3LWRA

Structure of h/aca rnp bound to a substrate rna containing 4su
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
317
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 96
structure length 317
sequence length 327
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3lwrA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3lwrA02
2APOA 1PRZA 1ZE1A 2AB4A 3LWRA 3UAIA 2AUSA 2ISTA 1R3FA 1V9KA 4LABA 1QYUA 1ZL3A 3LWVA 2RFKA 1KSKA 1KSLA 3HJYA 1ZE2A 1KSVA 3MQKA 1V9FA 3LWOA 4LGTA 3U28A 1R3EA 2I82A 2EY4A 3HAXA 3LWQA 1XPIA 1K8WA 3HJWA 1SGVA 3DH3A 2HVYA 3ZV0C 3LWPA
chains in the Genus database with same CATH superfamily
2E5OA 4CI3B 1WXXA 1R3FA 4LABA 2FRXA 2DP9A 3LWVA 1XNEA 2RFKA 1KSKA 1IT8A 3HJYA 2ANEA 3U28A 1R3EA 2Q07A 1XPIA 1UOYA 4DMGA 1T5YA 2AB4A 1Q7HA 2AUSA 2ISTA 3M6WA 1QYUA 3M4XA 1WK2A 3IUWA 2B78A 1S04A 1V9FA 2CX1A 2P38A 1IQ8A 1SGVA 3ZV0C 2J5VA 3M6UA 2APOA 2CWWA 3LWRA 1WXWA 3LJCA 1SQWA 1J2BA 2KKUA 3M6XA 2CX0A 1ZS7A 1KSLA 1Z2ZA 3C0KA 3D79A 1SI7A 1KSVA 4LGTA 3LWOA 3M65A 2I82A 4Q1TA 1K8WA 3HAXA 4TZ4C 3HJWA 2HVYA 3LWPA 1ZE1A 1PRZA 4CI1B 3UAIA 1V9KA 1ZL3A 2J5TA 1ZBOA 2Z0TA 4CI2B 1ZE2A 3LDFA 1TE7A 3M6VA 3MQKA 3VSEA 2EY4A 1IT7A 3LWQA 1SZWA 2AS0A 3DH3A 1SB7A
chains in the Genus database with same CATH topology
3M6UA 2APOA 1PRZA 1ZE1A 2AB4A 3LWRA 3UAIA 2AUSA 2ISTA 1R3FA 3M6WA 1V9KA 4LABA 1QYUA 3M6XA 1ZL3A 2FRXA 3M4XA 3LWVA 2RFKA 1KSKA 1KSLA 3HJYA 1SB7A 1Z2ZA 1ZE2A 1SI7A 3M6VA 1KSVA 3MQKA 1V9FA 3LWOA 4LGTA 3U28A 1R3EA 2I82A 2EY4A 3HAXA 3LWQA 1XPIA 1K8WA 1UOYA 1SZWA 3HJWA 1SGVA 3DH3A 2HVYA 3ZV0C 3LWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2APO A;  1PRZ A;  1ZE1 A;  2AB4 A;  3LWR A;  3UAI A;  2AUS A;  2IST A;  1R3F A;  1V9K A;  4LAB A;  1QYU A;  1ZL3 A;  3LWV A;  2RFK A;  1KSK A;  1KSL A;  3HJY A;  1ZE2 A;  1KSV A;  3MQK A;  1V9F A;  3LWO A;  4LGT A;  3U28 A;  1R3E A;  2I82 A;  2EY4 A;  3HAX A;  3LWQ A;  1XPI A;  1K8W A;  3HJW A;  1SGV A;  3DH3 A;  2HVY A;  3ZV0 C;  3LWP A; 
#chains in the Genus database with same CATH topology
 2E5O A;  4CI3 B;  1WXX A;  1R3F A;  4LAB A;  2FRX A;  2DP9 A;  3LWV A;  1XNE A;  2RFK A;  1KSK A;  1IT8 A;  3HJY A;  2ANE A;  3U28 A;  1R3E A;  2Q07 A;  1XPI A;  1UOY A;  4DMG A;  1T5Y A;  2AB4 A;  1Q7H A;  2AUS A;  2IST A;  3M6W A;  1QYU A;  3M4X A;  1WK2 A;  3IUW A;  2B78 A;  1S04 A;  1V9F A;  2CX1 A;  2P38 A;  1IQ8 A;  1SGV A;  3ZV0 C;  2J5V A;  3M6U A;  2APO A;  2CWW A;  3LWR A;  1WXW A;  3LJC A;  1SQW A;  1J2B A;  2KKU A;  3M6X A;  2CX0 A;  1ZS7 A;  1KSL A;  1Z2Z A;  3C0K A;  3D79 A;  1SI7 A;  1KSV A;  4LGT A;  3LWO A;  3M65 A;  2I82 A;  4Q1T A;  1K8W A;  3HAX A;  4TZ4 C;  3HJW A;  2HVY A;  3LWP A;  1ZE1 A;  1PRZ A;  4CI1 B;  3UAI A;  1V9K A;  1ZL3 A;  2J5T A;  1ZBO A;  2Z0T A;  4CI2 B;  1ZE2 A;  3LDF A;  1TE7 A;  3M6V A;  3MQK A;  3VSE A;  2EY4 A;  1IT7 A;  3LWQ A;  1SZW A;  2AS0 A;  3DH3 A;  1SB7 A; 
#chains in the Genus database with same CATH homology
 3M6U A;  2APO A;  1PRZ A;  1ZE1 A;  2AB4 A;  3LWR A;  3UAI A;  2AUS A;  2IST A;  1R3F A;  3M6W A;  1V9K A;  4LAB A;  1QYU A;  3M6X A;  1ZL3 A;  2FRX A;  3M4X A;  3LWV A;  2RFK A;  1KSK A;  1KSL A;  3HJY A;  1SB7 A;  1Z2Z A;  1ZE2 A;  1SI7 A;  3M6V A;  1KSV A;  3MQK A;  1V9F A;  3LWO A;  4LGT A;  3U28 A;  1R3E A;  2I82 A;  2EY4 A;  3HAX A;  3LWQ A;  1XPI A;  1K8W A;  1UOY A;  1SZW A;  3HJW A;  1SGV A;  3DH3 A;  2HVY A;  3ZV0 C;  3LWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...