2CX1A

Crystal structure of a pua domain (ape0525) from the aeropyrum pernix k1 (tartrate complex)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein APE0525
publication title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
total genus 48
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2cx1A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 2cx1A01
1J2BA 1WXXA 1R3FA 2Q07A 1R3EA 1K8WA 2J5VA 1IT8A 1IT7A 1ZE1A 3LDFA 1ZS7A 2CWWA 3VSEA 2CX0A 1T5YA 1Q7HA 3D79A 4Q1TA 2AS0A 1IQ8A 2J5TA 1SQWA 2P38A 1WXWA 4DMGA 3C0KA 1SGVA 1ZL3A 2CX1A 1ZE2A 2B78A 2AB4A 3UAIA
chains in the Genus database with same CATH superfamily
4HM3B 1B27A 1U8CB 1OF5B 2W56A 1VQ93 1RCLA 3D9RA 3F14A 2GU3A 1WQLB 1WMPA 2R4IA 3U1WA 4BL3A 1EA2A 5AIIA 2K54A 4O3VA 1GD3A 1CQSA 3WR2A 1LQGC 2CX0A 4L8OA 5AIHA 3FG1A 1IQYA 5ELUA 5BU4A 1BNGA 3UB1A 1JKGB 1BNEA 3CCQ3 1RN1A 4HVNA 1YGWA 5AEUB 3CCU3 1RNBA 3SX1A 2RGQA 4R1KA 3WHOA 4LSOA 2UX0A 1KQS2 4JF8A 3CC73 5TGNA 1GMQA 3EC9A 1X1XA 2WOFA 5AI1A 3LWQA 1UCJA 4IPBA 2CG1A 3GSPA 3AHSA 1Q7Y4 1E97A 1GY6A 2F86B 2IMJA 2P09A 4MMYB 1YJN3 1BGSA 3F8HA 1FGQA 1R3FA 3N8BA 1UDII 1ULJB 3KIIA 2H0GA 3QRDA 1BRHA 1HKXA 2XEPA 5DRVA 1VQM3 4L7KA 2OQEC 5AEWB 4N6MA 3VGNA 3FG4A 1DMQA 4BL2A 2GEYA 5IENA 1NO3A 5CXOA 3FGYA 2E2UA 2L4VA 1EEJA 3LMLA 2BU4A 2DP9A 4OK0A 1U5OA 4XBYA 2YX9A 4K90B 1UCIA 1MWTA 1QALA 5M18A 4JRFA 1LOYA 3BNEA 3SLUA 3EBTA 1D6UA 4FCZA 3NV0B 1BNRA 4AKYA 2M7OA 1GYBA 2XGNA 3A5EA 3CCS3 1IVXA 3KN4A 4KZ1A 3NUVA 3S28A 3EE1A 2CWWA 2F5WA 3DZLA 3I563 2Z0TA 3Q2PA 4WFOA 1E3VA 5GSPA 1RGEA 1NNVA 1NWWA 4HM1B 1I8VA 1K41A 1BOXA 1KSIA 3U28A 1OPYA 1TFOA 3KZTA 4HBRA 5AIFA 5HOHA 4HM4B 1PYLA 1RGAA 3G6E3 2E2TA 1FGMA 3CME3 4R9KA 1K8A4 3CPOA 2CFLA 5KP3A 2Z7AA 1OGXA 4G1MB 3G4S3 3X41A 3LWPA 2KAAA 3NHXA 3F9SA 3MSOA 6STDA 3M6VA 2C10A 3KSPA 3AMOB 3HZPA 3JUNA 2GBXB 4WHAA 4BU4A 4EC6A 1YIT3 2BMRB 1LOWA 2Z76A 1CH0A 2CH9A 2I9WA 3BNBA 3PXMA 4H61A 1BSBA 7GSPA 4GL6A 3OWUA 5FGOA 1CYUA 1RGLA 1QVG2 1E3RA 1UUVB 4IT7A 3X40A 2W9QA 1VQ73 1V74A 1TFKA 2KF5A 3KE7A 3M8CA 4WWUC 3B8LA 5LC6A 3BLZA 3ECFA 1FUWA 1M1XB 1RHLA 5D82A 2ML5A 3LWRA 2Y74A 4N6TA 2Z77A 1IV9A 1DETA 1SIHA 1VQ53 2JQ5A 2RFRA 3CMA3 4DKIA 4FCJA 5G2GA 1IK3A 2IA7A 1UW1A 2CFWA 1DVDA 1IT7A 2KF3A 4Q53A 5AIGA 1WK2A 1LOVA 1ZS7A 1RDSA 3JUPA 1I2GA 3ZG5A 3MG2A 3IUWA 2MF7A 4LZIA 3DY5A 3I553 3JUQA 3LH4A 4STDA 2OOVC 1VQ63 1FZUA 3LXUX 3V92A 3A76A 3DMCA 3HJWA 4J8TA 3S29A 4X2OA 5CK6A 4XBXA 1IDPA 2RFKA 2BO9B 3EBYA 1ZO2A 2FXTA 3OX9A 3WA3A 3CNXA 3S67A 3EN1B 2CW9A 3LWVA 1NB5I 5G1KA 1JB2A 2CK3H 1L5GB 3T8UA 4J9AA 2XSOB 1US1A 5IG0A 7STDA 2F5MA 1BRNL 1MOLA 4HM2B 2H0HA 2W04A 2JDIH 1S5AA 3U97A 1FGTA 3VSYA 5KP1A 1LVNA 1OGZA 2OCTA 2MC8A 5HGRA 3WODG 5IW9A 1F8NA 1DE3A 3ALAA 1JBSA 2FGTA 4MJDA 3URPA 1OH0A 3DGYA 4N6V0 2CIUA 1O7NB 2HVYA 3STDA 2O3OA 2PZVA 3JUMA 3M4XA 1SQWA 2XSHB 2Z6BA 1GSPA 4GB5A 3UNLA 3NM7A 1GOYA 4BTWA 4O2HA 1W6YA 1UCKA 1IV7A 1M9GA 1R4CA 2BMQB 2RNTA 1MGWA 4X2HA 1I3FA 2HMLB 1OHSA 4K1UA 1ZE2A 1YNVX 3CCV3 1FUSA 3HOHA 1W6GA 1UCLA 2OTL3 2KKUA 1B20A 1LOXA 2L1SA 1I70A 1I0XA 3PCRA 3Q90A 1T2IA 4MEIA 5IG4A 1KC84 4FCMA 1IU7A 1RRLA 3K63A 3DH2A 3PYJA 4KFDA 2YFIB 2CWTA 3PS8A 1M904 2QEX3 3BIRA 3CC23 3LTAA 1AY7A 3HJYA 1VQO3 2OOVA 1C7HA 3Q3FA 1B2SA 1RSNA 1UGHI 1WTHA 1N9EA 1JZDA 1VZZA 2FNQA 1T5YA 2KF6A 4HZ9B 3SVAA 1PU4A 1QVF2 3OW22 3DGNA 1X1UA 1RRHA 4J5GA 4Q1TA 1BAOA 2A15A 1EUIC 2ZA4A 4XB5A 1MGRA 4R9LA 2XRXB 4ZM8A 4HYZA 4R4KA 3M6XA 2W2CA 5IG5A 3B4PA 3F7SA 1TTOA 3GRDA 2ZL8A 3CNMA 1GMRA 1O7PB 3S27A 5JBSA 3RNTA 4CCVA 1ROAA 6RNTA 3V99A 1W2B2 1WXXA 1UI7A 1R3EA 1RGHA 4EV5A 5BXQA 1RKYA 3DGOA 2UGIA 3BNCA 2RCDA 1NU3A 1AVLA 1N8R4 5IERA 1C54A 4RBNA 4L8PA 4O02B 1V57A 2UUGC 1S04A 1EQKA 2O9UX 3DGLA 4FMDA 4U13A 2HMMB 3G8ZA 1V58A 2XFSA 4N3VA 4RZMA 4NREA 5IG3A 1TE7A 3D5GA 2IUJA 1B2MA 1RGCA 4H3UA 5M19A 3C0KA 4WYKB 1D6ZA 1AQZA 1UOYA 3TDGA 3ZG0A 1WNHA 2QGUA 1STDA 3RGAA 6GSPA 5D83A 3F7XA 2AB4A 2HOHA 2CKFB 3B4OA 1M1K4 1TRPA 3G713 1A2VA 3N9HA 1RGKA 1FYSA 3CPW2 1DYUA 1BNSA 1ZGXA 1YJ93 1IVVA 1HZ1A 1Q9EA 3AGNA 1RCKA 2OWPA 4TX4A 2OQEA 1GY5A 1I3IA 2FRXA 2AADA 7RNTA 3H51A 3K9MC 2INXA 4RNZA 1ASKA 2CFGA 1FW7A 1W7CA 4WYKA 3WOFB 2QIYA 3JVCA 2KRTA 4LMIA 3M6UA 2WGQA 1SPUA 1Q40B 3NQZA 4IIAA 2AS0A 1IQ8A 3LWOA 1Q824 1EG9B 3ER7A 3SOYA 2HMKB 3K5TA 2W9PA 4N6NB 4I4KA 3SXXA 1XNEA 4N6UA 1N9JA 2GU1A 3NX0A 3OV4A 1QMAA 1BUQA 1W02A 1SJWA 1JN5A 2LQVA 2STDA 3K0ZA 3HK4A 4ORLA 1K28A 3SOAA 3ROBA 4K61A 3NQYA 1Y4KA 1Q40A 1K8WA 2J5VA 2OTJ3 1IT8A 2GBWB 2W6JH 5G1LA 1O7HB 4FMCA 1YIJ3 1BRGA 4CDLA 3OWSA 4HM7B 2GSPA 1BSAA 4J5KA 3VF1A 1JB5A 1PFPA 2E2VA 2B24B 3FG3A 5CF2A 3LTDA 1JJ22 3FZWA 4WP5A 3DGMA 3LTCA 2BMOB 3OXAA 3BNDA 1GMPA 1VQ83 1OCVA 4NHFA 2AAEA 2KXGA 2ML6A 3PGBA 4HAAA 2CX1A 1TJDA 1TP6A 1W00A 1UGIA 2SBLA 1O7WB 1ULIB 3KKGA 1G02A 4HJLB 2EY4A 1UI8A 1YGEA 1A67A 1AR0A 1N5HA 1VQP3 3PZWA 4OVMA 1NJI4 4KFEA 2F56A 3KFQC 3NBBA 3MWZA 2SARA 1JBTA 2RBIA 1Q814 2WO0A 3RDEA 1SARA 3EHCA 2GEXA 4KVHA 3UJMA 1QJGA 1OACA 1ROVA 2BHMA 1A2PA 1BNFA 1GOUA 1RNTA 2PNCA 3Q1CA 3H3HA 1I2FA 3MHEA 1EKMA 2Y73A 5A0OB 1Q7HA 2IY2A 3D3LA 4HM8B 3MQKA 4R80A 9RNTA 4FR9A 3NBJA 2XR8B 3V98A 1TRQA 1BU4A 3KSED 5CF1A 3GZBA 3PCSA 4MMXB 2IUKA 3EN8A 3QK9A 3UL5A 4HZBB 1MWRA 3N54B 3X42A 1K734 4N6OB 2KF4A 3LT9A 4CJNA 2ANEA 1B2XA 2WGOA 3HAXA 5ELJA 4EW5A 3M6WA 1K9M4 1YVSA 5KP4A 1VQK3 3BB9A 3M65A 4GSPA 4PEJA 1STFI 1JRQA 3FSDA 1IVUA 3CCM3 1B3SA 5IEOA 1IYYA 3CC43 4CI2B 1OUNA 1RTUA 3GZRA 3FLJA 3CCR3 3D4AA 3NBRA 4LGQA 3VSEA 1BANA 1N5PA 1DVCA 1BRSA 2GXFA 3FF2A 3GAXA 5FW5A 3RGRA 2C11A 4HM5B 4XDVA 1G96A 5M1AA 1PY3A 3F40A 1Z1SA 3S5CA 1Q864 2W03A 5AYRB 1UUWB 1WXWA 3AHWA 1RMSA 1G0TA 1OF5A 3MG1A 1BSCA 3EX9A 5IF6A 1BRIA 5RNTA 1N8QA 1B2ZA 1BRJA 4HOHA 4RNTA 2CWUA 3CCL3 3X3XA 1GS3A 1BSEA 2B78A 2C4BA 1RGGA 1OHPA 2CC3A 1NDOB 2AUSA 2E5OA 3O8YA 4LYLB 1DMNA 3UAIA 3I0YA 4OUQA 1HYFA 2BT3A 2H0IA 2D1WA 1B21A 3D5IA 1ZBOA 2CHCA 3LZAA 1YHQ3 1X1YA 4EBGA 1W6CA 1JKGA 5STDA 1BIRA 5JPPA 1TUHA 4AKZA 4HM6B 5DREA 4EXRA 1X1WA 3IJEB 4XM4A 3AGOA 4GHOA 1OHOA 4I5QA 1O7GB 1BNIA 4BIRA 3HX8A 5EVHA 1BRKA 4O8SA 4QWTA 5D81A 4DMGA 3EF8A 1RJOA 1TU5A 1VQL3 3EJVA 3ZFZA 1TIJA 3KCHA 4TZ4C 2P0MA 2LYXA 3LJCA 2HMOB 1GY7A 3G0KA 4CI1B 1VQN3 3X3ZA 1J2BA 3GWRA 4KT3B 3LTBA 1BUJA 1UUGB 3NM2A 4AEQA 4FMAA 3J7Yd 1YI23 1KD14 3IMAB 1CEWI 1ZE1A 2HMJB 2WOHA 2YFLB 3HIGA 3T8NA 1JN5B 1RLSA 2P0XA 1Q42A 1ZX2A 1T3BA 2XH9A 2B1XB 4XBTA 2KCDA 1S723 1VQ43 1FUTA 3K7CA 3D79A 3ZV0C 1W2ZA 3SYUA 2RSXA 4EV2A 5CLKA 3NV0A 4NPBA 2P38A 3HIIA 2ZHXB 1FGRA 1HU9A 3L0RA 5BVBA 4CPKA 2F4YA 1VQQA 1SGVA 1LNHA 5EEOA 1WMNA 4BTYA 4RNYA 3CCJ3 2F99A 3HI7A 1RGFA 1QAFA 3SEDA 3BU4A 3E99A 1BNJA 3MPHA 2K3DA 1RN7A 3NXJA 4K1VA 1FA3A 4MMZB 1B2UA 1BVIA 2CFDA 1NB3I 3WDGB 2QA43 2Q07A 1A90A 1ISKA 1MWUA 1JV2B 1AV4A 1JZOA 3CXC2 1DMMA 1RN4A 2J8XB 2W0QA 1JNQA 8CHOA 3T0UA 1SIIA 1O7MB 3CD63 1LRAA 1LNIA 1JBRA 2HMNB 2XF3A 3G16A 3WMDA 2R41A 2CFKA 2J5TA 4CI3B 4HKVB 3WA2X 1CYVA 1YVBI 2BNGA 2CWVA 4FMBA 3AMOA 3LT8A 1WMOA 3FCSB 2D42A 1ZL3A 1W5ZA 3DXOA 3FKAA 4XDWA 5LC7A 3WOEB 3F8XA 4N6LA 2IYJA 3MG3A 3CCE3 3DUKA 1JB4A 3FF0A 3IPTA 3GZXB 8RNTA 1LXEA 3JUOA 1W4NA 1YJW3 1MWSA 2APOA 2F98A 2XFTA 2CG0A 5JPUA 1D6YA 2XGLA 3LOYA 3UL6A 3X3YA 3LDFA 1A2KA 1KWIA 1FGOA 1R4YA 3CU3A 4BTXA 3FH1A 2K0MA 3LYGA 5AYSC 5BIRA 2YFJB 3B7CA 1I2EA 2W56B 3MYTA 4LEHA 1GOVA 1LQMB 1AVKA 1I0VA 3DM8A 3EB8A 3EQQB 3MKIA 1GD4A 2V1LA 2P05A 1W01A 4KFFA 3GZYB 4HM0B 1IQXA 1T2HA 4EYCA 1IVWA 1BSDA 1MNLA 3OWYA 2ZDJA 5I97A 1QAKA 5EQLA 4ILFA 2BIRA 5IEPA
chains in the Genus database with same CATH topology
1J2BA 1WXXA 1R3FA 2Q07A 1R3EA 1K8WA 2J5VA 1IT8A 1IT7A 1ZE1A 3LDFA 1ZS7A 2CWWA 3VSEA 2CX0A 1T5YA 1Q7HA 3D79A 4Q1TA 2AS0A 1IQ8A 2J5TA 1SQWA 2P38A 1WXWA 4DMGA 3C0KA 1SGVA 1ZL3A 2CX1A 1ZE2A 2B78A 2AB4A 3UAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J2B A;  1WXX A;  1R3F A;  2Q07 A;  1R3E A;  1K8W A;  2J5V A;  1IT8 A;  1IT7 A;  1ZE1 A;  3LDF A;  1ZS7 A;  2CWW A;  3VSE A;  2CX0 A;  1T5Y A;  1Q7H A;  3D79 A;  4Q1T A;  2AS0 A;  1IQ8 A;  2J5T A;  1SQW A;  2P38 A;  1WXW A;  4DMG A;  3C0K A;  1SGV A;  1ZL3 A;  2CX1 A;  1ZE2 A;  2B78 A;  2AB4 A;  3UAI A; 
#chains in the Genus database with same CATH topology
 4HM3 B;  1B27 A;  1U8C B;  1OF5 B;  2W56 A;  1VQ9 3;  1RCL A;  3D9R A;  3F14 A;  2GU3 A;  1WQL B;  1WMP A;  2R4I A;  3U1W A;  4BL3 A;  1EA2 A;  5AII A;  2K54 A;  4O3V A;  1GD3 A;  1CQS A;  3WR2 A;  1LQG C;  2CX0 A;  4L8O A;  5AIH A;  3FG1 A;  1IQY A;  5ELU A;  5BU4 A;  1BNG A;  3UB1 A;  1JKG B;  1BNE A;  3CCQ 3;  1RN1 A;  4HVN A;  1YGW A;  5AEU B;  3CCU 3;  1RNB A;  3SX1 A;  2RGQ A;  4R1K A;  3WHO A;  4LSO A;  2UX0 A;  1KQS 2;  4JF8 A;  3CC7 3;  5TGN A;  1GMQ A;  3EC9 A;  1X1X A;  2WOF A;  5AI1 A;  3LWQ A;  1UCJ A;  4IPB A;  2CG1 A;  3GSP A;  3AHS A;  1Q7Y 4;  1E97 A;  1GY6 A;  2F86 B;  2IMJ A;  2P09 A;  4MMY B;  1YJN 3;  1BGS A;  3F8H A;  1FGQ A;  1R3F A;  3N8B A;  1UDI I;  1ULJ B;  3KII A;  2H0G A;  3QRD A;  1BRH A;  1HKX A;  2XEP A;  5DRV A;  1VQM 3;  4L7K A;  2OQE C;  5AEW B;  4N6M A;  3VGN A;  3FG4 A;  1DMQ A;  4BL2 A;  2GEY A;  5IEN A;  1NO3 A;  5CXO A;  3FGY A;  2E2U A;  2L4V A;  1EEJ A;  3LML A;  2BU4 A;  2DP9 A;  4OK0 A;  1U5O A;  4XBY A;  2YX9 A;  4K90 B;  1UCI A;  1MWT A;  1QAL A;  5M18 A;  4JRF A;  1LOY A;  3BNE A;  3SLU A;  3EBT A;  1D6U A;  4FCZ A;  3NV0 B;  1BNR A;  4AKY A;  2M7O A;  1GYB A;  2XGN A;  3A5E A;  3CCS 3;  1IVX A;  3KN4 A;  4KZ1 A;  3NUV A;  3S28 A;  3EE1 A;  2CWW A;  2F5W A;  3DZL A;  3I56 3;  2Z0T A;  3Q2P A;  4WFO A;  1E3V A;  5GSP A;  1RGE A;  1NNV A;  1NWW A;  4HM1 B;  1I8V A;  1K41 A;  1BOX A;  1KSI A;  3U28 A;  1OPY A;  1TFO A;  3KZT A;  4HBR A;  5AIF A;  5HOH A;  4HM4 B;  1PYL A;  1RGA A;  3G6E 3;  2E2T A;  1FGM A;  3CME 3;  4R9K A;  1K8A 4;  3CPO A;  2CFL A;  5KP3 A;  2Z7A A;  1OGX A;  4G1M B;  3G4S 3;  3X41 A;  3LWP A;  2KAA A;  3NHX A;  3F9S A;  3MSO A;  6STD A;  3M6V A;  2C10 A;  3KSP A;  3AMO B;  3HZP A;  3JUN A;  2GBX B;  4WHA A;  4BU4 A;  4EC6 A;  1YIT 3;  2BMR B;  1LOW A;  2Z76 A;  1CH0 A;  2CH9 A;  2I9W A;  3BNB A;  3PXM A;  4H61 A;  1BSB A;  7GSP A;  4GL6 A;  3OWU A;  5FGO A;  1CYU A;  1RGL A;  1QVG 2;  1E3R A;  1UUV B;  4IT7 A;  3X40 A;  2W9Q A;  1VQ7 3;  1V74 A;  1TFK A;  2KF5 A;  3KE7 A;  3M8C A;  4WWU C;  3B8L A;  5LC6 A;  3BLZ A;  3ECF A;  1FUW A;  1M1X B;  1RHL A;  5D82 A;  2ML5 A;  3LWR A;  2Y74 A;  4N6T A;  2Z77 A;  1IV9 A;  1DET A;  1SIH A;  1VQ5 3;  2JQ5 A;  2RFR A;  3CMA 3;  4DKI A;  4FCJ A;  5G2G A;  1IK3 A;  2IA7 A;  1UW1 A;  2CFW A;  1DVD A;  1IT7 A;  2KF3 A;  4Q53 A;  5AIG A;  1WK2 A;  1LOV A;  1ZS7 A;  1RDS A;  3JUP A;  1I2G A;  3ZG5 A;  3MG2 A;  3IUW A;  2MF7 A;  4LZI A;  3DY5 A;  3I55 3;  3JUQ A;  3LH4 A;  4STD A;  2OOV C;  1VQ6 3;  1FZU A;  3LXU X;  3V92 A;  3A76 A;  3DMC A;  3HJW A;  4J8T A;  3S29 A;  4X2O A;  5CK6 A;  4XBX A;  1IDP A;  2RFK A;  2BO9 B;  3EBY A;  1ZO2 A;  2FXT A;  3OX9 A;  3WA3 A;  3CNX A;  3S67 A;  3EN1 B;  2CW9 A;  3LWV A;  1NB5 I;  5G1K A;  1JB2 A;  2CK3 H;  1L5G B;  3T8U A;  4J9A A;  2XSO B;  1US1 A;  5IG0 A;  7STD A;  2F5M A;  1BRN L;  1MOL A;  4HM2 B;  2H0H A;  2W04 A;  2JDI H;  1S5A A;  3U97 A;  1FGT A;  3VSY A;  5KP1 A;  1LVN A;  1OGZ A;  2OCT A;  2MC8 A;  5HGR A;  3WOD G;  5IW9 A;  1F8N A;  1DE3 A;  3ALA A;  1JBS A;  2FGT A;  4MJD A;  3URP A;  1OH0 A;  3DGY A;  4N6V 0;  2CIU A;  1O7N B;  2HVY A;  3STD A;  2O3O A;  2PZV A;  3JUM A;  3M4X A;  1SQW A;  2XSH B;  2Z6B A;  1GSP A;  4GB5 A;  3UNL A;  3NM7 A;  1GOY A;  4BTW A;  4O2H A;  1W6Y A;  1UCK A;  1IV7 A;  1M9G A;  1R4C A;  2BMQ B;  2RNT A;  1MGW A;  4X2H A;  1I3F A;  2HML B;  1OHS A;  4K1U A;  1ZE2 A;  1YNV X;  3CCV 3;  1FUS A;  3HOH A;  1W6G A;  1UCL A;  2OTL 3;  2KKU A;  1B20 A;  1LOX A;  2L1S A;  1I70 A;  1I0X A;  3PCR A;  3Q90 A;  1T2I A;  4MEI A;  5IG4 A;  1KC8 4;  4FCM A;  1IU7 A;  1RRL A;  3K63 A;  3DH2 A;  3PYJ A;  4KFD A;  2YFI B;  2CWT A;  3PS8 A;  1M90 4;  2QEX 3;  3BIR A;  3CC2 3;  3LTA A;  1AY7 A;  3HJY A;  1VQO 3;  2OOV A;  1C7H A;  3Q3F A;  1B2S A;  1RSN A;  1UGH I;  1WTH A;  1N9E A;  1JZD A;  1VZZ A;  2FNQ A;  1T5Y A;  2KF6 A;  4HZ9 B;  3SVA A;  1PU4 A;  1QVF 2;  3OW2 2;  3DGN A;  1X1U A;  1RRH A;  4J5G A;  4Q1T A;  1BAO A;  2A15 A;  1EUI C;  2ZA4 A;  4XB5 A;  1MGR A;  4R9L A;  2XRX B;  4ZM8 A;  4HYZ A;  4R4K A;  3M6X A;  2W2C A;  5IG5 A;  3B4P A;  3F7S A;  1TTO A;  3GRD A;  2ZL8 A;  3CNM A;  1GMR A;  1O7P B;  3S27 A;  5JBS A;  3RNT A;  4CCV A;  1ROA A;  6RNT A;  3V99 A;  1W2B 2;  1WXX A;  1UI7 A;  1R3E A;  1RGH A;  4EV5 A;  5BXQ A;  1RKY A;  3DGO A;  2UGI A;  3BNC A;  2RCD A;  1NU3 A;  1AVL A;  1N8R 4;  5IER A;  1C54 A;  4RBN A;  4L8P A;  4O02 B;  1V57 A;  2UUG C;  1S04 A;  1EQK A;  2O9U X;  3DGL A;  4FMD A;  4U13 A;  2HMM B;  3G8Z A;  1V58 A;  2XFS A;  4N3V A;  4RZM A;  4NRE A;  5IG3 A;  1TE7 A;  3D5G A;  2IUJ A;  1B2M A;  1RGC A;  4H3U A;  5M19 A;  3C0K A;  4WYK B;  1D6Z A;  1AQZ A;  1UOY A;  3TDG A;  3ZG0 A;  1WNH A;  2QGU A;  1STD A;  3RGA A;  6GSP A;  5D83 A;  3F7X A;  2AB4 A;  2HOH A;  2CKF B;  3B4O A;  1M1K 4;  1TRP A;  3G71 3;  1A2V A;  3N9H A;  1RGK A;  1FYS A;  3CPW 2;  1DYU A;  1BNS A;  1ZGX A;  1YJ9 3;  1IVV A;  1HZ1 A;  1Q9E A;  3AGN A;  1RCK A;  2OWP A;  4TX4 A;  2OQE A;  1GY5 A;  1I3I A;  2FRX A;  2AAD A;  7RNT A;  3H51 A;  3K9M C;  2INX A;  4RNZ A;  1ASK A;  2CFG A;  1FW7 A;  1W7C A;  4WYK A;  3WOF B;  2QIY A;  3JVC A;  2KRT A;  4LMI A;  3M6U A;  2WGQ A;  1SPU A;  1Q40 B;  3NQZ A;  4IIA A;  2AS0 A;  1IQ8 A;  3LWO A;  1Q82 4;  1EG9 B;  3ER7 A;  3SOY A;  2HMK B;  3K5T A;  2W9P A;  4N6N B;  4I4K A;  3SXX A;  1XNE A;  4N6U A;  1N9J A;  2GU1 A;  3NX0 A;  3OV4 A;  1QMA A;  1BUQ A;  1W02 A;  1SJW A;  1JN5 A;  2LQV A;  2STD A;  3K0Z A;  3HK4 A;  4ORL A;  1K28 A;  3SOA A;  3ROB A;  4K61 A;  3NQY A;  1Y4K A;  1Q40 A;  1K8W A;  2J5V A;  2OTJ 3;  1IT8 A;  2GBW B;  2W6J H;  5G1L A;  1O7H B;  4FMC A;  1YIJ 3;  1BRG A;  4CDL A;  3OWS A;  4HM7 B;  2GSP A;  1BSA A;  4J5K A;  3VF1 A;  1JB5 A;  1PFP A;  2E2V A;  2B24 B;  3FG3 A;  5CF2 A;  3LTD A;  1JJ2 2;  3FZW A;  4WP5 A;  3DGM A;  3LTC A;  2BMO B;  3OXA A;  3BND A;  1GMP A;  1VQ8 3;  1OCV A;  4NHF A;  2AAE A;  2KXG A;  2ML6 A;  3PGB A;  4HAA A;  2CX1 A;  1TJD A;  1TP6 A;  1W00 A;  1UGI A;  2SBL A;  1O7W B;  1ULI B;  3KKG A;  1G02 A;  4HJL B;  2EY4 A;  1UI8 A;  1YGE A;  1A67 A;  1AR0 A;  1N5H A;  1VQP 3;  3PZW A;  4OVM A;  1NJI 4;  4KFE A;  2F56 A;  3KFQ C;  3NBB A;  3MWZ A;  2SAR A;  1JBT A;  2RBI A;  1Q81 4;  2WO0 A;  3RDE A;  1SAR A;  3EHC A;  2GEX A;  4KVH A;  3UJM A;  1QJG A;  1OAC A;  1ROV A;  2BHM A;  1A2P A;  1BNF A;  1GOU A;  1RNT A;  2PNC A;  3Q1C A;  3H3H A;  1I2F A;  3MHE A;  1EKM A;  2Y73 A;  5A0O B;  1Q7H A;  2IY2 A;  3D3L A;  4HM8 B;  3MQK A;  4R80 A;  9RNT A;  4FR9 A;  3NBJ A;  2XR8 B;  3V98 A;  1TRQ A;  1BU4 A;  3KSE D;  5CF1 A;  3GZB A;  3PCS A;  4MMX B;  2IUK A;  3EN8 A;  3QK9 A;  3UL5 A;  4HZB B;  1MWR A;  3N54 B;  3X42 A;  1K73 4;  4N6O B;  2KF4 A;  3LT9 A;  4CJN A;  2ANE A;  1B2X A;  2WGO A;  3HAX A;  5ELJ A;  4EW5 A;  3M6W A;  1K9M 4;  1YVS A;  5KP4 A;  1VQK 3;  3BB9 A;  3M65 A;  4GSP A;  4PEJ A;  1STF I;  1JRQ A;  3FSD A;  1IVU A;  3CCM 3;  1B3S A;  5IEO A;  1IYY A;  3CC4 3;  4CI2 B;  1OUN A;  1RTU A;  3GZR A;  3FLJ A;  3CCR 3;  3D4A A;  3NBR A;  4LGQ A;  3VSE A;  1BAN A;  1N5P A;  1DVC A;  1BRS A;  2GXF A;  3FF2 A;  3GAX A;  5FW5 A;  3RGR A;  2C11 A;  4HM5 B;  4XDV A;  1G96 A;  5M1A A;  1PY3 A;  3F40 A;  1Z1S A;  3S5C A;  1Q86 4;  2W03 A;  5AYR B;  1UUW B;  1WXW A;  3AHW A;  1RMS A;  1G0T A;  1OF5 A;  3MG1 A;  1BSC A;  3EX9 A;  5IF6 A;  1BRI A;  5RNT A;  1N8Q A;  1B2Z A;  1BRJ A;  4HOH A;  4RNT A;  2CWU A;  3CCL 3;  3X3X A;  1GS3 A;  1BSE A;  2B78 A;  2C4B A;  1RGG A;  1OHP A;  2CC3 A;  1NDO B;  2AUS A;  2E5O A;  3O8Y A;  4LYL B;  1DMN A;  3UAI A;  3I0Y A;  4OUQ A;  1HYF A;  2BT3 A;  2H0I A;  2D1W A;  1B21 A;  3D5I A;  1ZBO A;  2CHC A;  3LZA A;  1YHQ 3;  1X1Y A;  4EBG A;  1W6C A;  1JKG A;  5STD A;  1BIR A;  5JPP A;  1TUH A;  4AKZ A;  4HM6 B;  5DRE A;  4EXR A;  1X1W A;  3IJE B;  4XM4 A;  3AGO A;  4GHO A;  1OHO A;  4I5Q A;  1O7G B;  1BNI A;  4BIR A;  3HX8 A;  5EVH A;  1BRK A;  4O8S A;  4QWT A;  5D81 A;  4DMG A;  3EF8 A;  1RJO A;  1TU5 A;  1VQL 3;  3EJV A;  3ZFZ A;  1TIJ A;  3KCH A;  4TZ4 C;  2P0M A;  2LYX A;  3LJC A;  2HMO B;  1GY7 A;  3G0K A;  4CI1 B;  1VQN 3;  3X3Z A;  1J2B A;  3GWR A;  4KT3 B;  3LTB A;  1BUJ A;  1UUG B;  3NM2 A;  4AEQ A;  4FMA A;  3J7Y d;  1YI2 3;  1KD1 4;  3IMA B;  1CEW I;  1ZE1 A;  2HMJ B;  2WOH A;  2YFL B;  3HIG A;  3T8N A;  1JN5 B;  1RLS A;  2P0X A;  1Q42 A;  1ZX2 A;  1T3B A;  2XH9 A;  2B1X B;  4XBT A;  2KCD A;  1S72 3;  1VQ4 3;  1FUT A;  3K7C A;  3D79 A;  3ZV0 C;  1W2Z A;  3SYU A;  2RSX A;  4EV2 A;  5CLK A;  3NV0 A;  4NPB A;  2P38 A;  3HII A;  2ZHX B;  1FGR A;  1HU9 A;  3L0R A;  5BVB A;  4CPK A;  2F4Y A;  1VQQ A;  1SGV A;  1LNH A;  5EEO A;  1WMN A;  4BTY A;  4RNY A;  3CCJ 3;  2F99 A;  3HI7 A;  1RGF A;  1QAF A;  3SED A;  3BU4 A;  3E99 A;  1BNJ A;  3MPH A;  2K3D A;  1RN7 A;  3NXJ A;  4K1V A;  1FA3 A;  4MMZ B;  1B2U A;  1BVI A;  2CFD A;  1NB3 I;  3WDG B;  2QA4 3;  2Q07 A;  1A90 A;  1ISK A;  1MWU A;  1JV2 B;  1AV4 A;  1JZO A;  3CXC 2;  1DMM A;  1RN4 A;  2J8X B;  2W0Q A;  1JNQ A;  8CHO A;  3T0U A;  1SII A;  1O7M B;  3CD6 3;  1LRA A;  1LNI A;  1JBR A;  2HMN B;  2XF3 A;  3G16 A;  3WMD A;  2R41 A;  2CFK A;  2J5T A;  4CI3 B;  4HKV B;  3WA2 X;  1CYV A;  1YVB I;  2BNG A;  2CWV A;  4FMB A;  3AMO A;  3LT8 A;  1WMO A;  3FCS B;  2D42 A;  1ZL3 A;  1W5Z A;  3DXO A;  3FKA A;  4XDW A;  5LC7 A;  3WOE B;  3F8X A;  4N6L A;  2IYJ A;  3MG3 A;  3CCE 3;  3DUK A;  1JB4 A;  3FF0 A;  3IPT A;  3GZX B;  8RNT A;  1LXE A;  3JUO A;  1W4N A;  1YJW 3;  1MWS A;  2APO A;  2F98 A;  2XFT A;  2CG0 A;  5JPU A;  1D6Y A;  2XGL A;  3LOY A;  3UL6 A;  3X3Y A;  3LDF A;  1A2K A;  1KWI A;  1FGO A;  1R4Y A;  3CU3 A;  4BTX A;  3FH1 A;  2K0M A;  3LYG A;  5AYS C;  5BIR A;  2YFJ B;  3B7C A;  1I2E A;  2W56 B;  3MYT A;  4LEH A;  1GOV A;  1LQM B;  1AVK A;  1I0V A;  3DM8 A;  3EB8 A;  3EQQ B;  3MKI A;  1GD4 A;  2V1L A;  2P05 A;  1W01 A;  4KFF A;  3GZY B;  4HM0 B;  1IQX A;  1T2H A;  4EYC A;  1IVW A;  1BSD A;  1MNL A;  3OWY A;  2ZDJ A;  5I97 A;  1QAK A;  5EQL A;  4ILF A;  2BIR A;  5IEP A; 
#chains in the Genus database with same CATH homology
 1J2B A;  1WXX A;  1R3F A;  2Q07 A;  1R3E A;  1K8W A;  2J5V A;  1IT8 A;  1IT7 A;  1ZE1 A;  3LDF A;  1ZS7 A;  2CWW A;  3VSE A;  2CX0 A;  1T5Y A;  1Q7H A;  3D79 A;  4Q1T A;  2AS0 A;  1IQ8 A;  2J5T A;  1SQW A;  2P38 A;  1WXW A;  4DMG A;  3C0K A;  1SGV A;  1ZL3 A;  2CX1 A;  1ZE2 A;  2B78 A;  2AB4 A;  3UAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...