2CX1A

Crystal structure of a pua domain (ape0525) from the aeropyrum pernix k1 (tartrate complex)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein APE0525
total genus 48
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2cx1A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 2cx1A01
2P38A 3D79A 1K8WA 2AB4A 2J5VA 3VSEA 2CX0A 3UAIA 1Q7HA 4DMGA 1IQ8A 1T5YA 2J5TA 1IT8A 1WXWA 2AS0A 1SGVA 1R3FA 1ZE1A 1WXXA 1R3EA 1SQWA 2CX1A 1IT7A 2B78A 4Q1TA 2Q07A 3C0KA 3LDFA 1ZS7A 1ZE2A 1ZL3A 2CWWA 1J2BA
chains in the Genus database with same CATH superfamily
1W2B2 4MMZB 5CXOA 2HMJB 1IU7A 5EQLA 4HZ9B 3Q90A 3CCV3 4WYKA 5AEUB 1JNQA 4JF8A 4J8TA 3UNLA 1QVF2 1KWIA 3DGMA 3LZAA 1G96A 3X40A 1YGEA 2BO9B 2CX0A 4N6TA 1VQ53 1IQ8A 1SJWA 2CW9A 4K61A 3T0UA 4AEQA 5JPUA 1SGVA 1BSBA 2LYXA 3UL5A 3NBBA 3EN8A 1TJDA 1RCLA 3NXJA 2HVYA 1DETA 3U28A 1D6ZA 3LH4A 2F86B 3JUOA 2W04A 4LMIA 1GS3A 2CK3H 5LC7A 2FRXA 1VQ43 5IG4A 1JZDA 3CCS3 1FUWA 1VQO3 1I70A 1W01A 1VQK3 4FCZA 3G8ZA 2W03A 3M6UA 4HM7B 2OWPA 1WMPA 3EF8A 1FGQA 3F7XA 2GBXB 1V58A 3VSEA 3UAIA 1OACA 3D5GA 3FCSB 9RNTA 1BIRA 1IYYA 2E5OA 4LYLB 3KZTA 4HYZA 1B2MA 1RNTA 3B4PA 1GSPA 3MSOA 1RRHA 2XEPA 3EJVA 1FW7A 1UCLA 1B2ZA 3CPOA 1CH0A 3GZRA 2UGIA 4HAAA 2CC3A 3D3LA 2HMNB 1UOYA 3ZV0C 2XSOB 3ALAA 2GEXA 1RHLA 1R3EA 5AEWB 5HOHA 1QVG2 3PGBA 2AUSA 1PFPA 3NM2A 3IPTA 1N8QA 1UCIA 3DM8A 4IIAA 1AR0A 3C0KA 1VQ93 2W2CA 1BNFA 2BHMA 1DMQA 2RGQA 3WDGB 2CG1A 4I5QA 7GSPA 1NJI4 2RFRA 1BUJA 5FGOA 1JN5A 1U8CB 3VGNA 1NO3A 1V74A 4RBNA 3EC9A 1UDII 5AYSC 1T3BA 1ULIB 3EHCA 1C54A 1I3IA 3SLUA 3CME3 3U97A 3X41A 1IK3A 1TE7A 3AHSA 3ZG5A 2H0IA 3M4XA 2BIRA 1UGHI 4HJLB 1RGFA 1IT8A 2SARA 1WXWA 2QA43 3LTCA 3LOYA 3LT8A 1NDOB 1BNGA 5DRVA 5KP3A 1BVIA 4BTWA 1BSCA 1A90A 3KSPA 4J9AA 3S67A 4AKZA 2B78A 3ER7A 4R1KA 3K9MC 1KC84 2OOVC 3S27A 2KKUA 1ZS7A 1A2VA 1R4CA 1Q814 1STFI 4RNYA 2L1SA 1TFOA 4CI2B 3EN1B 5JBSA 2QEX3 1YIJ3 1Q42A 4CI3B 3MYTA 1IV7A 1ROAA 3OXAA 1W7CA 4HBRA 3CNXA 1OGXA 3ECFA 3AHWA 3HIGA 2XGNA 4CPKA 1D6UA 3G4S3 1GOVA 2LQVA 4BU4A 4AKYA 5BXQA 1KQS2 2CIUA 8RNTA 3OX9A 1UI7A 2KF4A 3WR2A 1A2KA 5STDA 2AS0A 2CFLA 1TTOA 1LVNA 1I0XA 1RCKA 2R4IA 1NU3A 3FH1A 4H3UA 4NPBA 4RNZA 5D82A 5DREA 7RNTA 3H51A 3I553 4TZ4C 1LNHA 3F14A 1B20A 3UJMA 4HVNA 2CG0A 5IEPA 3LYGA 1F8NA 1YGWA 2QIYA 1UUGB 3MWZA 3I0YA 3G16A 3FGYA 1FGRA 2IUKA 1VQM3 1VQ83 2EY4A 4FMDA 3LWRA 1VZZA 2F5MA 3WOFB 2RBIA 3AGNA 1K734 2Z7AA 1O7NB 2YFIB 3AMOA 3IJEB 3KIIA 2D42A 5A0OB 2A15A 5IENA 1Q7HA 1FGTA 1JBTA 1HKXA 5BIRA 3X42A 2C11A 2BMQB 4FMAA 1Q9EA 3BB9A 3AGOA 1ZE1A 3WMDA 3CCE3 2ML6A 1VQ63 1O7HB 3M65A 1L5GB 5IW9A 1VQ73 1RJOA 5AIHA 1FYSA 1I3FA 3QK9A 1FUTA 1BNEA 1OF5B 1OGZA 1SPUA 3D9RA 3DY5A 5M19A 1WTHA 1M1XB 1OUNA 2XFSA 2CFWA 4ORLA 4R4KA 5FW5A 1JB4A 1BSEA 2E2UA 1ROVA 3CD63 3I563 3CXC2 4WHAA 2BU4A 1O7PB 3VF1A 2F99A 2RCDA 3F40A 3ROBA 4N6MA 4XBYA 4KFFA 3LJCA 5AIGA 2E2VA 1BAOA 1MOLA 3EX9A 1B27A 1BOXA 4WWUC 5JPPA 1M904 3WHOA 4FCJA 3MG3A 4KVHA 5I97A 3PCRA 3FG1A 3KN4A 2GSPA 1U5OA 1OHOA 1SIIA 2UX0A 1OCVA 1BRHA 3BNDA 3K63A 3DGYA 1WMNA 1RLSA 5GSPA 1DE3A 4XB5A 2L4VA 1W4NA 3V98A 3FF0A 1MWTA 1W5ZA 2APOA 3CCQ3 1JN5B 1TUHA 1X1YA 3RNTA 2FNQA 6GSPA 5EEOA 1WMOA 3F8HA 2K0MA 2QGUA 3U1WA 2I9WA 3ZFZA 4DMGA 4MMYB 4FMCA 1T5YA 1LOWA 3H3HA 3PCSA 3HX8A 4JRFA 1BRSA 1O7WB 1OH0A 2RNTA 3FLJA 1UUVB 3NHXA 4IPBA 5KP1A 2KF3A 2OCTA 3QRDA 1N9EA 3GZBA 5TGNA 1JBSA 3FG3A 4L8OA 1BU4A 3K5TA 3BIRA 2HMOB 1UCKA 1IDPA 3EE1A 3ZG0A 1MWSA 3NQYA 1FZUA 2O9UX 4BL3A 1MNLA 1X1WA 1B21A 2CWWA 5AIIA 3BU4A 4TX4A 3DGLA 2YFLB 1AQZA 1RGLA 3MHEA 2W9PA 1FA3A 3WOEB 3CNMA 3LWVA 4R80A 1BRGA 1G0TA 2SBLA 2ZA4A 3FZWA 4BTYA 1C7HA 2Z0TA 1BRKA 3BNBA 1QALA 4WFOA 4MJDA 2M7OA 4H61A 4XM4A 2HMLB 1YIT3 3CC23 1M9GA 3WODG 1BNIA 1EKMA 1JKGB 4K1UA 1E3VA 1IV9A 3GRDA 4L7KA 2F56A 5RNTA 4LZIA 2R41A 1BRIA 3PZWA 3G6E3 3HZPA 4WYKB 1W2ZA 2BMOB 3EBYA 1K8WA 1HYFA 1WQLB 1RNBA 2HMKB 1OHSA 4XDVA 4KZ1A 1O7GB 3JUMA 2CFGA 5G1KA 4EW5A 2P05A 4G1MB 1T2HA 4HM5B 3URPA 1JRQA 3STDA 5CF1A 4CI1B 1IVXA 1K28A 1O7MB 1W00A 3DH2A 2J5TA 2C10A 1I0VA 2FGTA 3NV0B 3K7CA 3M6VA 3GZXB 1RGCA 4N6UA 5EVHA 1UUWB 2GBWB 3K0ZA 3N54B 1BGSA 3G0KA 3CCJ3 4FMBA 1SQWA 2CX1A 1KSIA 2W0QA 1IT7A 1LQMB 2O3OA 4ZM8A 1QMAA 4Q1TA 2Q07A 4GSPA 1BUQA 3KFQC 1EA2A 1LOYA 4LGQA 3M6XA 2INXA 2HOHA 3KSED 2OOVA 3HK4A 5HGRA 1GY6A 4X2HA 3HAXA 2IY2A 1J2BA 5IEOA 3V92A 3D79A 3AMOB 4BL2A 1BNRA 2GU1A 1D6YA 1FUSA 1RRLA 1X1UA 1BRJA 1E3RA 1JKGA 2WGQA 2W9QA 3RGAA 2KRTA 3SX1A 1N8R4 1DMNA 1PY3A 3GSPA 4NREA 4O3VA 2RSXA 5AI1A 1ZGXA 2STDA 4ILFA 5M1AA 3CU3A 2IUJA 2UUGC 3RDEA 3DGNA 1YVSA 3SVAA 1GYBA 4K1VA 3LWPA 1N9JA 4EC6A 1PU4A 3CCU3 3OWSA 4IT7A 1GD4A 1XNEA 2BT3A 5G1LA 3DUKA 3DXOA 5BVBA 2ZDJA 2F5WA 3IMAB 4HM6B 5CF2A 3CCL3 1IVWA 3E99A 4HM1B 2CWUA 2D1WA 4HOHA 1NB3I 3MKIA 4NHFA 1YI23 2OTL3 3A5EA 3MG1A 1YHQ3 1FGOA 2P38A 1Q40B 1RN1A 2HMMB 3DGOA 3X3XA 1RN4A 2W6JH 4FCMA 3OW22 3N9HA 1LOXA 1IVUA 2B1XB 1CYVA 3EBTA 2CWVA 1K9M4 4N6OB 4CDLA 1W02A 4EV5A 1WNHA 3M8CA 3RGRA 4LSOA 3CC43 1IQXA 2PNCA 6STDA 1AVKA 2XF3A 2GEYA 1UGIA 4R9KA 3FG4A 1DMMA 3N8BA 1OPYA 3B7CA 1RKYA 4HM4B 2DP9A 2H0HA 1WXXA 3LWQA 4N6NB 4RZMA 1YJN3 1DYUA 1CEWI 3NBRA 4HM8B 4PEJA 2KCDA 4CJNA 3J7Yd 5IERA 4XBTA 3F9SA 1QAFA 2CWTA 2IA7A 1AY7A 1HU9A 3TDGA 4HM0B 1K41A 1Q824 3B8LA 1JJ22 1GY7A 2F98A 3NQZA 1DVDA 3BNCA 4LEHA 5AIFA 4XDWA 5KP4A 2Z76A 3NBJA 1STDA 1MGWA 2XFTA 4MMXB 5D81A 3LXUX 2P09A 1G02A 2ZHXB 4HZBB 2AB4A 1OHPA 2GU3A 2IYJA 1HZ1A 1I2EA 5IF6A 2MC8A 1Q7Y4 1W6CA 1R3FA 2GXFA 2CFDA 3T8UA 3SEDA 3LMLA 2IMJA 1LXEA 2JQ5A 3HIIA 4N6V0 3FF2A 1W6YA 3IUWA 4GB5A 3S29A 1US1A 2F4YA 3NUVA 3CCM3 4J5KA 4O02B 1K8A4 3LDFA 3D4AA 1ZE2A 4GL6A 2KAAA 4DKIA 1VQP3 1RN7A 1LNIA 5AYRB 2B24B 3F7SA 5G2GA 3SXXA 4J5GA 4EYCA 1OF5A 5CK6A 3S28A 2RFKA 2Z6BA 1ASKA 1I8VA 3CPW2 2OQEC 4L8PA 3GZYB 2BMRB 1VQL3 1I2FA 4Q53A 3DZLA 1RGEA 4MEIA 1Y4KA 4BTXA 3HJWA 2J5VA 3EQQB 1JB2A 2P0MA 4XBXA 2XGLA 1AVLA 1RDSA 1SARA 5IG3A 5M18A 2YX9A 3KCHA 4U13A 5LC6A 2XR8B 3Q1CA 1N5HA 1IQYA 1BSDA 3JUNA 3HJYA 1LOVA 1RGHA 1TIJA 3A76A 1PYLA 3DMCA 3SOAA 2FXTA 3OWYA 3CC73 2WGOA 2CH9A 1UCJA 2WOHA 1AV4A 3M6WA 1EUIC 2XSHB 2WOFA 3LTAA 4O8SA 4HM2B 3FKAA 1GY5A 1RMSA 3GWRA 3UB1A 3PS8A 1Q864 3KKGA 5ELJA 2AADA 2WO0A 1JZOA 3JUPA 2ANEA 3BLZA 2AAEA 4I4KA 5BU4A 1BANA 1M1K4 1B2UA 3SYUA 3LTBA 4K90B 1SIHA 1MWUA 1GMPA 6RNTA 1UW1A 1ZO2A 2Z77A 1A67A 2YFJB 2Y73A 3X3YA 3CCR3 1Z1SA 3MG2A 2OQEA 1B3SA 1NNVA 1T2IA 1VQN3 1GMRA 1FGMA 3OWUA 4N6LA 4OK0A 3B4OA 2V1LA 3JVCA 3Q3FA 3F8XA 3LWOA 4BIRA 2CKFB 1B2XA 4EXRA 3VSYA 2BNGA 1ZL3A 1RGKA 3S5CA 1YNVX 2PZVA 1YJW3 1ISKA 1Q40A 4CCVA 2CFKA 1CYUA 4QWTA 4N3VA 1GOUA 3HI7A 3G713 1KD14 4RNTA 1IVVA 2W56B 2J8XB 2JDIH 1S04A 1ZBOA 3HOHA 1N5PA 1ULJB 2E2TA 1EEJA 1B2SA 2KXGA 3NX0A 2H0GA 3O8YA 3PYJA 1WK2A 1QJGA 1ZX2A 4X2OA 2OTJ3 5IG5A 1E97A 2Y74A 1I2GA 8CHOA 1GOYA 1BRNL 1GD3A 1S5AA 1NWWA 3BNEA 3KE7A 5IG0A 1YJ93 3CMA3 3LTDA 5ELUA 2MF7A 2CHCA 3D5IA 3WA2X 4R9LA 4EV2A 1RGGA 1UI8A 4OUQA 1S723 3T8NA 1BNSA 4HKVB 4STDA 3UL6A 1A2PA 1R4YA 3PXMA 1V57A 2W56A 1DVCA 3L0RA 4FR9A 1YVBI 1NB5I 2P0XA 2ZL8A 5D83A 3MPHA 1CQSA 4KFDA 1RSNA 2XRXB 1TRPA 1LRAA 1BNJA 3NM7A 3FSDA 1EQKA 2KF6A 3Q2PA 1TRQA 7STDA 1GMQA 1JBRA 1LQGC 1MGRA 1RTUA 1JV2B 1RGAA 3X3ZA 1X1XA 4HM3B 1JB5A 3GAXA 4WP5A 3MQKA 1MWRA 2KF5A 3JUQA 3OV4A 3NV0A 3EB8A 3V99A 4EBGA 1TFKA 4OVMA 2K3DA 1VQQA 1BSAA 1TU5A 3LT9A 2C4BA 4GHOA 4KT3B 4O2HA 1EG9B 2K54A 2ML5A 5CLKA 1TP6A 4KFEA 3SOYA 3WA3A 1W6GA 1QAKA 2XH9A
chains in the Genus database with same CATH topology
2P38A 3D79A 1K8WA 2AB4A 2J5VA 3VSEA 2CX0A 3UAIA 1Q7HA 4DMGA 1IQ8A 1T5YA 2J5TA 1IT8A 1WXWA 2AS0A 1SGVA 1R3FA 1ZE1A 1WXXA 1R3EA 1SQWA 2CX1A 1IT7A 2B78A 4Q1TA 2Q07A 3C0KA 3LDFA 1ZS7A 1ZE2A 1ZL3A 2CWWA 1J2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P38 A;  3D79 A;  1K8W A;  2AB4 A;  2J5V A;  3VSE A;  2CX0 A;  3UAI A;  1Q7H A;  4DMG A;  1IQ8 A;  1T5Y A;  2J5T A;  1IT8 A;  1WXW A;  2AS0 A;  1SGV A;  1R3F A;  1ZE1 A;  1WXX A;  1R3E A;  1SQW A;  2CX1 A;  1IT7 A;  2B78 A;  4Q1T A;  2Q07 A;  3C0K A;  3LDF A;  1ZS7 A;  1ZE2 A;  1ZL3 A;  2CWW A;  1J2B A; 
#chains in the Genus database with same CATH topology
 1W2B 2;  4MMZ B;  5CXO A;  2HMJ B;  1IU7 A;  5EQL A;  4HZ9 B;  3Q90 A;  3CCV 3;  4WYK A;  5AEU B;  1JNQ A;  4JF8 A;  4J8T A;  3UNL A;  1QVF 2;  1KWI A;  3DGM A;  3LZA A;  1G96 A;  3X40 A;  1YGE A;  2BO9 B;  2CX0 A;  4N6T A;  1VQ5 3;  1IQ8 A;  1SJW A;  2CW9 A;  4K61 A;  3T0U A;  4AEQ A;  5JPU A;  1SGV A;  1BSB A;  2LYX A;  3UL5 A;  3NBB A;  3EN8 A;  1TJD A;  1RCL A;  3NXJ A;  2HVY A;  1DET A;  3U28 A;  1D6Z A;  3LH4 A;  2F86 B;  3JUO A;  2W04 A;  4LMI A;  1GS3 A;  2CK3 H;  5LC7 A;  2FRX A;  1VQ4 3;  5IG4 A;  1JZD A;  3CCS 3;  1FUW A;  1VQO 3;  1I70 A;  1W01 A;  1VQK 3;  4FCZ A;  3G8Z A;  2W03 A;  3M6U A;  4HM7 B;  2OWP A;  1WMP A;  3EF8 A;  1FGQ A;  3F7X A;  2GBX B;  1V58 A;  3VSE A;  3UAI A;  1OAC A;  3D5G A;  3FCS B;  9RNT A;  1BIR A;  1IYY A;  2E5O A;  4LYL B;  3KZT A;  4HYZ A;  1B2M A;  1RNT A;  3B4P A;  1GSP A;  3MSO A;  1RRH A;  2XEP A;  3EJV A;  1FW7 A;  1UCL A;  1B2Z A;  3CPO A;  1CH0 A;  3GZR A;  2UGI A;  4HAA A;  2CC3 A;  3D3L A;  2HMN B;  1UOY A;  3ZV0 C;  2XSO B;  3ALA A;  2GEX A;  1RHL A;  1R3E A;  5AEW B;  5HOH A;  1QVG 2;  3PGB A;  2AUS A;  1PFP A;  3NM2 A;  3IPT A;  1N8Q A;  1UCI A;  3DM8 A;  4IIA A;  1AR0 A;  3C0K A;  1VQ9 3;  2W2C A;  1BNF A;  2BHM A;  1DMQ A;  2RGQ A;  3WDG B;  2CG1 A;  4I5Q A;  7GSP A;  1NJI 4;  2RFR A;  1BUJ A;  5FGO A;  1JN5 A;  1U8C B;  3VGN A;  1NO3 A;  1V74 A;  4RBN A;  3EC9 A;  1UDI I;  5AYS C;  1T3B A;  1ULI B;  3EHC A;  1C54 A;  1I3I A;  3SLU A;  3CME 3;  3U97 A;  3X41 A;  1IK3 A;  1TE7 A;  3AHS A;  3ZG5 A;  2H0I A;  3M4X A;  2BIR A;  1UGH I;  4HJL B;  1RGF A;  1IT8 A;  2SAR A;  1WXW A;  2QA4 3;  3LTC A;  3LOY A;  3LT8 A;  1NDO B;  1BNG A;  5DRV A;  5KP3 A;  1BVI A;  4BTW A;  1BSC A;  1A90 A;  3KSP A;  4J9A A;  3S67 A;  4AKZ A;  2B78 A;  3ER7 A;  4R1K A;  3K9M C;  1KC8 4;  2OOV C;  3S27 A;  2KKU A;  1ZS7 A;  1A2V A;  1R4C A;  1Q81 4;  1STF I;  4RNY A;  2L1S A;  1TFO A;  4CI2 B;  3EN1 B;  5JBS A;  2QEX 3;  1YIJ 3;  1Q42 A;  4CI3 B;  3MYT A;  1IV7 A;  1ROA A;  3OXA A;  1W7C A;  4HBR A;  3CNX A;  1OGX A;  3ECF A;  3AHW A;  3HIG A;  2XGN A;  4CPK A;  1D6U A;  3G4S 3;  1GOV A;  2LQV A;  4BU4 A;  4AKY A;  5BXQ A;  1KQS 2;  2CIU A;  8RNT A;  3OX9 A;  1UI7 A;  2KF4 A;  3WR2 A;  1A2K A;  5STD A;  2AS0 A;  2CFL A;  1TTO A;  1LVN A;  1I0X A;  1RCK A;  2R4I A;  1NU3 A;  3FH1 A;  4H3U A;  4NPB A;  4RNZ A;  5D82 A;  5DRE A;  7RNT A;  3H51 A;  3I55 3;  4TZ4 C;  1LNH A;  3F14 A;  1B20 A;  3UJM A;  4HVN A;  2CG0 A;  5IEP A;  3LYG A;  1F8N A;  1YGW A;  2QIY A;  1UUG B;  3MWZ A;  3I0Y A;  3G16 A;  3FGY A;  1FGR A;  2IUK A;  1VQM 3;  1VQ8 3;  2EY4 A;  4FMD A;  3LWR A;  1VZZ A;  2F5M A;  3WOF B;  2RBI A;  3AGN A;  1K73 4;  2Z7A A;  1O7N B;  2YFI B;  3AMO A;  3IJE B;  3KII A;  2D42 A;  5A0O B;  2A15 A;  5IEN A;  1Q7H A;  1FGT A;  1JBT A;  1HKX A;  5BIR A;  3X42 A;  2C11 A;  2BMQ B;  4FMA A;  1Q9E A;  3BB9 A;  3AGO A;  1ZE1 A;  3WMD A;  3CCE 3;  2ML6 A;  1VQ6 3;  1O7H B;  3M65 A;  1L5G B;  5IW9 A;  1VQ7 3;  1RJO A;  5AIH A;  1FYS A;  1I3F A;  3QK9 A;  1FUT A;  1BNE A;  1OF5 B;  1OGZ A;  1SPU A;  3D9R A;  3DY5 A;  5M19 A;  1WTH A;  1M1X B;  1OUN A;  2XFS A;  2CFW A;  4ORL A;  4R4K A;  5FW5 A;  1JB4 A;  1BSE A;  2E2U A;  1ROV A;  3CD6 3;  3I56 3;  3CXC 2;  4WHA A;  2BU4 A;  1O7P B;  3VF1 A;  2F99 A;  2RCD A;  3F40 A;  3ROB A;  4N6M A;  4XBY A;  4KFF A;  3LJC A;  5AIG A;  2E2V A;  1BAO A;  1MOL A;  3EX9 A;  1B27 A;  1BOX A;  4WWU C;  5JPP A;  1M90 4;  3WHO A;  4FCJ A;  3MG3 A;  4KVH A;  5I97 A;  3PCR A;  3FG1 A;  3KN4 A;  2GSP A;  1U5O A;  1OHO A;  1SII A;  2UX0 A;  1OCV A;  1BRH A;  3BND A;  3K63 A;  3DGY A;  1WMN A;  1RLS A;  5GSP A;  1DE3 A;  4XB5 A;  2L4V A;  1W4N A;  3V98 A;  3FF0 A;  1MWT A;  1W5Z A;  2APO A;  3CCQ 3;  1JN5 B;  1TUH A;  1X1Y A;  3RNT A;  2FNQ A;  6GSP A;  5EEO A;  1WMO A;  3F8H A;  2K0M A;  2QGU A;  3U1W A;  2I9W A;  3ZFZ A;  4DMG A;  4MMY B;  4FMC A;  1T5Y A;  1LOW A;  3H3H A;  3PCS A;  3HX8 A;  4JRF A;  1BRS A;  1O7W B;  1OH0 A;  2RNT A;  3FLJ A;  1UUV B;  3NHX A;  4IPB A;  5KP1 A;  2KF3 A;  2OCT A;  3QRD A;  1N9E A;  3GZB A;  5TGN A;  1JBS A;  3FG3 A;  4L8O A;  1BU4 A;  3K5T A;  3BIR A;  2HMO B;  1UCK A;  1IDP A;  3EE1 A;  3ZG0 A;  1MWS A;  3NQY A;  1FZU A;  2O9U X;  4BL3 A;  1MNL A;  1X1W A;  1B21 A;  2CWW A;  5AII A;  3BU4 A;  4TX4 A;  3DGL A;  2YFL B;  1AQZ A;  1RGL A;  3MHE A;  2W9P A;  1FA3 A;  3WOE B;  3CNM A;  3LWV A;  4R80 A;  1BRG A;  1G0T A;  2SBL A;  2ZA4 A;  3FZW A;  4BTY A;  1C7H A;  2Z0T A;  1BRK A;  3BNB A;  1QAL A;  4WFO A;  4MJD A;  2M7O A;  4H61 A;  4XM4 A;  2HML B;  1YIT 3;  3CC2 3;  1M9G A;  3WOD G;  1BNI A;  1EKM A;  1JKG B;  4K1U A;  1E3V A;  1IV9 A;  3GRD A;  4L7K A;  2F56 A;  5RNT A;  4LZI A;  2R41 A;  1BRI A;  3PZW A;  3G6E 3;  3HZP A;  4WYK B;  1W2Z A;  2BMO B;  3EBY A;  1K8W A;  1HYF A;  1WQL B;  1RNB A;  2HMK B;  1OHS A;  4XDV A;  4KZ1 A;  1O7G B;  3JUM A;  2CFG A;  5G1K A;  4EW5 A;  2P05 A;  4G1M B;  1T2H A;  4HM5 B;  3URP A;  1JRQ A;  3STD A;  5CF1 A;  4CI1 B;  1IVX A;  1K28 A;  1O7M B;  1W00 A;  3DH2 A;  2J5T A;  2C10 A;  1I0V A;  2FGT A;  3NV0 B;  3K7C A;  3M6V A;  3GZX B;  1RGC A;  4N6U A;  5EVH A;  1UUW B;  2GBW B;  3K0Z A;  3N54 B;  1BGS A;  3G0K A;  3CCJ 3;  4FMB A;  1SQW A;  2CX1 A;  1KSI A;  2W0Q A;  1IT7 A;  1LQM B;  2O3O A;  4ZM8 A;  1QMA A;  4Q1T A;  2Q07 A;  4GSP A;  1BUQ A;  3KFQ C;  1EA2 A;  1LOY A;  4LGQ A;  3M6X A;  2INX A;  2HOH A;  3KSE D;  2OOV A;  3HK4 A;  5HGR A;  1GY6 A;  4X2H A;  3HAX A;  2IY2 A;  1J2B A;  5IEO A;  3V92 A;  3D79 A;  3AMO B;  4BL2 A;  1BNR A;  2GU1 A;  1D6Y A;  1FUS A;  1RRL A;  1X1U A;  1BRJ A;  1E3R A;  1JKG A;  2WGQ A;  2W9Q A;  3RGA A;  2KRT A;  3SX1 A;  1N8R 4;  1DMN A;  1PY3 A;  3GSP A;  4NRE A;  4O3V A;  2RSX A;  5AI1 A;  1ZGX A;  2STD A;  4ILF A;  5M1A A;  3CU3 A;  2IUJ A;  2UUG C;  3RDE A;  3DGN A;  1YVS A;  3SVA A;  1GYB A;  4K1V A;  3LWP A;  1N9J A;  4EC6 A;  1PU4 A;  3CCU 3;  3OWS A;  4IT7 A;  1GD4 A;  1XNE A;  2BT3 A;  5G1L A;  3DUK A;  3DXO A;  5BVB A;  2ZDJ A;  2F5W A;  3IMA B;  4HM6 B;  5CF2 A;  3CCL 3;  1IVW A;  3E99 A;  4HM1 B;  2CWU A;  2D1W A;  4HOH A;  1NB3 I;  3MKI A;  4NHF A;  1YI2 3;  2OTL 3;  3A5E A;  3MG1 A;  1YHQ 3;  1FGO A;  2P38 A;  1Q40 B;  1RN1 A;  2HMM B;  3DGO A;  3X3X A;  1RN4 A;  2W6J H;  4FCM A;  3OW2 2;  3N9H A;  1LOX A;  1IVU A;  2B1X B;  1CYV A;  3EBT A;  2CWV A;  1K9M 4;  4N6O B;  4CDL A;  1W02 A;  4EV5 A;  1WNH A;  3M8C A;  3RGR A;  4LSO A;  3CC4 3;  1IQX A;  2PNC A;  6STD A;  1AVK A;  2XF3 A;  2GEY A;  1UGI A;  4R9K A;  3FG4 A;  1DMM A;  3N8B A;  1OPY A;  3B7C A;  1RKY A;  4HM4 B;  2DP9 A;  2H0H A;  1WXX A;  3LWQ A;  4N6N B;  4RZM A;  1YJN 3;  1DYU A;  1CEW I;  3NBR A;  4HM8 B;  4PEJ A;  2KCD A;  4CJN A;  3J7Y d;  5IER A;  4XBT A;  3F9S A;  1QAF A;  2CWT A;  2IA7 A;  1AY7 A;  1HU9 A;  3TDG A;  4HM0 B;  1K41 A;  1Q82 4;  3B8L A;  1JJ2 2;  1GY7 A;  2F98 A;  3NQZ A;  1DVD A;  3BNC A;  4LEH A;  5AIF A;  4XDW A;  5KP4 A;  2Z76 A;  3NBJ A;  1STD A;  1MGW A;  2XFT A;  4MMX B;  5D81 A;  3LXU X;  2P09 A;  1G02 A;  2ZHX B;  4HZB B;  2AB4 A;  1OHP A;  2GU3 A;  2IYJ A;  1HZ1 A;  1I2E A;  5IF6 A;  2MC8 A;  1Q7Y 4;  1W6C A;  1R3F A;  2GXF A;  2CFD A;  3T8U A;  3SED A;  3LML A;  2IMJ A;  1LXE A;  2JQ5 A;  3HII A;  4N6V 0;  3FF2 A;  1W6Y A;  3IUW A;  4GB5 A;  3S29 A;  1US1 A;  2F4Y A;  3NUV A;  3CCM 3;  4J5K A;  4O02 B;  1K8A 4;  3LDF A;  3D4A A;  1ZE2 A;  4GL6 A;  2KAA A;  4DKI A;  1VQP 3;  1RN7 A;  1LNI A;  5AYR B;  2B24 B;  3F7S A;  5G2G A;  3SXX A;  4J5G A;  4EYC A;  1OF5 A;  5CK6 A;  3S28 A;  2RFK A;  2Z6B A;  1ASK A;  1I8V A;  3CPW 2;  2OQE C;  4L8P A;  3GZY B;  2BMR B;  1VQL 3;  1I2F A;  4Q53 A;  3DZL A;  1RGE A;  4MEI A;  1Y4K A;  4BTX A;  3HJW A;  2J5V A;  3EQQ B;  1JB2 A;  2P0M A;  4XBX A;  2XGL A;  1AVL A;  1RDS A;  1SAR A;  5IG3 A;  5M18 A;  2YX9 A;  3KCH A;  4U13 A;  5LC6 A;  2XR8 B;  3Q1C A;  1N5H A;  1IQY A;  1BSD A;  3JUN A;  3HJY A;  1LOV A;  1RGH A;  1TIJ A;  3A76 A;  1PYL A;  3DMC A;  3SOA A;  2FXT A;  3OWY A;  3CC7 3;  2WGO A;  2CH9 A;  1UCJ A;  2WOH A;  1AV4 A;  3M6W A;  1EUI C;  2XSH B;  2WOF A;  3LTA A;  4O8S A;  4HM2 B;  3FKA A;  1GY5 A;  1RMS A;  3GWR A;  3UB1 A;  3PS8 A;  1Q86 4;  3KKG A;  5ELJ A;  2AAD A;  2WO0 A;  1JZO A;  3JUP A;  2ANE A;  3BLZ A;  2AAE A;  4I4K A;  5BU4 A;  1BAN A;  1M1K 4;  1B2U A;  3SYU A;  3LTB A;  4K90 B;  1SIH A;  1MWU A;  1GMP A;  6RNT A;  1UW1 A;  1ZO2 A;  2Z77 A;  1A67 A;  2YFJ B;  2Y73 A;  3X3Y A;  3CCR 3;  1Z1S A;  3MG2 A;  2OQE A;  1B3S A;  1NNV A;  1T2I A;  1VQN 3;  1GMR A;  1FGM A;  3OWU A;  4N6L A;  4OK0 A;  3B4O A;  2V1L A;  3JVC A;  3Q3F A;  3F8X A;  3LWO A;  4BIR A;  2CKF B;  1B2X A;  4EXR A;  3VSY A;  2BNG A;  1ZL3 A;  1RGK A;  3S5C A;  1YNV X;  2PZV A;  1YJW 3;  1ISK A;  1Q40 A;  4CCV A;  2CFK A;  1CYU A;  4QWT A;  4N3V A;  1GOU A;  3HI7 A;  3G71 3;  1KD1 4;  4RNT A;  1IVV A;  2W56 B;  2J8X B;  2JDI H;  1S04 A;  1ZBO A;  3HOH A;  1N5P A;  1ULJ B;  2E2T A;  1EEJ A;  1B2S A;  2KXG A;  3NX0 A;  2H0G A;  3O8Y A;  3PYJ A;  1WK2 A;  1QJG A;  1ZX2 A;  4X2O A;  2OTJ 3;  5IG5 A;  1E97 A;  2Y74 A;  1I2G A;  8CHO A;  1GOY A;  1BRN L;  1GD3 A;  1S5A A;  1NWW A;  3BNE A;  3KE7 A;  5IG0 A;  1YJ9 3;  3CMA 3;  3LTD A;  5ELU A;  2MF7 A;  2CHC A;  3D5I A;  3WA2 X;  4R9L A;  4EV2 A;  1RGG A;  1UI8 A;  4OUQ A;  1S72 3;  3T8N A;  1BNS A;  4HKV B;  4STD A;  3UL6 A;  1A2P A;  1R4Y A;  3PXM A;  1V57 A;  2W56 A;  1DVC A;  3L0R A;  4FR9 A;  1YVB I;  1NB5 I;  2P0X A;  2ZL8 A;  5D83 A;  3MPH A;  1CQS A;  4KFD A;  1RSN A;  2XRX B;  1TRP A;  1LRA A;  1BNJ A;  3NM7 A;  3FSD A;  1EQK A;  2KF6 A;  3Q2P A;  1TRQ A;  7STD A;  1GMQ A;  1JBR A;  1LQG C;  1MGR A;  1RTU A;  1JV2 B;  1RGA A;  3X3Z A;  1X1X A;  4HM3 B;  1JB5 A;  3GAX A;  4WP5 A;  3MQK A;  1MWR A;  2KF5 A;  3JUQ A;  3OV4 A;  3NV0 A;  3EB8 A;  3V99 A;  4EBG A;  1TFK A;  4OVM A;  2K3D A;  1VQQ A;  1BSA A;  1TU5 A;  3LT9 A;  2C4B A;  4GHO A;  4KT3 B;  4O2H A;  1EG9 B;  2K54 A;  2ML5 A;  5CLK A;  1TP6 A;  4KFE A;  3SOY A;  3WA3 A;  1W6G A;  1QAK A;  2XH9 A; 
#chains in the Genus database with same CATH homology
 2P38 A;  3D79 A;  1K8W A;  2AB4 A;  2J5V A;  3VSE A;  2CX0 A;  3UAI A;  1Q7H A;  4DMG A;  1IQ8 A;  1T5Y A;  2J5T A;  1IT8 A;  1WXW A;  2AS0 A;  1SGV A;  1R3F A;  1ZE1 A;  1WXX A;  1R3E A;  1SQW A;  2CX1 A;  1IT7 A;  2B78 A;  4Q1T A;  2Q07 A;  3C0K A;  3LDF A;  1ZS7 A;  1ZE2 A;  1ZL3 A;  2CWW A;  1J2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...