2EY4A

Crystal structure of a cbf5-nop10-gar1 complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
329
structure length
329
Chain Sequence
EVRRILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/biosynthetic protein
molecule keywords Probable tRNA pseudouridine synthase B
publication title Crystal structure of a Cbf5-Nop10-Gar1 complex and implications in RNA-guided pseudouridylation and dyskeratosis congenita.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 91
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 2ey4A01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 2ey4A02
2I82A 2AUSA 3LWPA 1K8WA 3LWVA 3HAXA 4LABA 1ZE2A 1KSKA 1V9KA 2RFKA 1V9FA 2APOA 1PRZA 3HJYA 1ZL3A 3UAIA 3U28A 1QYUA 1SGVA 3HJWA 2HVYA 2EY4A 3DH3A 3LWRA 1XPIA 3ZV0C 1KSLA 2ISTA 1KSVA 1ZE1A 3LWQA 3MQKA 1R3FA 1R3EA 4LGTA 3LWOA 2AB4A
chains in the Genus database with same CATH superfamily
2AUSA 3LWPA 3HAXA 4LABA 2FRXA 1KSKA 4CI2B 1V9KA 2DP9A 2RFKA 1ZBOA 1Z2ZA 3DH3A 3LWRA 1S04A 3D79A 1SZWA 1KSLA 3VSEA 1R3EA 2AS0A 3LWOA 4CI3B 3LWVA 3M6UA 2ANEA 2B78A 1V9FA 1SQWA 1PRZA 2Z0TA 1ZL3A 3M4XA 1SGVA 3M6WA 1WXWA 1KSVA 3LWQA 3MQKA 2CX1A 4LGTA 1T5YA 1SB7A 2AB4A 2CX0A 3C0KA 4DMGA 3LJCA 1IT7A 3LDFA 2J5TA 2APOA 1IQ8A 3HJYA 1UOYA 3UAIA 2J5VA 3HJWA 2P38A 2Q07A 2ISTA 1ZS7A 2I82A 4TZ4C 2KKUA 1K8WA 1SI7A 1ZE2A 3M6VA 2CWWA 1XNEA 1Q7HA 3U28A 1QYUA 4Q1TA 2HVYA 2EY4A 1TE7A 1XPIA 1IT8A 1WXXA 3M6XA 3ZV0C 4CI1B 3IUWA 1ZE1A 1R3FA 3M65A 2E5OA 1J2BA 1WK2A
chains in the Genus database with same CATH topology
2I82A 2AUSA 3LWPA 1SI7A 3LWVA 3HAXA 4LABA 3M6UA 1K8WA 1ZE2A 2FRXA 1KSKA 1V9KA 2RFKA 1V9FA 2APOA 3M6VA 1PRZA 3HJYA 1UOYA 1ZL3A 3UAIA 3U28A 3M4XA 1QYUA 1SGVA 3M6WA 3HJWA 2HVYA 2EY4A 1Z2ZA 3LWRA 3DH3A 1SZWA 1XPIA 3M6XA 3ZV0C 1KSLA 2ISTA 1KSVA 1ZE1A 3LWQA 3MQKA 1R3FA 1R3EA 4LGTA 1SB7A 3LWOA 2AB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I82 A;  2AUS A;  3LWP A;  1K8W A;  3LWV A;  3HAX A;  4LAB A;  1ZE2 A;  1KSK A;  1V9K A;  2RFK A;  1V9F A;  2APO A;  1PRZ A;  3HJY A;  1ZL3 A;  3UAI A;  3U28 A;  1QYU A;  1SGV A;  3HJW A;  2HVY A;  2EY4 A;  3DH3 A;  3LWR A;  1XPI A;  3ZV0 C;  1KSL A;  2IST A;  1KSV A;  1ZE1 A;  3LWQ A;  3MQK A;  1R3F A;  1R3E A;  4LGT A;  3LWO A;  2AB4 A; 
#chains in the Genus database with same CATH topology
 2AUS A;  3LWP A;  3HAX A;  4LAB A;  2FRX A;  1KSK A;  4CI2 B;  1V9K A;  2DP9 A;  2RFK A;  1ZBO A;  1Z2Z A;  3DH3 A;  3LWR A;  1S04 A;  3D79 A;  1SZW A;  1KSL A;  3VSE A;  1R3E A;  2AS0 A;  3LWO A;  4CI3 B;  3LWV A;  3M6U A;  2ANE A;  2B78 A;  1V9F A;  1SQW A;  1PRZ A;  2Z0T A;  1ZL3 A;  3M4X A;  1SGV A;  3M6W A;  1WXW A;  1KSV A;  3LWQ A;  3MQK A;  2CX1 A;  4LGT A;  1T5Y A;  1SB7 A;  2AB4 A;  2CX0 A;  3C0K A;  4DMG A;  3LJC A;  1IT7 A;  3LDF A;  2J5T A;  2APO A;  1IQ8 A;  3HJY A;  1UOY A;  3UAI A;  2J5V A;  3HJW A;  2P38 A;  2Q07 A;  2IST A;  1ZS7 A;  2I82 A;  4TZ4 C;  2KKU A;  1K8W A;  1SI7 A;  1ZE2 A;  3M6V A;  2CWW A;  1XNE A;  1Q7H A;  3U28 A;  1QYU A;  4Q1T A;  2HVY A;  2EY4 A;  1TE7 A;  1XPI A;  1IT8 A;  1WXX A;  3M6X A;  3ZV0 C;  4CI1 B;  3IUW A;  1ZE1 A;  1R3F A;  3M65 A;  2E5O A;  1J2B A;  1WK2 A; 
#chains in the Genus database with same CATH homology
 2I82 A;  2AUS A;  3LWP A;  1SI7 A;  3LWV A;  3HAX A;  4LAB A;  3M6U A;  1K8W A;  1ZE2 A;  2FRX A;  1KSK A;  1V9K A;  2RFK A;  1V9F A;  2APO A;  3M6V A;  1PRZ A;  3HJY A;  1UOY A;  1ZL3 A;  3UAI A;  3U28 A;  3M4X A;  1QYU A;  1SGV A;  3M6W A;  3HJW A;  2HVY A;  2EY4 A;  1Z2Z A;  3LWR A;  3DH3 A;  1SZW A;  1XPI A;  3M6X A;  3ZV0 C;  1KSL A;  2IST A;  1KSV A;  1ZE1 A;  3LWQ A;  3MQK A;  1R3F A;  1R3E A;  4LGT A;  1SB7 A;  3LWO A;  2AB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...