1ZBOA

X-ray crystal structure of protein bpp1347 from bordetella parapertussis. northeast structural genomics consortium target bor27.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
197
Chain Sequence
AEIPLFPLSNALFPAGVLRLRVFEIRYLDMVRRCIADGSEFGVVVLEQGTEVRRPDGREVLARAGTMARIDHWEAPMPALLELACTGTGRFRLHACTQGKYGLWTGQAEPVPDDAPLEVPPELARSASALGRLIARLQREGVPPHIMPMAAPFRLDDCGWVADRWAEMLSLPPADKARLLLLPPLDRLREIDAVLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein BPP1347
publication title Crystal Structure of the Hypothetical Protein BPP1347 from Bordetella parapertussis, Northeast Structural Genomics Target BoR27.
rcsb
source organism Bordetella parapertussis
molecule tags Structural genomics, unknown function
total genus 45
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4060.10 Mainly Alpha Orthogonal Bundle LON domain-like fold BPP1347 like domain 1zboA02
2.30.130.40 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 LON domain-like 1zboA01
1ZBOA 3LJCA 4TZ4C 4CI1B 3M65A 4CI2B 4CI3B 2ANEA
chains in the Genus database with same CATH superfamily
1IT8A 1XNEA 1R3FA 3LJCA 1UOYA 1IQ8A 1S04A 1TE7A 1WK2A 1WXXA 2B78A 4CI1B 2RFKA 4CI2B 3M4XA 1ZL3A 3LWRA 1ZBOA 1SQWA 2AB4A 3LWQA 3HJYA 2KKUA 2CX0A 3M6WA 3UAIA 3LDFA 2CX1A 1ZE2A 3M6XA 1R3EA 1Q7HA 1SGVA 3ZV0C 3LWPA 3MQKA 2ANEA 1T5YA 1WXWA 2P38A 2AS0A 3D79A 1K8WA 4TZ4C 1IT7A 2Q07A 1ZE1A 2J5VA 3VSEA 2APOA 4DMGA 2J5TA 3IUWA 2FRXA 3LWVA 3LWOA 1ZS7A 1J2BA 2Z0TA 3U28A 3HJWA 2DP9A 2EY4A 3M6UA 4CI3B 2HVYA 4Q1TA 3M65A 2CWWA 3HAXA 3M6VA 2E5OA 3C0KA 2AUSA
chains in the Genus database with same CATH topology
1ZBOA 3LJCA 4TZ4C 4CI1B 3M65A 4CI2B 4CI3B 2ANEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBO A;  3LJC A;  4TZ4 C;  4CI1 B;  3M65 A;  4CI2 B;  4CI3 B;  2ANE A; 
#chains in the Genus database with same CATH topology
 1IT8 A;  1XNE A;  1R3F A;  3LJC A;  1UOY A;  1IQ8 A;  1S04 A;  1TE7 A;  1WK2 A;  1WXX A;  2B78 A;  4CI1 B;  2RFK A;  4CI2 B;  3M4X A;  1ZL3 A;  3LWR A;  1ZBO A;  1SQW A;  2AB4 A;  3LWQ A;  3HJY A;  2KKU A;  2CX0 A;  3M6W A;  3UAI A;  3LDF A;  2CX1 A;  1ZE2 A;  3M6X A;  1R3E A;  1Q7H A;  1SGV A;  3ZV0 C;  3LWP A;  3MQK A;  2ANE A;  1T5Y A;  1WXW A;  2P38 A;  2AS0 A;  3D79 A;  1K8W A;  4TZ4 C;  1IT7 A;  2Q07 A;  1ZE1 A;  2J5V A;  3VSE A;  2APO A;  4DMG A;  2J5T A;  3IUW A;  2FRX A;  3LWV A;  3LWO A;  1ZS7 A;  1J2B A;  2Z0T A;  3U28 A;  3HJW A;  2DP9 A;  2EY4 A;  3M6U A;  4CI3 B;  2HVY A;  4Q1T A;  3M65 A;  2CWW A;  3HAX A;  3M6V A;  2E5O A;  3C0K A;  2AUS A; 
#chains in the Genus database with same CATH homology
 1ZBO A;  3LJC A;  4TZ4 C;  4CI1 B;  3M65 A;  4CI2 B;  4CI3 B;  2ANE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...