3LWRA

Structure of h/aca rnp bound to a substrate rna containing 4su
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
317
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/rna binding protein/rna
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 96
structure length 317
sequence length 327
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3lwrA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3lwrA02
2HVYA 1XPIA 4LABA 2AUSA 3U28A 4LGTA 3HJYA 1ZL3A 3LWPA 2I82A 3HAXA 1QYUA 1V9FA 1R3EA 3LWQA 1ZE1A 1PRZA 2AB4A 1KSLA 1KSVA 1K8WA 1V9KA 3DH3A 3LWVA 3LWOA 1ZE2A 1R3FA 2RFKA 1SGVA 3UAIA 3LWRA 2EY4A 2ISTA 3ZV0C 2APOA 1KSKA 3MQKA 3HJWA
chains in the Genus database with same CATH superfamily
2AS0A 1ZBOA 1SI7A 2Z0TA 3HJYA 1IT8A 3LWPA 1J2BA 1V9FA 3M6WA 1ZE1A 1KSVA 3M6UA 2DP9A 1ZE2A 1IQ8A 1WXXA 2ISTA 3LDFA 1KSKA 3M65A 1PRZA 3HJWA 1V9KA 2HVYA 2AUSA 4DMGA 4LGTA 2I82A 1Q7HA 3D79A 3VSEA 2J5VA 1UOYA 3LWVA 3IUWA 1R3FA 2Q07A 3UAIA 2P38A 3LWRA 3C0KA 1IT7A 2FRXA 1Z2ZA 4TZ4C 1XPIA 1ZL3A 2J5TA 1ZS7A 1T5YA 3HAXA 1SQWA 1TE7A 4CI1B 3M4XA 1WXWA 1SB7A 2APOA 4Q1TA 3M6VA 3MQKA 4LABA 3U28A 3M6XA 2B78A 3LJCA 4CI3B 2CWWA 1WK2A 1QYUA 1R3EA 3LWQA 2AB4A 1S04A 1KSLA 1K8WA 3DH3A 3LWOA 2RFKA 1SZWA 4CI2B 1SGVA 2KKUA 2E5OA 2EY4A 2CX0A 1XNEA 2CX1A 3ZV0C 2ANEA
chains in the Genus database with same CATH topology
1Z2ZA 2HVYA 1XPIA 4LABA 1SI7A 2AUSA 3U28A 4LGTA 3M6XA 3HJYA 1ZL3A 3LWPA 2I82A 3HAXA 1QYUA 1V9FA 1R3EA 3LWQA 3M6WA 1ZE1A 1PRZA 2AB4A 1KSLA 1KSVA 3M6UA 1UOYA 1V9KA 1K8WA 3DH3A 3LWVA 3LWOA 1ZE2A 1R3FA 2RFKA 1SZWA 3M4XA 1SGVA 3UAIA 3LWRA 1KSKA 2EY4A 2ISTA 3ZV0C 1SB7A 2APOA 2FRXA 3M6VA 3MQKA 3HJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVY A;  1XPI A;  4LAB A;  2AUS A;  3U28 A;  4LGT A;  3HJY A;  1ZL3 A;  3LWP A;  2I82 A;  3HAX A;  1QYU A;  1V9F A;  1R3E A;  3LWQ A;  1ZE1 A;  1PRZ A;  2AB4 A;  1KSL A;  1KSV A;  1K8W A;  1V9K A;  3DH3 A;  3LWV A;  3LWO A;  1ZE2 A;  1R3F A;  2RFK A;  1SGV A;  3UAI A;  3LWR A;  2EY4 A;  2IST A;  3ZV0 C;  2APO A;  1KSK A;  3MQK A;  3HJW A; 
#chains in the Genus database with same CATH topology
 2AS0 A;  1ZBO A;  1SI7 A;  2Z0T A;  3HJY A;  1IT8 A;  3LWP A;  1J2B A;  1V9F A;  3M6W A;  1ZE1 A;  1KSV A;  3M6U A;  2DP9 A;  1ZE2 A;  1IQ8 A;  1WXX A;  2IST A;  3LDF A;  1KSK A;  3M65 A;  1PRZ A;  3HJW A;  1V9K A;  2HVY A;  2AUS A;  4DMG A;  4LGT A;  2I82 A;  1Q7H A;  3D79 A;  3VSE A;  2J5V A;  1UOY A;  3LWV A;  3IUW A;  1R3F A;  2Q07 A;  3UAI A;  2P38 A;  3LWR A;  3C0K A;  1IT7 A;  2FRX A;  1Z2Z A;  4TZ4 C;  1XPI A;  1ZL3 A;  2J5T A;  1ZS7 A;  1T5Y A;  3HAX A;  1SQW A;  1TE7 A;  4CI1 B;  3M4X A;  1WXW A;  1SB7 A;  2APO A;  4Q1T A;  3M6V A;  3MQK A;  4LAB A;  3U28 A;  3M6X A;  2B78 A;  3LJC A;  4CI3 B;  2CWW A;  1WK2 A;  1QYU A;  1R3E A;  3LWQ A;  2AB4 A;  1S04 A;  1KSL A;  1K8W A;  3DH3 A;  3LWO A;  2RFK A;  1SZW A;  4CI2 B;  1SGV A;  2KKU A;  2E5O A;  2EY4 A;  2CX0 A;  1XNE A;  2CX1 A;  3ZV0 C;  2ANE A; 
#chains in the Genus database with same CATH homology
 1Z2Z A;  2HVY A;  1XPI A;  4LAB A;  1SI7 A;  2AUS A;  3U28 A;  4LGT A;  3M6X A;  3HJY A;  1ZL3 A;  3LWP A;  2I82 A;  3HAX A;  1QYU A;  1V9F A;  1R3E A;  3LWQ A;  3M6W A;  1ZE1 A;  1PRZ A;  2AB4 A;  1KSL A;  1KSV A;  3M6U A;  1UOY A;  1V9K A;  1K8W A;  3DH3 A;  3LWV A;  3LWO A;  1ZE2 A;  1R3F A;  2RFK A;  1SZW A;  3M4X A;  1SGV A;  3UAI A;  3LWR A;  1KSK A;  2EY4 A;  2IST A;  3ZV0 C;  1SB7 A;  2APO A;  2FRX A;  3M6V A;  3MQK A;  3HJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...