3HJWA

Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
327
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/rna
molecule keywords Pseudouridine synthase Cbf5
publication title Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 96
structure length 327
sequence length 327
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3hjwA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3hjwA02
3HAXA 1R3FA 3LWVA 1XPIA 3LWRA 2RFKA 3U28A 1ZE1A 2AUSA 2I82A 1KSLA 1PRZA 1K8WA 2APOA 3DH3A 1V9FA 3HJWA 1ZE2A 3LWPA 3MQKA 1V9KA 3HJYA 1R3EA 1ZL3A 2ISTA 1QYUA 2EY4A 4LGTA 3ZV0C 3LWQA 1SGVA 1KSVA 1KSKA 2HVYA 2AB4A 3LWOA 3UAIA 4LABA
chains in the Genus database with same CATH superfamily
3HAXA 1IT8A 1ZE1A 1T5YA 3M4XA 2CX1A 3M6UA 2B78A 2FRXA 2AS0A 2Q07A 1IT7A 1WXXA 2EY4A 4LGTA 2E5OA 1KSKA 1SB7A 4CI1B 2DP9A 1ZS7A 2HVYA 1K8WA 4TZ4C 3LWVA 4DMGA 3LWRA 4CI3B 1SZWA 2CX0A 4CI2B 3C0KA 3MQKA 2Z0TA 3M65A 2ANEA 3LWQA 2J5TA 4Q1TA 3IUWA 1R3FA 3D79A 1IQ8A 1SQWA 1XPIA 3M6XA 2RFKA 1TE7A 1KSLA 1PRZA 2APOA 1Q7HA 1V9FA 1UOYA 1ZE2A 3LWPA 2CWWA 3LJCA 3LDFA 1ZL3A 1J2BA 2KKUA 1SI7A 1QYUA 1SGVA 1WK2A 4LABA 2P38A 3U28A 2J5VA 2AUSA 1WXWA 2I82A 1S04A 3DH3A 3M6VA 3HJWA 3VSEA 3M6WA 1V9KA 3HJYA 1R3EA 2ISTA 1ZBOA 1Z2ZA 1XNEA 3ZV0C 1KSVA 2AB4A 3LWOA 3UAIA
chains in the Genus database with same CATH topology
3HAXA 1R3FA 3LWVA 1XPIA 3M6XA 3LWRA 2RFKA 3U28A 1ZE1A 2AUSA 1SZWA 2I82A 1KSLA 1PRZA 1K8WA 3M4XA 2APOA 3DH3A 3M6UA 3M6VA 1V9FA 1UOYA 3HJWA 1ZE2A 3LWPA 2FRXA 3MQKA 3M6WA 1V9KA 3HJYA 1R3EA 1ZL3A 2ISTA 1SI7A 1QYUA 1Z2ZA 2EY4A 4LGTA 3ZV0C 3LWQA 1SGVA 1KSVA 1KSKA 1SB7A 2HVYA 2AB4A 3LWOA 3UAIA 4LABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAX A;  1R3F A;  3LWV A;  1XPI A;  3LWR A;  2RFK A;  3U28 A;  1ZE1 A;  2AUS A;  2I82 A;  1KSL A;  1PRZ A;  1K8W A;  2APO A;  3DH3 A;  1V9F A;  3HJW A;  1ZE2 A;  3LWP A;  3MQK A;  1V9K A;  3HJY A;  1R3E A;  1ZL3 A;  2IST A;  1QYU A;  2EY4 A;  4LGT A;  3ZV0 C;  3LWQ A;  1SGV A;  1KSV A;  1KSK A;  2HVY A;  2AB4 A;  3LWO A;  3UAI A;  4LAB A; 
#chains in the Genus database with same CATH topology
 3HAX A;  1IT8 A;  1ZE1 A;  1T5Y A;  3M4X A;  2CX1 A;  3M6U A;  2B78 A;  2FRX A;  2AS0 A;  2Q07 A;  1IT7 A;  1WXX A;  2EY4 A;  4LGT A;  2E5O A;  1KSK A;  1SB7 A;  4CI1 B;  2DP9 A;  1ZS7 A;  2HVY A;  1K8W A;  4TZ4 C;  3LWV A;  4DMG A;  3LWR A;  4CI3 B;  1SZW A;  2CX0 A;  4CI2 B;  3C0K A;  3MQK A;  2Z0T A;  3M65 A;  2ANE A;  3LWQ A;  2J5T A;  4Q1T A;  3IUW A;  1R3F A;  3D79 A;  1IQ8 A;  1SQW A;  1XPI A;  3M6X A;  2RFK A;  1TE7 A;  1KSL A;  1PRZ A;  2APO A;  1Q7H A;  1V9F A;  1UOY A;  1ZE2 A;  3LWP A;  2CWW A;  3LJC A;  3LDF A;  1ZL3 A;  1J2B A;  2KKU A;  1SI7 A;  1QYU A;  1SGV A;  1WK2 A;  4LAB A;  2P38 A;  3U28 A;  2J5V A;  2AUS A;  1WXW A;  2I82 A;  1S04 A;  3DH3 A;  3M6V A;  3HJW A;  3VSE A;  3M6W A;  1V9K A;  3HJY A;  1R3E A;  2IST A;  1ZBO A;  1Z2Z A;  1XNE A;  3ZV0 C;  1KSV A;  2AB4 A;  3LWO A;  3UAI A; 
#chains in the Genus database with same CATH homology
 3HAX A;  1R3F A;  3LWV A;  1XPI A;  3M6X A;  3LWR A;  2RFK A;  3U28 A;  1ZE1 A;  2AUS A;  1SZW A;  2I82 A;  1KSL A;  1PRZ A;  1K8W A;  3M4X A;  2APO A;  3DH3 A;  3M6U A;  3M6V A;  1V9F A;  1UOY A;  3HJW A;  1ZE2 A;  3LWP A;  2FRX A;  3MQK A;  3M6W A;  1V9K A;  3HJY A;  1R3E A;  1ZL3 A;  2IST A;  1SI7 A;  1QYU A;  1Z2Z A;  2EY4 A;  4LGT A;  3ZV0 C;  3LWQ A;  1SGV A;  1KSV A;  1KSK A;  1SB7 A;  2HVY A;  2AB4 A;  3LWO A;  3UAI A;  4LAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...