1ZBOA

X-ray crystal structure of protein bpp1347 from bordetella parapertussis. northeast structural genomics consortium target bor27.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
197
Chain Sequence
AEIPLFPLSNALFPAGVLRLRVFEIRYLDMVRRCIADGSEFGVVVLEQGTEVRRPDGREVLARAGTMARIDHWEAPMPALLELACTGTGRFRLHACTQGKYGLWTGQAEPVPDDAPLEVPPELARSASALGRLIARLQREGVPPHIMPMAAPFRLDDCGWVADRWAEMLSLPPADKARLLLLPPLDRLREIDAVLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein BPP1347
publication title Crystal Structure of the Hypothetical Protein BPP1347 from Bordetella parapertussis, Northeast Structural Genomics Target BoR27.
rcsb
source organism Bordetella parapertussis
total genus 45
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4060.10 Mainly Alpha Orthogonal Bundle LON domain-like fold BPP1347 like domain 1zboA02
2.30.130.40 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 LON domain-like 1zboA01
2ANEA 3LJCA 4CI3B 3M65A 4CI2B 4TZ4C 4CI1B 1ZBOA
chains in the Genus database with same CATH superfamily
1IT8A 1K8WA 1TE7A 2CWWA 2Q07A 3LWRA 3LWVA 2J5VA 1S04A 2P38A 2E5OA 3LJCA 3UAIA 4CI3B 1ZL3A 3M6VA 1ZBOA 2AS0A 4Q1TA 2AUSA 2DP9A 2EY4A 1SQWA 1ZE1A 1IQ8A 3LDFA 3VSEA 2RFKA 2Z0TA 1WXXA 3HAXA 3MQKA 4CI1B 2HVYA 1J2BA 2AB4A 1Q7HA 2ANEA 2APOA 1R3EA 4DMGA 3U28A 1ZS7A 3M6XA 3LWOA 1R3FA 1SGVA 1XNEA 2CX1A 2FRXA 2KKUA 3M65A 1IT7A 1T5YA 1WXWA 4TZ4C 3LWPA 3HJYA 3ZV0C 3M4XA 2CX0A 3D79A 4CI2B 3IUWA 3C0KA 3LWQA 3HJWA 1WK2A 1UOYA 3M6UA 3M6WA 1ZE2A 2B78A 2J5TA
chains in the Genus database with same CATH topology
2ANEA 3LJCA 4CI3B 3M65A 4CI2B 4TZ4C 4CI1B 1ZBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ANE A;  3LJC A;  4CI3 B;  3M65 A;  4CI2 B;  4TZ4 C;  4CI1 B;  1ZBO A; 
#chains in the Genus database with same CATH topology
 1IT8 A;  1K8W A;  1TE7 A;  2CWW A;  2Q07 A;  3LWR A;  3LWV A;  2J5V A;  1S04 A;  2P38 A;  2E5O A;  3LJC A;  3UAI A;  4CI3 B;  1ZL3 A;  3M6V A;  1ZBO A;  2AS0 A;  4Q1T A;  2AUS A;  2DP9 A;  2EY4 A;  1SQW A;  1ZE1 A;  1IQ8 A;  3LDF A;  3VSE A;  2RFK A;  2Z0T A;  1WXX A;  3HAX A;  3MQK A;  4CI1 B;  2HVY A;  1J2B A;  2AB4 A;  1Q7H A;  2ANE A;  2APO A;  1R3E A;  4DMG A;  3U28 A;  1ZS7 A;  3M6X A;  3LWO A;  1R3F A;  1SGV A;  1XNE A;  2CX1 A;  2FRX A;  2KKU A;  3M65 A;  1IT7 A;  1T5Y A;  1WXW A;  4TZ4 C;  3LWP A;  3HJY A;  3ZV0 C;  3M4X A;  2CX0 A;  3D79 A;  4CI2 B;  3IUW A;  3C0K A;  3LWQ A;  3HJW A;  1WK2 A;  1UOY A;  3M6U A;  3M6W A;  1ZE2 A;  2B78 A;  2J5T A; 
#chains in the Genus database with same CATH homology
 2ANE A;  3LJC A;  4CI3 B;  3M65 A;  4CI2 B;  4TZ4 C;  4CI1 B;  1ZBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...