2EY4A

Crystal structure of a cbf5-nop10-gar1 complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
329
structure length
329
Chain Sequence
EVRRILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA pseudouridine synthase B
publication title Crystal structure of a Cbf5-Nop10-Gar1 complex and implications in RNA-guided pseudouridylation and dyskeratosis congenita.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein
total genus 91
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 2ey4A01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 2ey4A02
2APOA 3U28A 3LWVA 3LWOA 1ZE2A 2ISTA 3HJYA 2RFKA 1QYUA 1K8WA 3DH3A 3ZV0C 3HJWA 3LWRA 3LWQA 1KSKA 1R3FA 2AUSA 1R3EA 2AB4A 1SGVA 1V9KA 3UAIA 1ZE1A 3HAXA 2EY4A 1ZL3A 1PRZA 2I82A 3MQKA 1KSLA 3LWPA 4LGTA 1V9FA 2HVYA 1XPIA 1KSVA 4LABA
chains in the Genus database with same CATH superfamily
2P38A 3LWVA 2ISTA 2B78A 1Q7HA 1T5YA 3DH3A 2CWWA 1TE7A 2J5TA 4CI3B 4TZ4C 1ZBOA 2Q07A 2AUSA 2Z0TA 4CI1B 1R3EA 3C0KA 2E5OA 1V9KA 1SQWA 1WXXA 2J5VA 1XPIA 2CX1A 1IT8A 1ZE2A 3ZV0C 3HJWA 4Q1TA 2AS0A 2CX0A 3M6UA 3LDFA 3M6XA 4CI2B 3LWPA 4LGTA 1V9FA 2HVYA 3M6WA 1SI7A 1KSVA 3U28A 3LWOA 2RFKA 1UOYA 1QYUA 1SB7A 1KSKA 3M4XA 2AB4A 3UAIA 1PRZA 2I82A 3MQKA 2KKUA 3LJCA 1S04A 4LABA 3M6VA 2APOA 1XNEA 4DMGA 3HJYA 1K8WA 1WK2A 2DP9A 3LWRA 3LWQA 1SZWA 1IT7A 3D79A 1WXWA 1R3FA 1Z2ZA 3M65A 1SGVA 1ZE1A 1IQ8A 3HAXA 2EY4A 3VSEA 1ZL3A 2ANEA 1KSLA 2FRXA 1J2BA 1ZS7A 3IUWA
chains in the Genus database with same CATH topology
3M6VA 2APOA 3U28A 3LWVA 3LWOA 1ZE2A 2ISTA 3HJYA 2RFKA 1UOYA 1QYUA 1SB7A 3DH3A 1K8WA 3ZV0C 3HJWA 3LWRA 3LWQA 1KSKA 1SZWA 1R3FA 2AUSA 1R3EA 1Z2ZA 3M4XA 2AB4A 1SGVA 1V9KA 3UAIA 1ZE1A 3M6UA 3HAXA 2EY4A 1ZL3A 3M6XA 1PRZA 2I82A 3MQKA 3M6WA 1KSLA 2FRXA 3LWPA 4LGTA 1V9FA 2HVYA 1XPIA 1SI7A 1KSVA 4LABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2APO A;  3U28 A;  3LWV A;  3LWO A;  1ZE2 A;  2IST A;  3HJY A;  2RFK A;  1QYU A;  1K8W A;  3DH3 A;  3ZV0 C;  3HJW A;  3LWR A;  3LWQ A;  1KSK A;  1R3F A;  2AUS A;  1R3E A;  2AB4 A;  1SGV A;  1V9K A;  3UAI A;  1ZE1 A;  3HAX A;  2EY4 A;  1ZL3 A;  1PRZ A;  2I82 A;  3MQK A;  1KSL A;  3LWP A;  4LGT A;  1V9F A;  2HVY A;  1XPI A;  1KSV A;  4LAB A; 
#chains in the Genus database with same CATH topology
 2P38 A;  3LWV A;  2IST A;  2B78 A;  1Q7H A;  1T5Y A;  3DH3 A;  2CWW A;  1TE7 A;  2J5T A;  4CI3 B;  4TZ4 C;  1ZBO A;  2Q07 A;  2AUS A;  2Z0T A;  4CI1 B;  1R3E A;  3C0K A;  2E5O A;  1V9K A;  1SQW A;  1WXX A;  2J5V A;  1XPI A;  2CX1 A;  1IT8 A;  1ZE2 A;  3ZV0 C;  3HJW A;  4Q1T A;  2AS0 A;  2CX0 A;  3M6U A;  3LDF A;  3M6X A;  4CI2 B;  3LWP A;  4LGT A;  1V9F A;  2HVY A;  3M6W A;  1SI7 A;  1KSV A;  3U28 A;  3LWO A;  2RFK A;  1UOY A;  1QYU A;  1SB7 A;  1KSK A;  3M4X A;  2AB4 A;  3UAI A;  1PRZ A;  2I82 A;  3MQK A;  2KKU A;  3LJC A;  1S04 A;  4LAB A;  3M6V A;  2APO A;  1XNE A;  4DMG A;  3HJY A;  1K8W A;  1WK2 A;  2DP9 A;  3LWR A;  3LWQ A;  1SZW A;  1IT7 A;  3D79 A;  1WXW A;  1R3F A;  1Z2Z A;  3M65 A;  1SGV A;  1ZE1 A;  1IQ8 A;  3HAX A;  2EY4 A;  3VSE A;  1ZL3 A;  2ANE A;  1KSL A;  2FRX A;  1J2B A;  1ZS7 A;  3IUW A; 
#chains in the Genus database with same CATH homology
 3M6V A;  2APO A;  3U28 A;  3LWV A;  3LWO A;  1ZE2 A;  2IST A;  3HJY A;  2RFK A;  1UOY A;  1QYU A;  1SB7 A;  3DH3 A;  1K8W A;  3ZV0 C;  3HJW A;  3LWR A;  3LWQ A;  1KSK A;  1SZW A;  1R3F A;  2AUS A;  1R3E A;  1Z2Z A;  3M4X A;  2AB4 A;  1SGV A;  1V9K A;  3UAI A;  1ZE1 A;  3M6U A;  3HAX A;  2EY4 A;  1ZL3 A;  3M6X A;  1PRZ A;  2I82 A;  3MQK A;  3M6W A;  1KSL A;  2FRX A;  3LWP A;  4LGT A;  1V9F A;  2HVY A;  1XPI A;  1SI7 A;  1KSV A;  4LAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...