3HJWA

Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
327
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna
total genus 96
structure length 327
sequence length 327
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3hjwA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3hjwA02
1ZE1A 4LGTA 3UAIA 1ZE2A 2EY4A 3ZV0C 3LWOA 3LWRA 1PRZA 2HVYA 1R3FA 3LWPA 1XPIA 1K8WA 3HAXA 2RFKA 1SGVA 3LWQA 1KSVA 1ZL3A 2ISTA 3U28A 1KSKA 2AB4A 3MQKA 1R3EA 2AUSA 1V9KA 3LWVA 1QYUA 4LABA 3HJYA 1V9FA 3HJWA 1KSLA 2APOA 2I82A 3DH3A
chains in the Genus database with same CATH superfamily
2EY4A 3LWRA 1SZWA 2HVYA 3LWPA 2ANEA 1WXXA 2J5TA 3LWQA 3C0KA 1KSKA 1WK2A 3MQKA 4CI1B 1SB7A 3HJYA 1WXWA 3M4XA 2I82A 2E5OA 2FRXA 3UAIA 1XNEA 3ZV0C 1PRZA 2B78A 1UOYA 2CWWA 1ZL3A 2KKUA 1ZBOA 4DMGA 4CI2B 1R3EA 1V9KA 4Q1TA 1QYUA 1V9FA 3VSEA 2APOA 3LDFA 1IT8A 3M6WA 1T5YA 1ZE1A 3LWOA 1XPIA 1K8WA 3HAXA 1ZS7A 2CX0A 1KSVA 1TE7A 2AB4A 1SI7A 2AUSA 1J2BA 2Z0TA 3D79A 2CX1A 4LABA 4TZ4C 1S04A 1KSLA 3LJCA 2Q07A 1ZE2A 4LGTA 2J5VA 3M6UA 1R3FA 1Z2ZA 1IQ8A 2P38A 2AS0A 2RFKA 1SGVA 1SQWA 3M6VA 2ISTA 3U28A 3M6XA 3M65A 1IT7A 2DP9A 3LWVA 3IUWA 3HJWA 4CI3B 1Q7HA 3DH3A
chains in the Genus database with same CATH topology
1ZE1A 4LGTA 3UAIA 1ZE2A 2EY4A 3ZV0C 3LWOA 3LWRA 1PRZA 3M6UA 1SZWA 2HVYA 1R3FA 1Z2ZA 3LWPA 1UOYA 1XPIA 1K8WA 3HAXA 2RFKA 1SGVA 3LWQA 1KSVA 1ZL3A 3M6VA 2ISTA 3U28A 1KSKA 3M6XA 1SI7A 2AB4A 3MQKA 1R3EA 2AUSA 1V9KA 3LWVA 1QYUA 4LABA 1SB7A 3HJYA 1V9FA 3M4XA 3HJWA 1KSLA 2APOA 2I82A 3M6WA 3DH3A 2FRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZE1 A;  4LGT A;  3UAI A;  1ZE2 A;  2EY4 A;  3ZV0 C;  3LWO A;  3LWR A;  1PRZ A;  2HVY A;  1R3F A;  3LWP A;  1XPI A;  1K8W A;  3HAX A;  2RFK A;  1SGV A;  3LWQ A;  1KSV A;  1ZL3 A;  2IST A;  3U28 A;  1KSK A;  2AB4 A;  3MQK A;  1R3E A;  2AUS A;  1V9K A;  3LWV A;  1QYU A;  4LAB A;  3HJY A;  1V9F A;  3HJW A;  1KSL A;  2APO A;  2I82 A;  3DH3 A; 
#chains in the Genus database with same CATH topology
 2EY4 A;  3LWR A;  1SZW A;  2HVY A;  3LWP A;  2ANE A;  1WXX A;  2J5T A;  3LWQ A;  3C0K A;  1KSK A;  1WK2 A;  3MQK A;  4CI1 B;  1SB7 A;  3HJY A;  1WXW A;  3M4X A;  2I82 A;  2E5O A;  2FRX A;  3UAI A;  1XNE A;  3ZV0 C;  1PRZ A;  2B78 A;  1UOY A;  2CWW A;  1ZL3 A;  2KKU A;  1ZBO A;  4DMG A;  4CI2 B;  1R3E A;  1V9K A;  4Q1T A;  1QYU A;  1V9F A;  3VSE A;  2APO A;  3LDF A;  1IT8 A;  3M6W A;  1T5Y A;  1ZE1 A;  3LWO A;  1XPI A;  1K8W A;  3HAX A;  1ZS7 A;  2CX0 A;  1KSV A;  1TE7 A;  2AB4 A;  1SI7 A;  2AUS A;  1J2B A;  2Z0T A;  3D79 A;  2CX1 A;  4LAB A;  4TZ4 C;  1S04 A;  1KSL A;  3LJC A;  2Q07 A;  1ZE2 A;  4LGT A;  2J5V A;  3M6U A;  1R3F A;  1Z2Z A;  1IQ8 A;  2P38 A;  2AS0 A;  2RFK A;  1SGV A;  1SQW A;  3M6V A;  2IST A;  3U28 A;  3M6X A;  3M65 A;  1IT7 A;  2DP9 A;  3LWV A;  3IUW A;  3HJW A;  4CI3 B;  1Q7H A;  3DH3 A; 
#chains in the Genus database with same CATH homology
 1ZE1 A;  4LGT A;  3UAI A;  1ZE2 A;  2EY4 A;  3ZV0 C;  3LWO A;  3LWR A;  1PRZ A;  3M6U A;  1SZW A;  2HVY A;  1R3F A;  1Z2Z A;  3LWP A;  1UOY A;  1XPI A;  1K8W A;  3HAX A;  2RFK A;  1SGV A;  3LWQ A;  1KSV A;  1ZL3 A;  3M6V A;  2IST A;  3U28 A;  1KSK A;  3M6X A;  1SI7 A;  2AB4 A;  3MQK A;  1R3E A;  2AUS A;  1V9K A;  3LWV A;  1QYU A;  4LAB A;  1SB7 A;  3HJY A;  1V9F A;  3M4X A;  3HJW A;  1KSL A;  2APO A;  2I82 A;  3M6W A;  3DH3 A;  2FRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...