3HJWA

Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
327
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna
molecule keywords Pseudouridine synthase Cbf5
total genus 96
structure length 327
sequence length 327
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3hjwA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3hjwA02
2I82A 4LABA 1QYUA 2HVYA 3MQKA 1ZE2A 1V9FA 1ZL3A 4LGTA 1KSKA 3DH3A 3LWOA 2APOA 1R3FA 3LWRA 3HAXA 3LWPA 3U28A 3HJWA 2RFKA 3HJYA 1XPIA 3ZV0C 3LWVA 2ISTA 1K8WA 1KSVA 2AB4A 1ZE1A 1KSLA 1V9KA 1R3EA 3LWQA 3UAIA 2AUSA 1PRZA 1SGVA 2EY4A
chains in the Genus database with same CATH superfamily
1WK2A 2B78A 1KSKA 2KKUA 3DH3A 3LWOA 1SB7A 3LWRA 3LWPA 3HAXA 1IQ8A 1T5YA 3HJYA 1K8WA 2Z0TA 2CX0A 1SGVA 1PRZA 2E5OA 2J5VA 4CI1B 1SQWA 1SZWA 2I82A 3M65A 4LABA 1XNEA 1ZE2A 2CWWA 1ZBOA 2P38A 1IT8A 1WXWA 4DMGA 2ANEA 3LJCA 2AB4A 3M6WA 3VSEA 3M6XA 3UAIA 3LWQA 2AUSA 1R3EA 4TZ4C 1TE7A 1J2BA 2J5TA 1QYUA 1UOYA 3C0KA 1V9FA 4LGTA 2CX1A 3M6UA 1ZS7A 2APOA 1WXXA 2AS0A 3U28A 3HJWA 2RFKA 1KSVA 3IUWA 1ZE1A 1SI7A 3D79A 4CI3B 2DP9A 2HVYA 3MQKA 1ZL3A 1Z2ZA 3LDFA 1R3FA 2FRXA 1Q7HA 1XPIA 3ZV0C 3LWVA 1IT7A 3M4XA 2ISTA 2Q07A 1S04A 3M6VA 1KSLA 1V9KA 4CI2B 4Q1TA 2EY4A
chains in the Genus database with same CATH topology
1SZWA 2I82A 4LABA 1QYUA 2HVYA 3MQKA 1UOYA 1ZE2A 1V9FA 1ZL3A 4LGTA 3M6UA 1KSKA 1Z2ZA 3DH3A 3LWOA 1SB7A 2APOA 1R3FA 2FRXA 3LWRA 3HAXA 3U28A 3LWPA 3HJWA 2RFKA 3HJYA 1XPIA 3ZV0C 3LWVA 2ISTA 3M4XA 1K8WA 1KSVA 2AB4A 3M6VA 1ZE1A 1KSLA 3M6WA 1SI7A 1V9KA 3M6XA 3LWQA 3UAIA 2AUSA 1PRZA 1SGVA 1R3EA 2EY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I82 A;  4LAB A;  1QYU A;  2HVY A;  3MQK A;  1ZE2 A;  1V9F A;  1ZL3 A;  4LGT A;  1KSK A;  3DH3 A;  3LWO A;  2APO A;  1R3F A;  3LWR A;  3HAX A;  3LWP A;  3U28 A;  3HJW A;  2RFK A;  3HJY A;  1XPI A;  3ZV0 C;  3LWV A;  2IST A;  1K8W A;  1KSV A;  2AB4 A;  1ZE1 A;  1KSL A;  1V9K A;  1R3E A;  3LWQ A;  3UAI A;  2AUS A;  1PRZ A;  1SGV A;  2EY4 A; 
#chains in the Genus database with same CATH topology
 1WK2 A;  2B78 A;  1KSK A;  2KKU A;  3DH3 A;  3LWO A;  1SB7 A;  3LWR A;  3LWP A;  3HAX A;  1IQ8 A;  1T5Y A;  3HJY A;  1K8W A;  2Z0T A;  2CX0 A;  1SGV A;  1PRZ A;  2E5O A;  2J5V A;  4CI1 B;  1SQW A;  1SZW A;  2I82 A;  3M65 A;  4LAB A;  1XNE A;  1ZE2 A;  2CWW A;  1ZBO A;  2P38 A;  1IT8 A;  1WXW A;  4DMG A;  2ANE A;  3LJC A;  2AB4 A;  3M6W A;  3VSE A;  3M6X A;  3UAI A;  3LWQ A;  2AUS A;  1R3E A;  4TZ4 C;  1TE7 A;  1J2B A;  2J5T A;  1QYU A;  1UOY A;  3C0K A;  1V9F A;  4LGT A;  2CX1 A;  3M6U A;  1ZS7 A;  2APO A;  1WXX A;  2AS0 A;  3U28 A;  3HJW A;  2RFK A;  1KSV A;  3IUW A;  1ZE1 A;  1SI7 A;  3D79 A;  4CI3 B;  2DP9 A;  2HVY A;  3MQK A;  1ZL3 A;  1Z2Z A;  3LDF A;  1R3F A;  2FRX A;  1Q7H A;  1XPI A;  3ZV0 C;  3LWV A;  1IT7 A;  3M4X A;  2IST A;  2Q07 A;  1S04 A;  3M6V A;  1KSL A;  1V9K A;  4CI2 B;  4Q1T A;  2EY4 A; 
#chains in the Genus database with same CATH homology
 1SZW A;  2I82 A;  4LAB A;  1QYU A;  2HVY A;  3MQK A;  1UOY A;  1ZE2 A;  1V9F A;  1ZL3 A;  4LGT A;  3M6U A;  1KSK A;  1Z2Z A;  3DH3 A;  3LWO A;  1SB7 A;  2APO A;  1R3F A;  2FRX A;  3LWR A;  3HAX A;  3U28 A;  3LWP A;  3HJW A;  2RFK A;  3HJY A;  1XPI A;  3ZV0 C;  3LWV A;  2IST A;  3M4X A;  1K8W A;  1KSV A;  2AB4 A;  3M6V A;  1ZE1 A;  1KSL A;  3M6W A;  1SI7 A;  1V9K A;  3M6X A;  3LWQ A;  3UAI A;  2AUS A;  1PRZ A;  1SGV A;  1R3E A;  2EY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...