3HJWA

Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
327
Chain Sequence
b'RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna
total genus 96
structure length 327
sequence length 327
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3hjwA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3hjwA02
3U28A 1V9FA 3LWOA 3LWRA 1KSLA 1R3EA 2AUSA 3LWQA 4LABA 1XPIA 2HVYA 3HAXA 3HJWA 2AB4A 3HJYA 3DH3A 2ISTA 1K8WA 1KSVA 1QYUA 3LWPA 3ZV0C 3LWVA 1V9KA 4LGTA 1R3FA 1SGVA 1ZL3A 3UAIA 1ZE1A 2EY4A 1KSKA 1ZE2A 2I82A 1PRZA 2RFKA 3MQKA 2APOA
chains in the Genus database with same CATH superfamily
3U28A 3M6XA 3M6UA 2Q07A 4CI3B 3DH3A 1KSVA 2E5OA 4TZ4C 3D79A 2J5TA 1R3FA 4CI1B 2CWWA 3UAIA 1Z2ZA 1ZE1A 1ZE2A 2FRXA 2ANEA 1PRZA 3VSEA 2KKUA 2APOA 1XNEA 2Z0TA 2B78A 3LWOA 3LWRA 3LWQA 1SI7A 1XPIA 1SB7A 2HVYA 3HJYA 1QYUA 3ZV0C 1T5YA 1V9KA 4LGTA 1SGVA 1J2BA 1UOYA 1IT8A 1R3EA 2AUSA 1IQ8A 2J5VA 3C0KA 3HAXA 4DMGA 3HJWA 2ISTA 1ZS7A 1K8WA 3IUWA 3M4XA 1WK2A 2CX0A 2CX1A 3LWVA 1Q7HA 2AS0A 1WXXA 4Q1TA 2EY4A 1IT7A 2DP9A 3M6WA 3MQKA 3M65A 1ZBOA 1V9FA 1KSLA 3LJCA 4LABA 2P38A 3LDFA 2AB4A 3LWPA 1S04A 1SQWA 3M6VA 1ZL3A 1TE7A 1SZWA 1KSKA 4CI2B 2I82A 2RFKA 1WXWA
chains in the Genus database with same CATH topology
3U28A 3M6XA 3M6UA 1V9FA 3LWOA 3LWRA 1KSLA 1R3EA 2AUSA 3LWQA 4LABA 1SI7A 1XPIA 1SB7A 2HVYA 3HAXA 3HJWA 2AB4A 3HJYA 3DH3A 2ISTA 1K8WA 1KSVA 1QYUA 3LWPA 3ZV0C 3M4XA 3LWVA 1V9KA 4LGTA 1R3FA 1SGVA 3M6VA 1ZL3A 3UAIA 1Z2ZA 1UOYA 1ZE1A 2EY4A 1SZWA 1KSKA 1ZE2A 2I82A 2FRXA 3M6WA 1PRZA 2RFKA 3MQKA 2APOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U28 A;  1V9F A;  3LWO A;  3LWR A;  1KSL A;  1R3E A;  2AUS A;  3LWQ A;  4LAB A;  1XPI A;  2HVY A;  3HAX A;  3HJW A;  2AB4 A;  3HJY A;  3DH3 A;  2IST A;  1K8W A;  1KSV A;  1QYU A;  3LWP A;  3ZV0 C;  3LWV A;  1V9K A;  4LGT A;  1R3F A;  1SGV A;  1ZL3 A;  3UAI A;  1ZE1 A;  2EY4 A;  1KSK A;  1ZE2 A;  2I82 A;  1PRZ A;  2RFK A;  3MQK A;  2APO A; 
#chains in the Genus database with same CATH topology
 3U28 A;  3M6X A;  3M6U A;  2Q07 A;  4CI3 B;  3DH3 A;  1KSV A;  2E5O A;  4TZ4 C;  3D79 A;  2J5T A;  1R3F A;  4CI1 B;  2CWW A;  3UAI A;  1Z2Z A;  1ZE1 A;  1ZE2 A;  2FRX A;  2ANE A;  1PRZ A;  3VSE A;  2KKU A;  2APO A;  1XNE A;  2Z0T A;  2B78 A;  3LWO A;  3LWR A;  3LWQ A;  1SI7 A;  1XPI A;  1SB7 A;  2HVY A;  3HJY A;  1QYU A;  3ZV0 C;  1T5Y A;  1V9K A;  4LGT A;  1SGV A;  1J2B A;  1UOY A;  1IT8 A;  1R3E A;  2AUS A;  1IQ8 A;  2J5V A;  3C0K A;  3HAX A;  4DMG A;  3HJW A;  2IST A;  1ZS7 A;  1K8W A;  3IUW A;  3M4X A;  1WK2 A;  2CX0 A;  2CX1 A;  3LWV A;  1Q7H A;  2AS0 A;  1WXX A;  4Q1T A;  2EY4 A;  1IT7 A;  2DP9 A;  3M6W A;  3MQK A;  3M65 A;  1ZBO A;  1V9F A;  1KSL A;  3LJC A;  4LAB A;  2P38 A;  3LDF A;  2AB4 A;  3LWP A;  1S04 A;  1SQW A;  3M6V A;  1ZL3 A;  1TE7 A;  1SZW A;  1KSK A;  4CI2 B;  2I82 A;  2RFK A;  1WXW A; 
#chains in the Genus database with same CATH homology
 3U28 A;  3M6X A;  3M6U A;  1V9F A;  3LWO A;  3LWR A;  1KSL A;  1R3E A;  2AUS A;  3LWQ A;  4LAB A;  1SI7 A;  1XPI A;  1SB7 A;  2HVY A;  3HAX A;  3HJW A;  2AB4 A;  3HJY A;  3DH3 A;  2IST A;  1K8W A;  1KSV A;  1QYU A;  3LWP A;  3ZV0 C;  3M4X A;  3LWV A;  1V9K A;  4LGT A;  1R3F A;  1SGV A;  3M6V A;  1ZL3 A;  3UAI A;  1Z2Z A;  1UOY A;  1ZE1 A;  2EY4 A;  1SZW A;  1KSK A;  1ZE2 A;  2I82 A;  2FRX A;  3M6W A;  1PRZ A;  2RFK A;  3MQK A;  2APO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...