4R4KA 4EXRA 1MWSA 1PYLA 1HU9A 1RSNA 1UOYA 3K9MC 1GOYA 1F8NA 1O7GB 2RBIA 3KE7A 3NBRA 3Q1CA 2E2VA 3RGAA 2XH9A 1IV7A 2INXA 1CQSA 4NHFA 3FH1A 3NQZA 3M6VA 1OPYA 1GMPA 2SBLA 3FZWA 3LTAA 3CCE3 5JPUA 2W9QA 2RCDA 5FGOA 2BO9B 3GSPA 1UUGB 1BVIA 1U5OA 1ULIB 3UL5A 1KWIA 4MMYB 2GU3A 3KSPA 1B2UA 3BLZA 1RGCA 5STDA 4N6TA 1W4NA 1X1YA 2CC3A 4LYLB 1ZBOA 2KF5A 2XR8B 5JBSA 2K3DA 1RGKA 3OX9A 4MMZB 4NPBA 4AKYA 2F5WA 1N8R4 1W02A 4BTXA 3IJEB 1NDOB 4IPBA 3D5IA 1R4YA 3RGRA 1NB5I 1BUQA 3HZPA 3AGNA 3UJMA 1EKMA 1IT7A 1Q42A 2OTJ3 4BTYA 3IPTA 3FCSB 1UUVB 1G0TA 1W6YA 3SEDA 3VF1A 4LZIA 3ER7A 1V74A 1AVLA 1SGVA 4KFFA 2OOVA 5IEOA 4NREA 5GSPA 3CD63 5I97A 1C54A 3FSDA 1BRKA 1JKGA 5HGRA 2IMJA 3WMDA 2CFWA 1RMSA 3O8YA 3B8LA 4CI1B 4XM4A 1RDSA 1N5PA 1RTUA 2BT3A 1W6GA 3S67A 1JNQA 3CCL3 1VQ43 1G02A 1NU3A 3B7CA 2OCTA 4N6UA 5BVBA 4R1KA 1GY5A 3FG3A 3NM2A 3WODG 2GXFA 3H3HA 4HM7B 3NBBA 2CWTA 1A2VA 3G8ZA 3PZWA 4I5QA 1RGAA 1CH0A 1ZE2A 2XFTA 3IMAB 1B3SA 4EC6A 1UI8A 1Q864 3M8CA 2OOVC 2XFSA 3M4XA 5CF2A 2B24B 3F9SA 1Q40B 3D5GA 1ZS7A 1NNVA 1C7HA 3EJVA 4OUQA 3KSED 3NM7A 4CJNA 2CFGA 1WXXA 1BRJA 2RFRA 3JVCA 2Y74A 3PCSA 4LSOA 2AUSA 3ZG0A 2W56B 1DE3A 3D9RA 3LWPA 4N6V0 5EVHA 4HVNA 1W6CA 4EW5A 3NQYA 3STDA 2ML6A 5M19A 1RN1A 2F5MA 4HM1B 1EEJA 3AHWA 4HM6B 4KFEA 4RNZA 5IG4A 3LWQA 1UDII 3M6UA 1JV2B 3JUNA 4HZBB 3OW22 1A67A 2ML5A 1BNIA 1O7PB 1O7WB 1SPUA 3G713 3LJCA 2CH9A 3H51A 1BNFA 2R41A 3T8UA 2C10A 1WK2A 3JUPA 1FZUA 2P0MA 3AMOB 3HIGA 2Z6BA 2OWPA 1I2GA 2C11A 3SXXA 5A0OB 2D42A 2L1SA 4DKIA 4FR9A 1GOUA 1RGHA 2CWUA 3WR2A 1VQN3 1TJDA 3CCR3 3BNDA 1NB3I 4K61A 2WGOA 1SIHA 1M1K4 3A5EA 1RKYA 1W2B2 1IQ8A 2LYXA 2W9PA 2F98A 2WOHA 4FMBA 1EUIC 1LQGC 3FKAA 4HOHA 1IU7A 1E97A 3DZLA 3EE1A 1SIIA 4N6OB 4WYKB 1VZZA 2CFKA 1OF5B 3PCRA 5D82A 3WA2X 5IG0A 1IVXA 4R9LA 2CWWA 1RNTA 1VQK3 1TRPA 2YX9A 3FG4A 1N5HA 3S5CA 1ZO2A 1GYBA 1RHLA 5DREA 3J7Yd 3F40A 5CF1A 1KC84 2CHCA 2CFDA 5IG3A 3HJWA 3LWVA 3VSEA 1K28A 2SARA 1X1UA 1I0XA 1LNIA 1OCVA 1OACA 3DGOA 3UB1A 1K734 4LMIA 1B2XA 2B1XB 3LT8A 4LEHA 3ZV0C 5AIIA 3G6E3 3PGBA 3I563 1Q40A 4TX4A 3FF2A 2KF3A 3K0ZA 2XGNA 5LC6A 2F99A 4ORLA 4KT3B 1A90A 1RGFA 3MG2A 3G4S3 1BNGA 2JQ5A 1TFOA 2W56A 1BNRA 1RJOA 1JBSA 4TZ4C 7RNTA 1JB5A 4ILFA 1ZL3A 2CG0A 3S29A 3BNBA 1YHQ3 3DUKA 3U97A 1E3RA 2P09A 4N6MA 2AB4A 3JUMA 3PYJA 5M1AA 2XEPA 3LDFA 1JB2A 5IERA 4WHAA 3U28A 1KQS2 2CK3H 1OHSA 4QWTA 5BXQA 3ZG5A 1OGXA 1YJW3 2P38A 1IVWA 1B2ZA 3KKGA 1RN7A 1Y4KA 3S27A 3URPA 3CXC2 1O7MB 3HI7A 3MSOA 2QEX3 3KZTA 3CPW2 3AMOA 3B4PA 3D3LA 4OVMA 1NJI4 2H0HA 1S04A 1BNSA 1MWUA 1BSAA 3QRDA 5EQLA 3DGNA 4HM8B 2J5TA 5IG5A 4MEIA 4HM4B 5G1LA 1U8CB 1LQMB 2CIUA 4K1VA 1K41A 1FUTA 3SVAA 1US1A 3HIIA 3KIIA 1PU4A 4WFOA 3KCHA 1DMMA 1GS3A 3MWZA 1I70A 4WYKA 1AVKA 1MWRA 1YIT3 4HZ9B 1EQKA 1SQWA 1OF5A 3GZBA 2IUJA 1A2KA 1S5AA 3BNEA 4GB5A 3CCQ3 2WO0A 3WOEB 1TE7A 2E2UA 5DRVA 3N8BA 5AYRB 3TDGA 3DXOA 2AADA 3IUWA 3N54B 3T0UA 3M6XA 5IW9A 1N9JA 1PY3A 2HMMB 1GSPA 3GZRA 1Q7HA 4J5GA 1B20A 1IVUA 2Z7AA 1HZ1A 2GBWB 1M904 1KSIA 3F14A 3NV0B 2ZL8A 4FCMA 3UNLA 1I0VA 1W2ZA 1IVVA 3AGOA 8CHOA 3M65A 3DY5A 2DP9A 1HYFA 1STFI 1UW1A 2CW9A 3DGMA 1VQ93 4Q1TA 1BNEA 1E3VA 1IT8A 1DMNA 1LRAA 3CNXA 1OUNA 1FGTA 3S28A 3PXMA 1BRGA 1BUJA 1AV4A 2KF6A 1K8WA 3V99A 1JZDA 1LNHA 2JDIH 1ROVA 2XF3A 1YIJ3 1VQ63 4X2HA 2KXGA 4WP5A 2E2TA 4XBTA 2E5OA 2L4VA 4R9KA 3C0KA 3X3ZA 1BRNL 3OXAA 2GSPA 1CYUA 3EN1B 1W7CA 3HK4A 3LMLA 1TRQA 3KN4A 2FRXA 2F56A 1YJ93 3D79A 1IDPA 1WMPA 2XGLA 1KD14 5HOHA 7STDA 1GD3A 1K8A4 4Q53A 1QVF2 1RGLA 1YI23 2P0XA 1ZGXA 3EQQB 1TTOA 3K7CA 1VQ73 1I8VA 2MF7A 3CCU3 4EYCA 1DETA 1JBRA 1DMQA 2BU4A 2ZHXB 4K1UA 1L5GB 3LTDA 1QVG2 3WOFB 3N9HA 1RCLA 2J5VA 4WWUC 2Z77A 5G2GA 1AR0A 5IF6A 2HMKB 2O9UX 4HYZA 4BIRA 4CCVA 5AEWB 4MJDA 2MC8A 3WA3A 3OWUA 4HAAA 3HJYA 1GD4A 1TP6A 3CPOA 2KF4A 3V92A 8RNTA 5IEPA 2AAEA 1X1WA 1IK3A 2QA43 1XNEA 1QAKA 2F4YA 1T2HA 5KP3A 3NX0A 3FLJA 3CCV3 1QAFA 1WMNA 4N6NB 3LH4A 2BIRA 3SOAA 1BRIA 1ZE1A 1JN5B 3GWRA 1Q7Y4 4CI2B 1WTHA 1IQYA 1G96A 3ZFZA 3U1WA 5IENA 1T3BA 3OWSA 3VGNA 3RNTA 4O8SA 4FMCA 4DMGA 4L7KA 4IIAA 4LGQA 1UCJA 2W04A 1MWTA 3CNMA 1I2FA 2FGTA 4GSPA 1BOXA 3MKIA 3X41A 1WXWA 3OV4A 2W0QA 3GZXB 2WGQA 4HM0B 1BRHA 3NV0A 1BAOA 1IYYA 2YFLB 2ZA4A 3EB8A 3X3YA 6RNTA 1SJWA 3LTBA 2EY4A 1B2SA 1ISKA 1OGZA 3LWOA 4FCZA 1M1XB 1YVSA 3LOYA 4FMDA 4KVHA 4EBGA 1UCKA 7GSPA 4RBNA 2KAAA 1FYSA 4K90B 4RZMA 1UI7A 5G1KA 1M9GA 1UUWB 3SLUA 1LOXA 1GOVA 2HMLB 3CCS3 1D6ZA 5CXOA 1SARA 4RNYA 1FGMA 1QJGA 1RLSA 3WHOA 2J8XB 2PZVA 4CI3B 5M18A 1WQLB 3MG1A 1UGHI 4KZ1A 4O2HA 1J2BA 5CLKA 4HM3B 1GY7A 3GAXA 3HX8A 3HOHA 3DM8A 3PS8A 1CYVA 1VQ53 4OK0A 1RCKA 2UGIA 1RGEA 3I553 3BB9A 1WNHA 1NWWA 2A15A 3NXJA 1FUSA 4HBRA 3K5TA 2YFJB 1RRLA 1Q9EA 5BU4A 1OH0A 4X2OA 1FW7A 1FA3A 3EX9A 3FG1A 1VQM3 2UX0A 1TU5A 4AKZA 1BSDA 3DGLA 1FGQA 2BMRB 3AHSA 3G16A 3EC9A 3MG3A 4KFDA 2CWVA 1JJ22 5AIGA 1B27A 1GY6A 5AIFA 2CKFB 3CU3A 4JRFA 3F7SA 1YGEA 1LOYA 2BNGA 3G0KA 4XBXA 2KCDA 1V58A 4O3VA 2XSOB 1A2PA 1I3IA 3T8NA 1VQP3 1HKXA 1ROAA 3A76A 1BGSA 2CX0A 1JRQA 1T2IA 2W6JH 3X3XA 1MOLA 1MGWA 2QGUA 3CCJ3 1JN5A 2YFIB 3FGYA 2HMJB 1ULJB 4N6LA 3CC43 5RNTA 5AI1A 3WDGB 1JZOA 3MYTA 5EEOA 1VQQA 2GBXB 4PEJA 5AEUB 4J8TA 4L8OA 4XBYA 2P05A 2I9WA 2K0MA 3LYGA 1UCLA 2Z0TA 1GMRA 1AY7A 3MQKA 1O7HB 1Q814 3I0YA 3X42A 3QK9A 3F8XA 3UL6A 6STDA 3L0RA 2APOA 1GMQA 3OWYA 3EN8A 5CK6A 3CMA3 1BSEA 1ASKA 1EG9B 1YNVX 3FF0A 4I4KA 4R80A 2CX1A 2ANEA 1UCIA
chains in the Genus database with same CATH topology
3NBJA 1N9EA 4EV5A 2BHMA 2FXTA 1ZX2A 3EBTA 5ELUA 4G1MB 2F86B 2GU1A 1T5YA 2Y73A 2O3OA 3JUQA 2HMNB 1JB4A 3RDEA 1R3EA 5LC7A 2QIYA 2Q07A 4XDVA 3NUVA 2IA7A 3CME3 3ALAA 1FUWA 3CCM3 3Q2PA 3JUOA 3LZAA 1DVCA 4HM2B 3F7XA 2R4IA 4MMXB 3Q90A 1CEWI 1TIJA 1Z1SA 3UAIA 1QMAA 3SOYA 4ZM8A 2Z76A 2OTL3 2RSXA 5D81A 2M7OA 1Q824 3LTCA 5D83A 3V98A 1W00A 3LT9A 2GEYA 2CFLA 1QALA 5KP4A 1EA2A 2B78A 1IQXA 3GZYB 4JF8A 4CDLA 1DYUA 1MNLA 3B4OA 4H3UA 2OQEA 1NO3A 4GL6A 3KFQC 2GEXA 3CC73 2XSHB 3MPHA 2LQVA 1LVNA 3ECFA 1FGRA 2BMOB 1LXEA 2XRXB 5FW5A 1IV9A 1S723 4HKVB 3VSYA 3K63A 2FNQA 1D6UA 1OHOA 1WMOA 3EF8A 2KRTA 4HM5B 3F8HA 3X40A 1RRHA 2D1WA 1D6YA 4J9AA 4EV2A 4XDWA 2PNCA 3E99A 5TGNA 1O7NB 1N8QA 2AS0A 3SX1A 5ELJA 1W5ZA 2W03A 3BNCA 4H61A 2HMOB 3NHXA 3CCL3 4AEQA 2BMQB 4BTWA 2OQEC 1VQO3 4O02B 5AYSC 5AIHA 1FGOA 2V1LA 1W01A 3CC23 1TUHA 3EHCA 1YJN3 1STDA 2IUKA 4STDA 1VQ83 1R3FA 1OHPA 3LXUX 2STDA 1JKGB 1VQL3 2ZDJA 2W2CA 4XB5A 4L8PA 2K54A 5KP1A 1DVDA 1YVBI 4FMAA 3GRDA 3MHEA 3ROBA 1R4CA 4U13A 1PFPA 4IT7A 3DMCA 4N3VA 2RGQA 2CG1A 3EBYA 1TFKA 4FCJA 4HJLB 5JPPA 1K9M4 2WOFA 4R4KA 4EXRA 1HU9A 3K9MC 1F8NA 1O7GB 3NBRA 3KE7A 3Q1CA 2E2VA 3RGAA 2XH9A 1IV7A 2INXA 1CQSA 4NHFA 3FH1A 3NQZA 1OPYA 2SBLA 3FZWA 3LTAA 3CCE3 5JPUA 2W9QA 2RCDA 5FGOA 2BO9B 1U5OA 1ULIB 3UL5A 1KWIA 4MMYB 2GU3A 3KSPA 3BLZA 5STDA 4N6TA 1W4NA 2CC3A 2XR8B 5JBSA 3OX9A 4MMZB 4AKYA 1N8R4 1W02A 4BTXA 3IJEB 1NDOB 4IPBA 1BUQA 1NB5I 3RGRA 3HZPA 3UJMA 1EKMA 1IT7A 1Q42A 2OTJ3 4BTYA 3IPTA 3FCSB 1UUVB 1W6YA 3SEDA 3VF1A 4LZIA 3ER7A 1V74A 1AVLA 1SGVA 4KFFA 2OOVA 5IEOA 4NREA 3CD63 5I97A 3FSDA 1JKGA 5HGRA 2IMJA 3WMDA 2CFWA 3O8YA 3B8LA 4XM4A 1N5PA 2BT3A 1W6GA 3S67A 1JNQA 1VQ43 1NU3A 3B7CA 2OCTA 4N6UA 5BVBA 4R1KA 1GY5A 3FG3A 3NM2A 3WODG 2GXFA 3H3HA 4HM7B 3NBBA 2CWTA 1A2VA 3G8ZA 3PZWA 1ZE2A 2XFTA 3IMAB 4EC6A 1Q864 1UI8A 3M8CA 2OOVC 2XFSA 5CF2A 2B24B 3F9SA 1Q40B 1ZS7A 1C7HA 3EJVA 4OUQA 3KSED 3NM7A 2CFGA 1WXXA 2RFRA 3JVCA 3PCSA 2Y74A 4LSOA 2W56B 3D9RA 4N6V0 5EVHA 4HVNA 1W6CA 3NQYA 3STDA 2ML6A 4HM6B 4HM1B 4KFEA 4RNZA 5IG4A 3JUNA 1JV2B 4HZBB 3OW22 1A67A 2ML5A 1O7PB 1O7WB 1SPUA 3G713 2CH9A 3H51A 3T8UA 2C10A 3JUPA 2P0MA 3AMOB 3HIGA 2Z6BA 2OWPA 2C11A 3SXXA 5A0OB 2D42A 4FR9A 2CWUA 1VQN3 3CCR3 3BNDA 1NB3I 4K61A 2WGOA 1SIHA 1M1K4 1RKYA 1W2B2 1IQ8A 2LYXA 2W9PA 2F98A 2WOHA 4FMBA 3FKAA 1IU7A 1E97A 3DZLA 3EE1A 1SIIA 4N6OB 4WYKB 1VZZA 2CFKA 1OF5B 3PCRA 5D82A 3WA2X 5IG0A 1IVXA 4R9LA 2CWWA 1VQK3 2YX9A 3FG4A 1N5HA 3S5CA 1ZO2A 1GYBA 5DREA 3J7Yd 3F40A 5CF1A 1KC84 2CHCA 2CFDA 5IG3A 3VSEA 1K28A 1OCVA 1OACA 3DGOA 3UB1A 1K734 4LMIA 2B1XB 3LT8A 4LEHA 5AIIA 3G6E3 3PGBA 3I563 1Q40A 4TX4A 3FF2A 3K0ZA 2XGNA 5LC6A 2F99A 4ORLA 1A90A 3MG2A 3G4S3 2JQ5A 1TFOA 2W56A 1RJOA 1JB5A 1ZL3A 2CG0A 3S29A 3BNBA 1YHQ3 3DUKA 3U97A 1E3RA 2P09A 4N6MA 2AB4A 3JUMA 3PYJA 2XEPA 3LDFA 1JB2A 5IERA 4WHAA 1KQS2 2CK3H 1OHSA 4QWTA 5BXQA 1OGXA 1YJW3 2P38A 1IVWA 3KKGA 1RN7A 1Y4KA 3S27A 3CXC2 1O7MB 3HI7A 3MSOA 2QEX3 3KZTA 3CPW2 3AMOA 3B4PA 3D3LA 4OVMA 1NJI4 3QRDA 5EQLA 3DGNA 4HM8B 2J5TA 5IG5A 4MEIA 4HM4B 1U8CB 2CIUA 4K1VA 1K41A 3SVAA 1US1A 3HIIA 3KIIA 1PU4A 4WFOA 1DMMA 1GS3A 3MWZA 4WYKA 1AVKA 1YIT3 1EQKA 4HZ9B 1SQWA 1OF5A 3GZBA 2IUJA 1A2KA 1S5AA 3BNEA 4GB5A 3CCQ3 2WO0A 3WOEB 2E2UA 5DRVA 3N8BA 5AYRB 3TDGA 3DXOA 3N54B 3T0UA 5IW9A 1N9JA 2HMMB 3GZRA 1Q7HA 1IVUA 2Z7AA 2GBWB 1M904 1KSIA 3F14A 3NV0B 2ZL8A 4FCMA 3UNLA 1W2ZA 1IVVA 8CHOA 3DY5A 1STFI 1UW1A 2CW9A 3DGMA 1VQ93 4Q1TA 1E3VA 1IT8A 1DMNA 3CNXA 1OUNA 1FGTA 3S28A 3PXMA 1AV4A 1K8WA 3V99A 1LNHA 2JDIH 1ROVA 2XF3A 1YIJ3 1VQ63 4X2HA 2KXGA 4WP5A 2E2TA 4XBTA 2L4VA 4R9KA 3C0KA 3X3ZA 3OXAA 1CYUA 3EN1B 1W7CA 3HK4A 3LMLA 3KN4A 1YJ93 3D79A 1IDPA 1WMPA 2XGLA 1KD14 7STDA 1GD3A 1K8A4 1QVF2 1YI23 2P0XA 3EQQB 3K7CA 1VQ73 2MF7A 3CCU3 4EYCA 1DMQA 4K1UA 1L5GB 3LTDA 1QVG2 3WOFB 3N9HA 2J5VA 4WWUC 2Z77A 5G2GA 1AR0A 5IF6A 2HMKB 2O9UX 4HYZA 4CCVA 5AEWB 4MJDA 2MC8A 3WA3A 3OWUA 3V92A 1GD4A 1TP6A 3CPOA 5IEPA 1IK3A 2QA43 5KP3A 1QAKA 3NX0A 3FLJA 3CCV3 1QAFA 1WMNA 4N6NB 3LH4A 3SOAA 1JN5B 1ZE1A 3GWRA 1Q7Y4 1WTHA 1IQYA 1G96A 5IENA 3U1WA 3OWSA 3VGNA 4O8SA 4FMCA 4DMGA 4L7KA 4IIAA 4LGQA 2W04A 3CNMA 2FGTA 3MKIA 3X41A 1WXWA 3OV4A 2W0QA 3GZXB 2WGQA 4HM0B 3NV0A 2YFLB 3EB8A 3X3YA 1SJWA 3LTBA 1ISKA 1OGZA 4FCZA 4FMDA 1M1XB 3LOYA 4KVHA 4EBGA 4RBNA 4K90B 4RZMA 1UI7A 1M9GA 1UUWB 3SLUA 1LOXA 2HMLB 3CCS3 1D6ZA 5CXOA 4RNYA 1FGMA 1QJGA 2PZVA 1WQLB 3MG1A 4KZ1A 4O2HA 1J2BA 5CLKA 4HM3B 1GY7A 3GAXA 3HX8A 1VQ53 3DM8A 3PS8A 1CYVA 4OK0A 3I553 3BB9A 1WNHA 1NWWA 2A15A 3NXJA 4HBRA 3K5TA 2YFJB 1RRLA 1OH0A 4X2OA 1FA3A 3EX9A 3FG1A 1VQM3 2UX0A 1TU5A 4AKZA 3DGLA 1FGQA 2BMRB 3G16A 3EC9A 3MG3A 4KFDA 2CWVA 1JJ22 5AIGA 1GY6A 5AIFA 2CKFB 3CU3A 4JRFA 3F7SA 1YGEA 2BNGA 3G0KA 4XBXA 2KCDA 4O3VA 2XSOB 3T8NA 1VQP3 1HKXA 1ROAA 3A76A 2CX0A 1JRQA 3X3XA 2W6JH 1MOLA 3CCJ3 2QGUA 1JN5A 2YFIB 3FGYA 2HMJB 1ULJB 4N6LA 3CC43 5AI1A 3WDGB 3MYTA 5EEOA 2GBXB 4PEJA 5AEUB 4J8TA 4L8OA 4XBYA 2P05A 2I9WA 2K0MA 3LYGA 1O7HB 1Q814 3I0YA 3X42A 3QK9A 3F8XA 3UL6A 6STDA 3L0RA 3OWYA 3EN8A 5CK6A 3CMA3 1ASKA 1EG9B 3FF0A 4I4KA 4R80A 2CX1A 4Q53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DMG A;  1J2B A;  4Q1T A;  1IT8 A;  1SGV A;  2CX0 A;  2AB4 A;  1WXW A;  1ZS7 A;  3LDF A;  2AS0 A;  3VSE A;  1K8W A;  1SQW A;  2B78 A;  1T5Y A;  2P38 A;  2J5V A;  1WXX A;  1R3E A;  2Q07 A;  3C0K A;  1IQ8 A;  1Q7H A;  3D79 A;  1IT7 A;  1R3F A;  1ZE1 A;  2J5T A;  3UAI A;  2CWW A;  2CX1 A;  1ZL3 A;  1ZE2 A; 
#chains in the Genus database with same CATH topology
 3NBJ A;  1N9E A;  1RNB A;  2KKU A;  1BU4 A;  4EV5 A;  2BHM A;  1RN4 A;  2FXT A;  1ZX2 A;  3EBT A;  5ELU A;  4G1M B;  4RNT A;  2F86 B;  2GU1 A;  1T5Y A;  2Y73 A;  2O3O A;  3JUQ A;  2HMN B;  1JB4 A;  2IY2 A;  3RDE A;  1R3E A;  5LC7 A;  2QIY A;  2Q07 A;  4XDV A;  1B2M A;  1BAN A;  3NUV A;  1JBT A;  2IA7 A;  3DH2 A;  3CME 3;  3ALA A;  4BL3 A;  1FUW A;  2H0I A;  2HVY A;  3Q2P A;  3CCM 3;  3JUO A;  3LZA A;  1DVC A;  4HM2 B;  2RFK A;  2R4I A;  3F7X A;  1I2E A;  4MMX B;  9RNT A;  3Q90 A;  1CEW I;  1TIJ A;  1Z1S A;  3UAI A;  1QMA A;  3SOY A;  4ZM8 A;  2Z76 A;  1BRS A;  2OTL 3;  2IYJ A;  1BIR A;  2RSX A;  6GSP A;  5D81 A;  1UGI A;  2M7O A;  1Q82 4;  3LTC A;  1V57 A;  5D83 A;  3V98 A;  1W00 A;  3LT9 A;  2GEY A;  2CFL A;  1QAL A;  5KP4 A;  1EA2 A;  2B78 A;  1IQX A;  3GZY B;  4JF8 A;  4CDL A;  3BIR A;  1DYU A;  1MNL A;  2H0G A;  3B4O A;  4H3U A;  4J5K A;  2OQE A;  1NO3 A;  4GL6 A;  1YGW A;  3KFQ C;  3D4A A;  2GEX A;  3CC7 3;  2XSH B;  3MPH A;  2LQV A;  1LVN A;  3ECF A;  1FGR A;  2BMO B;  4BU4 A;  1LXE A;  2XRX B;  5FW5 A;  1IV9 A;  1X1X A;  1I3F A;  4HKV B;  3VSY A;  1S72 3;  3K63 A;  3SYU A;  2FNQ A;  1D6U A;  1OHO A;  1WMO A;  5BIR A;  3EF8 A;  2KRT A;  4HM5 B;  3F8H A;  3X40 A;  1RRH A;  2D1W A;  1D6Y A;  4J9A A;  4EV2 A;  4XDW A;  2PNC A;  3E99 A;  5TGN A;  1O7N B;  1N8Q A;  2AS0 A;  4BL2 A;  3SX1 A;  5ELJ A;  1W5Z A;  1AQZ A;  2W03 A;  1BSC A;  2HMO B;  3BNC A;  3NHX A;  4GHO A;  4H61 A;  2BMQ B;  4AEQ A;  4BTW A;  2OQE C;  1VQO 3;  4O02 B;  5AYS C;  5AIH A;  1FGO A;  2V1L A;  1W01 A;  3CC2 3;  1TUH A;  1MGR A;  3EHC A;  1YJN 3;  1STD A;  2IUK A;  4STD A;  4CPK A;  1BSB A;  1R3F A;  1B21 A;  1VQ8 3;  1OHP A;  3LXU X;  2STD A;  1JKG B;  1VQL 3;  2ZDJ A;  2W2C A;  1LOW A;  2UUG C;  1RGG A;  3BU4 A;  1BNJ A;  4XB5 A;  4L8P A;  2C4B A;  2K54 A;  5KP1 A;  1DVD A;  1YVB I;  4FMA A;  3DGY A;  3LWR A;  3GRD A;  3MHE A;  3ROB A;  1R4C A;  1LOV A;  2RNT A;  4U13 A;  1PFP A;  3M6W A;  3Q3F A;  3DMC A;  4IT7 A;  4N3V A;  2RGQ A;  2CG1 A;  2HOH A;  1TFK A;  3EBY A;  4FCJ A;  4HJL B;  5JPP A;  3HAX A;  1K9M 4;  2WOF A;  4R4K A;  4EXR A;  1MWS A;  1PYL A;  1HU9 A;  1RSN A;  1UOY A;  3K9M C;  1GOY A;  1F8N A;  1O7G B;  2RBI A;  3KE7 A;  3NBR A;  3Q1C A;  2E2V A;  3RGA A;  2XH9 A;  1IV7 A;  2INX A;  1CQS A;  4NHF A;  3FH1 A;  3NQZ A;  3M6V A;  1OPY A;  1GMP A;  2SBL A;  3FZW A;  3LTA A;  3CCE 3;  5JPU A;  2W9Q A;  2RCD A;  5FGO A;  2BO9 B;  3GSP A;  1UUG B;  1BVI A;  1U5O A;  1ULI B;  3UL5 A;  1KWI A;  4MMY B;  2GU3 A;  3KSP A;  1B2U A;  3BLZ A;  1RGC A;  5STD A;  4N6T A;  1W4N A;  1X1Y A;  2CC3 A;  4LYL B;  1ZBO A;  2KF5 A;  2XR8 B;  5JBS A;  2K3D A;  1RGK A;  3OX9 A;  4MMZ B;  4NPB A;  4AKY A;  2F5W A;  1N8R 4;  1W02 A;  4BTX A;  3IJE B;  1NDO B;  4IPB A;  3D5I A;  1R4Y A;  3RGR A;  1NB5 I;  1BUQ A;  3HZP A;  3AGN A;  3UJM A;  1EKM A;  1IT7 A;  1Q42 A;  2OTJ 3;  4BTY A;  3IPT A;  3FCS B;  1UUV B;  1G0T A;  1W6Y A;  3SED A;  3VF1 A;  4LZI A;  3ER7 A;  1V74 A;  1AVL A;  1SGV A;  4KFF A;  2OOV A;  5IEO A;  4NRE A;  5GSP A;  3CD6 3;  5I97 A;  1C54 A;  3FSD A;  1BRK A;  1JKG A;  5HGR A;  2IMJ A;  3WMD A;  2CFW A;  1RMS A;  3O8Y A;  3B8L A;  4CI1 B;  4XM4 A;  1RDS A;  1N5P A;  1RTU A;  2BT3 A;  1W6G A;  3S67 A;  1JNQ A;  3CCL 3;  1VQ4 3;  1G02 A;  1NU3 A;  3B7C A;  2OCT A;  4N6U A;  5BVB A;  4R1K A;  1GY5 A;  3FG3 A;  3NM2 A;  3WOD G;  2GXF A;  3H3H A;  4HM7 B;  3NBB A;  2CWT A;  1A2V A;  3G8Z A;  3PZW A;  4I5Q A;  1RGA A;  1CH0 A;  1ZE2 A;  2XFT A;  3IMA B;  1B3S A;  4EC6 A;  1UI8 A;  1Q86 4;  3M8C A;  2OOV C;  2XFS A;  3M4X A;  5CF2 A;  2B24 B;  3F9S A;  1Q40 B;  3D5G A;  1ZS7 A;  1NNV A;  1C7H A;  3EJV A;  4OUQ A;  3KSE D;  3NM7 A;  4CJN A;  2CFG A;  1WXX A;  1BRJ A;  2RFR A;  3JVC A;  2Y74 A;  3PCS A;  4LSO A;  2AUS A;  3ZG0 A;  2W56 B;  1DE3 A;  3D9R A;  3LWP A;  4N6V 0;  5EVH A;  4HVN A;  1W6C A;  4EW5 A;  3NQY A;  3STD A;  2ML6 A;  5M19 A;  1RN1 A;  2F5M A;  4HM1 B;  1EEJ A;  3AHW A;  4HM6 B;  4KFE A;  4RNZ A;  5IG4 A;  3LWQ A;  1UDI I;  3M6U A;  1JV2 B;  3JUN A;  4HZB B;  3OW2 2;  1A67 A;  2ML5 A;  1BNI A;  1O7P B;  1O7W B;  1SPU A;  3G71 3;  3LJC A;  2CH9 A;  3H51 A;  1BNF A;  2R41 A;  3T8U A;  2C10 A;  1WK2 A;  3JUP A;  1FZU A;  2P0M A;  3AMO B;  3HIG A;  2Z6B A;  2OWP A;  1I2G A;  2C11 A;  3SXX A;  5A0O B;  2D42 A;  2L1S A;  4DKI A;  4FR9 A;  1GOU A;  1RGH A;  2CWU A;  3WR2 A;  1VQN 3;  1TJD A;  3CCR 3;  3BND A;  1NB3 I;  4K61 A;  2WGO A;  1SIH A;  1M1K 4;  3A5E A;  1RKY A;  1W2B 2;  1IQ8 A;  2LYX A;  2W9P A;  2F98 A;  2WOH A;  4FMB A;  1EUI C;  1LQG C;  3FKA A;  4HOH A;  1IU7 A;  1E97 A;  3DZL A;  3EE1 A;  1SII A;  4N6O B;  4WYK B;  1VZZ A;  2CFK A;  1OF5 B;  3PCR A;  5D82 A;  3WA2 X;  5IG0 A;  1IVX A;  4R9L A;  2CWW A;  1RNT A;  1VQK 3;  1TRP A;  2YX9 A;  3FG4 A;  1N5H A;  3S5C A;  1ZO2 A;  1GYB A;  1RHL A;  5DRE A;  3J7Y d;  3F40 A;  5CF1 A;  1KC8 4;  2CHC A;  2CFD A;  5IG3 A;  3HJW A;  3LWV A;  3VSE A;  1K28 A;  2SAR A;  1X1U A;  1I0X A;  1LNI A;  1OCV A;  1OAC A;  3DGO A;  3UB1 A;  1K73 4;  4LMI A;  1B2X A;  2B1X B;  3LT8 A;  4LEH A;  3ZV0 C;  5AII A;  3G6E 3;  3PGB A;  3I56 3;  1Q40 A;  4TX4 A;  3FF2 A;  2KF3 A;  3K0Z A;  2XGN A;  5LC6 A;  2F99 A;  4ORL A;  4KT3 B;  1A90 A;  1RGF A;  3MG2 A;  3G4S 3;  1BNG A;  2JQ5 A;  1TFO A;  2W56 A;  1BNR A;  1RJO A;  1JBS A;  4TZ4 C;  7RNT A;  1JB5 A;  4ILF A;  1ZL3 A;  2CG0 A;  3S29 A;  3BNB A;  1YHQ 3;  3DUK A;  3U97 A;  1E3R A;  2P09 A;  4N6M A;  2AB4 A;  3JUM A;  3PYJ A;  5M1A A;  2XEP A;  3LDF A;  1JB2 A;  5IER A;  4WHA A;  3U28 A;  1KQS 2;  2CK3 H;  1OHS A;  4QWT A;  5BXQ A;  3ZG5 A;  1OGX A;  1YJW 3;  2P38 A;  1IVW A;  1B2Z A;  3KKG A;  1RN7 A;  1Y4K A;  3S27 A;  3URP A;  3CXC 2;  1O7M B;  3HI7 A;  3MSO A;  2QEX 3;  3KZT A;  3CPW 2;  3AMO A;  3B4P A;  3D3L A;  4OVM A;  1NJI 4;  2H0H A;  1S04 A;  1BNS A;  1MWU A;  1BSA A;  3QRD A;  5EQL A;  3DGN A;  4HM8 B;  2J5T A;  5IG5 A;  4MEI A;  4HM4 B;  5G1L A;  1U8C B;  1LQM B;  2CIU A;  4K1V A;  1K41 A;  1FUT A;  3SVA A;  1US1 A;  3HII A;  3KII A;  1PU4 A;  4WFO A;  3KCH A;  1DMM A;  1GS3 A;  3MWZ A;  1I70 A;  4WYK A;  1AVK A;  1MWR A;  1YIT 3;  4HZ9 B;  1EQK A;  1SQW A;  1OF5 A;  3GZB A;  2IUJ A;  1A2K A;  1S5A A;  3BNE A;  4GB5 A;  3CCQ 3;  2WO0 A;  3WOE B;  1TE7 A;  2E2U A;  5DRV A;  3N8B A;  5AYR B;  3TDG A;  3DXO A;  2AAD A;  3IUW A;  3N54 B;  3T0U A;  3M6X A;  5IW9 A;  1N9J A;  1PY3 A;  2HMM B;  1GSP A;  3GZR A;  1Q7H A;  4J5G A;  1B20 A;  1IVU A;  2Z7A A;  1HZ1 A;  2GBW B;  1M90 4;  1KSI A;  3F14 A;  3NV0 B;  2ZL8 A;  4FCM A;  3UNL A;  1I0V A;  1W2Z A;  1IVV A;  3AGO A;  8CHO A;  3M65 A;  3DY5 A;  2DP9 A;  1HYF A;  1STF I;  1UW1 A;  2CW9 A;  3DGM A;  1VQ9 3;  4Q1T A;  1BNE A;  1E3V A;  1IT8 A;  1DMN A;  1LRA A;  3CNX A;  1OUN A;  1FGT A;  3S28 A;  3PXM A;  1BRG A;  1BUJ A;  1AV4 A;  2KF6 A;  1K8W A;  3V99 A;  1JZD A;  1LNH A;  2JDI H;  1ROV A;  2XF3 A;  1YIJ 3;  1VQ6 3;  4X2H A;  2KXG A;  4WP5 A;  2E2T A;  4XBT A;  2E5O A;  2L4V A;  4R9K A;  3C0K A;  3X3Z A;  1BRN L;  3OXA A;  2GSP A;  1CYU A;  3EN1 B;  1W7C A;  3HK4 A;  3LML A;  1TRQ A;  3KN4 A;  2FRX A;  2F56 A;  1YJ9 3;  3D79 A;  1IDP A;  1WMP A;  2XGL A;  1KD1 4;  5HOH A;  7STD A;  1GD3 A;  1K8A 4;  4Q53 A;  1QVF 2;  1RGL A;  1YI2 3;  2P0X A;  1ZGX A;  3EQQ B;  1TTO A;  3K7C A;  1VQ7 3;  1I8V A;  2MF7 A;  3CCU 3;  4EYC A;  1DET A;  1JBR A;  1DMQ A;  2BU4 A;  2ZHX B;  4K1U A;  1L5G B;  3LTD A;  1QVG 2;  3WOF B;  3N9H A;  1RCL A;  2J5V A;  4WWU C;  2Z77 A;  5G2G A;  1AR0 A;  5IF6 A;  2HMK B;  2O9U X;  4HYZ A;  4BIR A;  4CCV A;  5AEW B;  4MJD A;  2MC8 A;  3WA3 A;  3OWU A;  4HAA A;  3HJY A;  1GD4 A;  1TP6 A;  3CPO A;  2KF4 A;  3V92 A;  8RNT A;  5IEP A;  2AAE A;  1X1W A;  1IK3 A;  2QA4 3;  1XNE A;  1QAK A;  2F4Y A;  1T2H A;  5KP3 A;  3NX0 A;  3FLJ A;  3CCV 3;  1QAF A;  1WMN A;  4N6N B;  3LH4 A;  2BIR A;  3SOA A;  1BRI A;  1ZE1 A;  1JN5 B;  3GWR A;  1Q7Y 4;  4CI2 B;  1WTH A;  1IQY A;  1G96 A;  3ZFZ A;  3U1W A;  5IEN A;  1T3B A;  3OWS A;  3VGN A;  3RNT A;  4O8S A;  4FMC A;  4DMG A;  4L7K A;  4IIA A;  4LGQ A;  1UCJ A;  2W04 A;  1MWT A;  3CNM A;  1I2F A;  2FGT A;  4GSP A;  1BOX A;  3MKI A;  3X41 A;  1WXW A;  3OV4 A;  2W0Q A;  3GZX B;  2WGQ A;  4HM0 B;  1BRH A;  3NV0 A;  1BAO A;  1IYY A;  2YFL B;  2ZA4 A;  3EB8 A;  3X3Y A;  6RNT A;  1SJW A;  3LTB A;  2EY4 A;  1B2S A;  1ISK A;  1OGZ A;  3LWO A;  4FCZ A;  1M1X B;  1YVS A;  3LOY A;  4FMD A;  4KVH A;  4EBG A;  1UCK A;  7GSP A;  4RBN A;  2KAA A;  1FYS A;  4K90 B;  4RZM A;  1UI7 A;  5G1K A;  1M9G A;  1UUW B;  3SLU A;  1LOX A;  1GOV A;  2HML B;  3CCS 3;  1D6Z A;  5CXO A;  1SAR A;  4RNY A;  1FGM A;  1QJG A;  1RLS A;  3WHO A;  2J8X B;  2PZV A;  4CI3 B;  5M18 A;  1WQL B;  3MG1 A;  1UGH I;  4KZ1 A;  4O2H A;  1J2B A;  5CLK A;  4HM3 B;  1GY7 A;  3GAX A;  3HX8 A;  3HOH A;  3DM8 A;  3PS8 A;  1CYV A;  1VQ5 3;  4OK0 A;  1RCK A;  2UGI A;  1RGE A;  3I55 3;  3BB9 A;  1WNH A;  1NWW A;  2A15 A;  3NXJ A;  1FUS A;  4HBR A;  3K5T A;  2YFJ B;  1RRL A;  1Q9E A;  5BU4 A;  1OH0 A;  4X2O A;  1FW7 A;  1FA3 A;  3EX9 A;  3FG1 A;  1VQM 3;  2UX0 A;  1TU5 A;  4AKZ A;  1BSD A;  3DGL A;  1FGQ A;  2BMR B;  3AHS A;  3G16 A;  3EC9 A;  3MG3 A;  4KFD A;  2CWV A;  1JJ2 2;  5AIG A;  1B27 A;  1GY6 A;  5AIF A;  2CKF B;  3CU3 A;  4JRF A;  3F7S A;  1YGE A;  1LOY A;  2BNG A;  3G0K A;  4XBX A;  2KCD A;  1V58 A;  4O3V A;  2XSO B;  1A2P A;  1I3I A;  3T8N A;  1VQP 3;  1HKX A;  1ROA A;  3A76 A;  1BGS A;  2CX0 A;  1JRQ A;  1T2I A;  2W6J H;  3X3X A;  1MOL A;  1MGW A;  2QGU A;  3CCJ 3;  1JN5 A;  2YFI B;  3FGY A;  2HMJ B;  1ULJ B;  4N6L A;  3CC4 3;  5RNT A;  5AI1 A;  3WDG B;  1JZO A;  3MYT A;  5EEO A;  1VQQ A;  2GBX B;  4PEJ A;  5AEU B;  4J8T A;  4L8O A;  4XBY A;  2P05 A;  2I9W A;  2K0M A;  3LYG A;  1UCL A;  2Z0T A;  1GMR A;  1AY7 A;  3MQK A;  1O7H B;  1Q81 4;  3I0Y A;  3X42 A;  3QK9 A;  3F8X A;  3UL6 A;  6STD A;  3L0R A;  2APO A;  1GMQ A;  3OWY A;  3EN8 A;  5CK6 A;  3CMA 3;  1BSE A;  1ASK A;  1EG9 B;  1YNV X;  3FF0 A;  4I4K A;  4R80 A;  2CX1 A;  2ANE A;  1UCI A; 
#chains in the Genus database with same CATH homology
 3NBJ A;  1N9E A;  4EV5 A;  2BHM A;  2FXT A;  1ZX2 A;  3EBT A;  5ELU A;  4G1M B;  2F86 B;  2GU1 A;  1T5Y A;  2Y73 A;  2O3O A;  3JUQ A;  2HMN B;  1JB4 A;  3RDE A;  1R3E A;  5LC7 A;  2QIY A;  2Q07 A;  4XDV A;  3NUV A;  2IA7 A;  3CME 3;  3ALA A;  1FUW A;  3CCM 3;  3Q2P A;  3JUO A;  3LZA A;  1DVC A;  4HM2 B;  3F7X A;  2R4I A;  4MMX B;  3Q90 A;  1CEW I;  1TIJ A;  1Z1S A;  3UAI A;  1QMA A;  3SOY A;  4ZM8 A;  2Z76 A;  2OTL 3;  2RSX A;  5D81 A;  2M7O A;  1Q82 4;  3LTC A;  5D83 A;  3V98 A;  1W00 A;  3LT9 A;  2GEY A;  2CFL A;  1QAL A;  5KP4 A;  1EA2 A;  2B78 A;  1IQX A;  3GZY B;  4JF8 A;  4CDL A;  1DYU A;  1MNL A;  3B4O A;  4H3U A;  2OQE A;  1NO3 A;  4GL6 A;  3KFQ C;  2GEX A;  3CC7 3;  2XSH B;  3MPH A;  2LQV A;  1LVN A;  3ECF A;  1FGR A;  2BMO B;  1LXE A;  2XRX B;  5FW5 A;  1IV9 A;  1S72 3;  4HKV B;  3VSY A;  3K63 A;  2FNQ A;  1D6U A;  1OHO A;  1WMO A;  3EF8 A;  2KRT A;  4HM5 B;  3F8H A;  3X40 A;  1RRH A;  2D1W A;  1D6Y A;  4J9A A;  4EV2 A;  4XDW A;  2PNC A;  3E99 A;  5TGN A;  1O7N B;  1N8Q A;  2AS0 A;  3SX1 A;  5ELJ A;  1W5Z A;  2W03 A;  3BNC A;  4H61 A;  2HMO B;  3NHX A;  3CCL 3;  4AEQ A;  2BMQ B;  4BTW A;  2OQE C;  1VQO 3;  4O02 B;  5AYS C;  5AIH A;  1FGO A;  2V1L A;  1W01 A;  3CC2 3;  1TUH A;  3EHC A;  1YJN 3;  1STD A;  2IUK A;  4STD A;  1VQ8 3;  1R3F A;  1OHP A;  3LXU X;  2STD A;  1JKG B;  1VQL 3;  2ZDJ A;  2W2C A;  4XB5 A;  4L8P A;  2K54 A;  5KP1 A;  1DVD A;  1YVB I;  4FMA A;  3GRD A;  3MHE A;  3ROB A;  1R4C A;  4U13 A;  1PFP A;  4IT7 A;  3DMC A;  4N3V A;  2RGQ A;  2CG1 A;  3EBY A;  1TFK A;  4FCJ A;  4HJL B;  5JPP A;  1K9M 4;  2WOF A;  4R4K A;  4EXR A;  1HU9 A;  3K9M C;  1F8N A;  1O7G B;  3NBR A;  3KE7 A;  3Q1C A;  2E2V A;  3RGA A;  2XH9 A;  1IV7 A;  2INX A;  1CQS A;  4NHF A;  3FH1 A;  3NQZ A;  1OPY A;  2SBL A;  3FZW A;  3LTA A;  3CCE 3;  5JPU A;  2W9Q A;  2RCD A;  5FGO A;  2BO9 B;  1U5O A;  1ULI B;  3UL5 A;  1KWI A;  4MMY B;  2GU3 A;  3KSP A;  3BLZ A;  5STD A;  4N6T A;  1W4N A;  2CC3 A;  2XR8 B;  5JBS A;  3OX9 A;  4MMZ B;  4AKY A;  1N8R 4;  1W02 A;  4BTX A;  3IJE B;  1NDO B;  4IPB A;  1BUQ A;  1NB5 I;  3RGR A;  3HZP A;  3UJM A;  1EKM A;  1IT7 A;  1Q42 A;  2OTJ 3;  4BTY A;  3IPT A;  3FCS B;  1UUV B;  1W6Y A;  3SED A;  3VF1 A;  4LZI A;  3ER7 A;  1V74 A;  1AVL A;  1SGV A;  4KFF A;  2OOV A;  5IEO A;  4NRE A;  3CD6 3;  5I97 A;  3FSD A;  1JKG A;  5HGR A;  2IMJ A;  3WMD A;  2CFW A;  3O8Y A;  3B8L A;  4XM4 A;  1N5P A;  2BT3 A;  1W6G A;  3S67 A;  1JNQ A;  1VQ4 3;  1NU3 A;  3B7C A;  2OCT A;  4N6U A;  5BVB A;  4R1K A;  1GY5 A;  3FG3 A;  3NM2 A;  3WOD G;  2GXF A;  3H3H A;  4HM7 B;  3NBB A;  2CWT A;  1A2V A;  3G8Z A;  3PZW A;  1ZE2 A;  2XFT A;  3IMA B;  4EC6 A;  1Q86 4;  1UI8 A;  3M8C A;  2OOV C;  2XFS A;  5CF2 A;  2B24 B;  3F9S A;  1Q40 B;  1ZS7 A;  1C7H A;  3EJV A;  4OUQ A;  3KSE D;  3NM7 A;  2CFG A;  1WXX A;  2RFR A;  3JVC A;  3PCS A;  2Y74 A;  4LSO A;  2W56 B;  3D9R A;  4N6V 0;  5EVH A;  4HVN A;  1W6C A;  3NQY A;  3STD A;  2ML6 A;  4HM6 B;  4HM1 B;  4KFE A;  4RNZ A;  5IG4 A;  3JUN A;  1JV2 B;  4HZB B;  3OW2 2;  1A67 A;  2ML5 A;  1O7P B;  1O7W B;  1SPU A;  3G71 3;  2CH9 A;  3H51 A;  3T8U A;  2C10 A;  3JUP A;  2P0M A;  3AMO B;  3HIG A;  2Z6B A;  2OWP A;  2C11 A;  3SXX A;  5A0O B;  2D42 A;  4FR9 A;  2CWU A;  1VQN 3;  3CCR 3;  3BND A;  1NB3 I;  4K61 A;  2WGO A;  1SIH A;  1M1K 4;  1RKY A;  1W2B 2;  1IQ8 A;  2LYX A;  2W9P A;  2F98 A;  2WOH A;  4FMB A;  3FKA A;  1IU7 A;  1E97 A;  3DZL A;  3EE1 A;  1SII A;  4N6O B;  4WYK B;  1VZZ A;  2CFK A;  1OF5 B;  3PCR A;  5D82 A;  3WA2 X;  5IG0 A;  1IVX A;  4R9L A;  2CWW A;  1VQK 3;  2YX9 A;  3FG4 A;  1N5H A;  3S5C A;  1ZO2 A;  1GYB A;  5DRE A;  3J7Y d;  3F40 A;  5CF1 A;  1KC8 4;  2CHC A;  2CFD A;  5IG3 A;  3VSE A;  1K28 A;  1OCV A;  1OAC A;  3DGO A;  3UB1 A;  1K73 4;  4LMI A;  2B1X B;  3LT8 A;  4LEH A;  5AII A;  3G6E 3;  3PGB A;  3I56 3;  1Q40 A;  4TX4 A;  3FF2 A;  3K0Z A;  2XGN A;  5LC6 A;  2F99 A;  4ORL A;  1A90 A;  3MG2 A;  3G4S 3;  2JQ5 A;  1TFO A;  2W56 A;  1RJO A;  1JB5 A;  1ZL3 A;  2CG0 A;  3S29 A;  3BNB A;  1YHQ 3;  3DUK A;  3U97 A;  1E3R A;  2P09 A;  4N6M A;  2AB4 A;  3JUM A;  3PYJ A;  2XEP A;  3LDF A;  1JB2 A;  5IER A;  4WHA A;  1KQS 2;  2CK3 H;  1OHS A;  4QWT A;  5BXQ A;  1OGX A;  1YJW 3;  2P38 A;  1IVW A;  3KKG A;  1RN7 A;  1Y4K A;  3S27 A;  3CXC 2;  1O7M B;  3HI7 A;  3MSO A;  2QEX 3;  3KZT A;  3CPW 2;  3AMO A;  3B4P A;  3D3L A;  4OVM A;  1NJI 4;  3QRD A;  5EQL A;  3DGN A;  4HM8 B;  2J5T A;  5IG5 A;  4MEI A;  4HM4 B;  1U8C B;  2CIU A;  4K1V A;  1K41 A;  3SVA A;  1US1 A;  3HII A;  3KII A;  1PU4 A;  4WFO A;  1DMM A;  1GS3 A;  3MWZ A;  4WYK A;  1AVK A;  1YIT 3;  1EQK A;  4HZ9 B;  1SQW A;  1OF5 A;  3GZB A;  2IUJ A;  1A2K A;  1S5A A;  3BNE A;  4GB5 A;  3CCQ 3;  2WO0 A;  3WOE B;  2E2U A;  5DRV A;  3N8B A;  5AYR B;  3TDG A;  3DXO A;  3N54 B;  3T0U A;  5IW9 A;  1N9J A;  2HMM B;  3GZR A;  1Q7H A;  1IVU A;  2Z7A A;  2GBW B;  1M90 4;  1KSI A;  3F14 A;  3NV0 B;  2ZL8 A;  4FCM A;  3UNL A;  1W2Z A;  1IVV A;  8CHO A;  3DY5 A;  1STF I;  1UW1 A;  2CW9 A;  3DGM A;  1VQ9 3;  4Q1T A;  1E3V A;  1IT8 A;  1DMN A;  3CNX A;  1OUN A;  1FGT A;  3S28 A;  3PXM A;  1AV4 A;  1K8W A;  3V99 A;  1LNH A;  2JDI H;  1ROV A;  2XF3 A;  1YIJ 3;  1VQ6 3;  4X2H A;  2KXG A;  4WP5 A;  2E2T A;  4XBT A;  2L4V A;  4R9K A;  3C0K A;  3X3Z A;  3OXA A;  1CYU A;  3EN1 B;  1W7C A;  3HK4 A;  3LML A;  3KN4 A;  1YJ9 3;  3D79 A;  1IDP A;  1WMP A;  2XGL A;  1KD1 4;  7STD A;  1GD3 A;  1K8A 4;  1QVF 2;  1YI2 3;  2P0X A;  3EQQ B;  3K7C A;  1VQ7 3;  2MF7 A;  3CCU 3;  4EYC A;  1DMQ A;  4K1U A;  1L5G B;  3LTD A;  1QVG 2;  3WOF B;  3N9H A;  2J5V A;  4WWU C;  2Z77 A;  5G2G A;  1AR0 A;  5IF6 A;  2HMK B;  2O9U X;  4HYZ A;  4CCV A;  5AEW B;  4MJD A;  2MC8 A;  3WA3 A;  3OWU A;  3V92 A;  1GD4 A;  1TP6 A;  3CPO A;  5IEP A;  1IK3 A;  2QA4 3;  5KP3 A;  1QAK A;  3NX0 A;  3FLJ A;  3CCV 3;  1QAF A;  1WMN A;  4N6N B;  3LH4 A;  3SOA A;  1JN5 B;  1ZE1 A;  3GWR A;  1Q7Y 4;  1WTH A;  1IQY A;  1G96 A;  5IEN A;  3U1W A;  3OWS A;  3VGN A;  4O8S A;  4FMC A;  4DMG A;  4L7K A;  4IIA A;  4LGQ A;  2W04 A;  3CNM A;  2FGT A;  3MKI A;  3X41 A;  1WXW A;  3OV4 A;  2W0Q A;  3GZX B;  2WGQ A;  4HM0 B;  3NV0 A;  2YFL B;  3EB8 A;  3X3Y A;  1SJW A;  3LTB A;  1ISK A;  1OGZ A;  4FCZ A;  4FMD A;  1M1X B;  3LOY A;  4KVH A;  4EBG A;  4RBN A;  4K90 B;  4RZM A;  1UI7 A;  1M9G A;  1UUW B;  3SLU A;  1LOX A;  2HML B;  3CCS 3;  1D6Z A;  5CXO A;  4RNY A;  1FGM A;  1QJG A;  2PZV A;  1WQL B;  3MG1 A;  4KZ1 A;  4O2H A;  1J2B A;  5CLK A;  4HM3 B;  1GY7 A;  3GAX A;  3HX8 A;  1VQ5 3;  3DM8 A;  3PS8 A;  1CYV A;  4OK0 A;  3I55 3;  3BB9 A;  1WNH A;  1NWW A;  2A15 A;  3NXJ A;  4HBR A;  3K5T A;  2YFJ B;  1RRL A;  1OH0 A;  4X2O A;  1FA3 A;  3EX9 A;  3FG1 A;  1VQM 3;  2UX0 A;  1TU5 A;  4AKZ A;  3DGL A;  1FGQ A;  2BMR B;  3G16 A;  3EC9 A;  3MG3 A;  4KFD A;  2CWV A;  1JJ2 2;  5AIG A;  1GY6 A;  5AIF A;  2CKF B;  3CU3 A;  4JRF A;  3F7S A;  1YGE A;  2BNG A;  3G0K A;  4XBX A;  2KCD A;  4O3V A;  2XSO B;  3T8N A;  1VQP 3;  1HKX A;  1ROA A;  3A76 A;  2CX0 A;  1JRQ A;  3X3X A;  2W6J H;  1MOL A;  3CCJ 3;  2QGU A;  1JN5 A;  2YFI B;  3FGY A;  2HMJ B;  1ULJ B;  4N6L A;  3CC4 3;  5AI1 A;  3WDG B;  3MYT A;  5EEO A;  2GBX B;  4PEJ A;  5AEU B;  4J8T A;  4L8O A;  4XBY A;  2P05 A;  2I9W A;  2K0M A;  3LYG A;  1O7H B;  1Q81 4;  3I0Y A;  3X42 A;  3QK9 A;  3F8X A;  3UL6 A;  6STD A;  3L0R A;  3OWY A;  3EN8 A;  5CK6 A;  3CMA 3;  1ASK A;  1EG9 B;  3FF0 A;  4I4K A;  4R80 A;  2CX1 A;  4Q53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...