2CX1A

Crystal structure of a pua domain (ape0525) from the aeropyrum pernix k1 (tartrate complex)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein APE0525
total genus 48
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2cx1A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 2cx1A01
1ZS7A 1WXWA 2P38A 3UAIA 1J2BA 1SGVA 3D79A 2CWWA 2CX0A 1T5YA 3VSEA 1WXXA 1Q7HA 3C0KA 2J5TA 1IT8A 1ZL3A 1ZE2A 1IT7A 2Q07A 2AS0A 3LDFA 2AB4A 1R3FA 1K8WA 2B78A 1SQWA 4DMGA 4Q1TA 1R3EA 1IQ8A 2CX1A 2J5VA 1ZE1A
chains in the Genus database with same CATH superfamily
1WXWA 1RGFA 1FGMA 2L4VA 3DUKA 1B27A 1IK3A 1GY6A 4RZMA 4TZ4C 2OOVA 3WDGB 1R4CA 4GHOA 1TRPA 3KN4A 5I97A 1GOUA 3FCSB 4R9LA 6RNTA 1M1K4 1FUSA 2M7OA 4AEQA 5AEUB 4MMXB 1LOVA 3LZAA 5IENA 1IQXA 3B8LA 1VQL3 2C11A 1NO3A 3I0YA 3JUPA 4TX4A 3MWZA 2ZA4A 3CCR3 3K5TA 1FA3A 2E2VA 3M6XA 1W6CA 3FGYA 4BIRA 2Y74A 1B2SA 3BNCA 5JBSA 1W00A 1TFKA 2CFDA 1Q40B 2RBIA 3DGYA 3DY5A 3NBRA 4HJLB 3PXMA 1XNEA 3UAIA 1WQLB 2OCTA 3LWOA 3GZBA 3J7Yd 4KFDA 3FG1A 4OK0A 1BVIA 3LXUX 1VZZA 4R9KA 3DGOA 1D6UA 3DM8A 3EBTA 1UW1A 1Q824 2CKFB 1FGOA 2XFSA 1UCJA 1VQ53 2IUKA 1MWSA 3U28A 3FF2A 3CC23 1T2IA 2GSPA 3F14A 3NUVA 4FMDA 1N8R4 1UCLA 4BTXA 1K8WA 2KAAA 3MHEA 1MGRA 1JJ22 4LYLB 4WP5A 3MQKA 1LQGC 4MMZB 1JB4A 3CCJ3 4CCVA 2Y73A 5M19A 3EBYA 1I2GA 4XBXA 3URPA 3CXC2 1BSCA 1YI23 1RGHA 2BIRA 5M18A 1YJN3 1I2FA 3JUOA 2P38A 1O7HB 4NREA 7RNTA 3WOEB 4EYCA 5CF1A 3I553 1EKMA 1BRIA 1AVLA 1W2B2 3EQQB 1NNVA 3G6E3 3PZWA 1BAOA 1OUNA 1JBSA 3LTDA 1IQYA 5EVHA 4L7KA 2O3OA 3LYGA 3FG4A 4XBTA 1RSNA 3RNTA 1IT8A 1ZX2A 3NHXA 3K63A 5EEOA 1LRAA 5D82A 2STDA 2KF6A 4O2HA 3M6UA 2OTJ3 4XB5A 3M6VA 1LQMB 1TFOA 1U8CB 1MNLA 4LGQA 1BUQA 4GSPA 1IQ8A 1GD4A 1BNRA 2YX9A 3U97A 1NB3I 2ZL8A 1QVF2 3NQZA 1D6ZA 1LNHA 3BNEA 3MSOA 1RCLA 1SJWA 2HMMB 2CFLA 4WHAA 5M1AA 3D79A 1I0VA 6STDA 1LVNA 5BU4A 3BU4A 3IJEB 3X42A 1BU4A 3CCQ3 2D42A 3HIIA 3I563 1FGQA 1MWUA 2BT3A 3GZRA 3KSPA 1MGWA 1CYUA 4G1MB 1BNFA 1RHLA 1QAFA 2BMOB 3HI7A 3BIRA 3NX0A 1UI7A 1N5PA 3CPOA 4RNTA 3CCV3 2P05A 1BANA 2Q07A 1LXEA 3DZLA 3K0ZA 3T0UA 3OWUA 1YNVX 3ZG5A 1RTUA 1RRLA 3KE7A 3LT8A 2H0GA 2QA43 4Q1TA 2J8XB 2H0IA 1VQ43 1FGRA 5BXQA 1MWRA 1O7GB 1YJ93 1YJW3 2JDIH 1NU3A 1KD14 4HZ9B 1JB5A 2PZVA 2HMLB 1RKYA 3UB1A 2YFIB 4J5KA 1X1WA 1JNQA 4EW5A 1JBTA 1TIJA 1E3VA 1SIIA 3EX9A 1B2MA 2IUJA 2CH9A 4N6TA 3WA2X 1NDOB 1VQN3 1FW7A 5IW9A 5LC7A 4KT3B 1NWWA 1B21A 1QJGA 3HIGA 4N6OB 1Q7Y4 2LYXA 3DH2A 4HM4B 1CQSA 1W01A 3T8UA 7GSPA 1BNIA 1RGLA 1EA2A 1FUTA 3M8CA 1K734 2L1SA 1IU7A 1LOWA 1BNGA 1WTHA 3D5GA 4CDLA 4CI1B 1BRNL 1B2ZA 4QWTA 1TUHA 4HM0B 3WMDA 1IV7A 3GZYB 3NBBA 4EV2A 1GYBA 2CHCA 4LZIA 3X3YA 4XDWA 2GEXA 4X2OA 1GOYA 1KQS2 4STDA 3RGAA 1DETA 1BRKA 2CX0A 1RCKA 1UUVB 3BNBA 3MYTA 1TJDA 3S27A 1GY7A 1FUWA 4R1KA 1RN7A 1NJI4 1KWIA 1OGZA 4O3VA 3HJWA 2CFWA 1US1A 1STFI 1EUIC 2B24B 1B2UA 1HZ1A 3JUMA 4HOHA 3B7CA 1BUJA 1JZOA 2K54A 8RNTA 4AKZA 2AS0A 4N6V0 1VQK3 5IERA 3F40A 3N8BA 1ZGXA 2XGLA 4ILFA 1ROVA 2E5OA 3DGNA 1SQWA 1UCKA 2XSOB 3OXAA 1DVDA 5ELUA 2UUGC 5DREA 3IUWA 2W04A 1M904 3BB9A 3NM2A 3NXJA 4N6UA 4X2HA 1E3RA 5AIGA 1ZE1A 2CG0A 3GAXA 2FXTA 2HMOB 2BHMA 2F56A 2XFTA 3AGOA 1T2HA 4LEHA 3GWRA 2OTL3 2FNQA 1IYYA 1GD3A 2W56B 1BRJA 3BLZA 4FCJA 4N6LA 1ASKA 4CI2B 1BRGA 1B2XA 2XF3A 4RNYA 1YIT3 4HM7B 1IVUA 3M65A 1FYSA 2AUSA 1HU9A 3Q2PA 4KZ1A 3G713 2KF5A 1AV4A 3EB8A 1YGEA 4MMYB 1JKGB 2W6JH 3AGNA 4H61A 1VQ73 2PNCA 4HM2B 1RNTA 3ZV0C 3CPW2 5RNTA 2FRXA 1DMQA 2MF7A 5CLKA 4HAAA 1IVVA 3SOYA 1GSPA 1L5GB 4FMBA 3A76A 2K0MA 4L8OA 3AHSA 5JPPA 1KSIA 3ER7A 1A2PA 3Q90A 5KP1A 1Z1SA 1N9JA 2R41A 4XBYA 5IG4A 2P09A 2W2CA 3VSEA 2GEYA 1Q40A 1W2ZA 3RDEA 3SVAA 1HKXA 2CWUA 1IV9A 3K9MC 1HYFA 3Q3FA 4FCMA 5EQLA 3UL6A 1TU5A 1BNSA 2WOHA 4WWUC 3UL5A 2H0HA 1C7HA 3DGLA 3RGRA 1GMRA 2BNGA 2OWPA 3LWRA 4N6NB 3NM7A 1OHSA 1RGAA 1G96A 1O7MB 4EXRA 3V98A 1OHPA 1NB5I 5TGNA 3KZTA 5AEWB 4L8PA 2OQEA 3B4OA 3JUNA 1BOXA 3SX1A 1VQP3 3X3ZA 6GSPA 3WA3A 1RN1A 2Z6BA 2W9PA 1TE7A 1O7NB 2CWWA 1Q42A 1RGGA 3HX8A 5KP4A 2Z76A 3FKAA 3N9HA 3CCS3 5BVBA 2WGOA 2UX0A 3CCL3 1BRHA 3WR2A 3DGMA 2XH9A 4J5GA 1OF5B 3ROBA 3DMCA 3O8YA 8CHOA 3NV0A 3CCU3 4R4KA 3ZG0A 1OACA 2HMNB 1Q9EA 1EQKA 2EY4A 1DMMA 2GBXB 1VQO3 3A5EA 4H3UA 3CC43 4HBRA 3LOYA 3F9SA 2YFLB 3LT9A 4N6MA 2CW9A 1E97A 1WNHA 4FMAA 3Q1CA 1ZBOA 1I70A 1W7CA 5AYRB 1ZO2A 3AMOB 4OVMA 3ZFZA 3WODG 2KKUA 1YHQ3 3NBJA 2XR8B 3FLJA 2CG1A 3CCM3 3HK4A 1SGVA 2ML6A 1WMNA 4IPBA 2ZDJA 2KRTA 3LWQA 1OHOA 4EC6A 5LC6A 3D5IA 1V58A 3BNDA 4MJDA 5AI1A 5G1KA 3CD63 4FR9A 1Q7HA 2CWTA 1UGIA 1TP6A 3IMAB 1I3FA 1RDSA 3L0RA 2AADA 4O02B 2WOFA 1TRQA 4XDVA 3LDFA 2B1XB 1MWTA 4EBGA 1A2VA 3AHWA 3WHOA 1OGXA 1N9EA 1OPYA 1UUWB 3GSPA 3M4XA 4FMCA 3EC9A 2C4BA 2B78A 1B20A 5IG0A 4DMGA 3OWSA 1BSBA 1I3IA 3V99A 3B4PA 2Z0TA 4GB5A 4K61A 4NHFA 4OUQA 3EN1B 1MOLA 1GMQA 1UCIA 1UOYA 1RJOA 3OV4A 3EN8A 5BIRA 1ZS7A 1PFPA 1IVXA 1RGCA 2HVYA 1U5OA 4KVHA 2KF4A 4U13A 4BL2A 2AAEA 2LQVA 2Z77A 3X41A 1UUGB 2IYJA 1GOVA 3E99A 3QK9A 4HM8B 4KFEA 1Q864 1SPUA 1ISKA 1YGWA 3PS8A 2GU1A 3AMOA 1WXXA 5FW5A 3X40A 1S5AA 3LTAA 1ULJB 3F7SA 3JUQA 3OX9A 2ANEA 1BSDA 4LSOA 1GY5A 2K3DA 1AVKA 3DXOA 5KP3A 3S5CA 1RN4A 2HOHA 2P0MA 1QMAA 2F98A 3V92A 2HMJB 1V57A 3PGBA 3GRDA 1SIHA 1WMPA 1PYLA 4KFFA 4HKVB 3G16A 4WYKB 2E2UA 2SBLA 3F7XA 5GSPA 2Z7AA 5IG5A 5IG3A 5A0OB 1BGSA 1UGHI 1J2BA 1W6GA 2W9QA 3VF1A 2I9WA 5D83A 1QALA 1AQZA 4DKIA 3EF8A 1JN5A 5CXOA 1FZUA 1B3SA 2INXA 1LOYA 2O9UX 2OQEC 3FF0A 2QIYA 1WK2A 3T8NA 3NQYA 4I4KA 3D4AA 4XM4A 2IA7A 1ULIB 2AB4A 1N8QA 2QGUA 5AIFA 3CC73 2KF3A 1R3FA 2QEX3 3H3HA 2WO0A 3LTCA 1A67A 2F86B 4K1UA 1R4YA 2RSXA 1LNIA 4HZBB 3HOHA 1QVG2 4J8TA 3S67A 3MG3A 2CX1A 1KC84 1VQ93 2APOA 3PCRA 3UNLA 2XGNA 4K90B 3G0KA 3X3XA 5HGRA 1O7WB 1N5HA 3F8XA 1RNBA 2V1LA 2W03A 4HYZA 1ROAA 1K28A 1RGKA 3LWVA 4IT7A 3VGNA 3CMA3 1VQ63 1C54A 1DYUA 2E2TA 2YFJB 1S723 1DMNA 4BTYA 4WYKA 1AY7A 2HMKB 2RGQA 1IDPA 3KSED 4HM1B 3C0KA 3F8HA 4MEIA 5DRVA 1Y4KA 3D9RA 4BTWA 7STDA 3IPTA 5G1LA 1ZE2A 2A15A 2MC8A 1EEJA 1WMOA 1RLSA 1JKGA 3PCSA 5IEPA 2BO9B 2R4IA 1STDA 4IIAA 4JF8A 1CYVA 3MPHA 5AYSC 1G02A 1SARA 1GMPA 1YVSA 1BNJA 1M9GA 3LH4A 4NPBA 5STDA 2CWVA 3VSYA 4WFOA 1R3EA 1GS3A 3FZWA 2W0QA 3UJMA 3H51A 3KFQC 2GU3A 1O7PB 3GZXB 1YVBI 2BU4A 2XEPA 4ORLA 1K8A4 3OWYA 3FG3A 1K9M4 4J9AA 3EJVA 1BSAA 1I0XA 4BL3A 3KIIA 3MG1A 3MKIA 4HM5B 2F5MA 1F8NA 4N3VA 3LTBA 3ECFA 5AIHA 2DP9A 1K41A 3U1WA 4LMIA 2ZHXB 3G8ZA 1JRQA 4R80A 4EV5A 1VQQA 3LMLA 3SOAA 3CNXA 1A2KA 3STDA 5G2GA 5IF6A 4GL6A 3HAXA 3SXXA 1RGEA 2CFGA 1YIJ3 1JV2B 2P0XA 3EHCA 2FGTA 1S04A 1A90A 3S29A 1JBRA 2BMQB 3TDGA 1D6YA 1UI8A 2BMRB 2KCDA 3FH1A 2GBWB 3HJYA 2CK3H 3CNMA 1W02A 3OW22 2RFRA 1EG9B 2CFKA 1PU4A 1QAKA 1X1UA 4AKYA 2IY2A 1OCVA 2RFKA 2OOVC 5D81A 2F4YA 5HOHA 1OH0A 4RBNA 1AR0A 1ZL3A 4ZM8A 1DE3A 1IT7A 2CIUA 4I5QA 1BSEA 1RMSA 2ML5A 2CC3A 1VQ83 3S28A 1X1YA 1IVWA 1CH0A 1T3BA 1V74A 2RNTA 3D3LA 5CF2A 1OF5A 4JRFA 2D1WA 9RNTA 4HM6B 3SEDA 1W6YA 1G0TA 5ELJA 1CEWI 3CME3 1BIRA 1PY3A 1UDII 3SLUA 3JVCA 2W56A 1TTOA 2XSHB 3HZPA 4O8SA 2F5WA 1JN5B 2SARA 3LJCA 4HM3B 1JZDA 5CK6A 3KCHA 1LOXA 3ALAA 3CU3A 3SYUA 4K1VA 1T5YA 1BRSA 2IMJA 4CJNA 1BNEA 3G4S3 1W5ZA 2KXGA 2UGIA 3CCE3 2WGQA 3PYJA 1I2EA 1JB2A 2RCDA 3LWPA 2J5TA 4BU4A 3M6WA 5IEOA 5FGOA 1X1XA 1Q814 4FCZA 1RRHA 1FGTA 3QRDA 5AIIA 1I8VA 2C10A 4PEJA 1W4NA 3K7CA 3NV0B 4CPKA 4HVNA 3WOFB 2F99A 2XRXB 3KKGA 2JQ5A 4Q53A 4RNZA 3FSDA 4CI3B 1M1XB 5JPUA 1DVCA 3MG2A 3N54B 1VQM3 3EE1A 2J5VA 2GXFA
chains in the Genus database with same CATH topology
1ZS7A 1WXWA 2P38A 3UAIA 1J2BA 1SGVA 3D79A 2CWWA 2CX0A 1T5YA 3VSEA 1WXXA 1Q7HA 3C0KA 2J5TA 1IT8A 1ZL3A 1ZE2A 1IT7A 2Q07A 2AS0A 3LDFA 2AB4A 1R3FA 1K8WA 2B78A 1SQWA 4DMGA 4Q1TA 1R3EA 1IQ8A 2CX1A 2J5VA 1ZE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZS7 A;  1WXW A;  2P38 A;  3UAI A;  1J2B A;  1SGV A;  3D79 A;  2CWW A;  2CX0 A;  1T5Y A;  3VSE A;  1WXX A;  1Q7H A;  3C0K A;  2J5T A;  1IT8 A;  1ZL3 A;  1ZE2 A;  1IT7 A;  2Q07 A;  2AS0 A;  3LDF A;  2AB4 A;  1R3F A;  1K8W A;  2B78 A;  1SQW A;  4DMG A;  4Q1T A;  1R3E A;  1IQ8 A;  2CX1 A;  2J5V A;  1ZE1 A; 
#chains in the Genus database with same CATH topology
 1WXW A;  1RGF A;  1FGM A;  2L4V A;  3DUK A;  1B27 A;  1IK3 A;  1GY6 A;  4RZM A;  4TZ4 C;  2OOV A;  3WDG B;  1R4C A;  4GHO A;  1TRP A;  3KN4 A;  5I97 A;  1GOU A;  3FCS B;  4R9L A;  6RNT A;  1M1K 4;  1FUS A;  2M7O A;  4AEQ A;  5AEU B;  4MMX B;  1LOV A;  3LZA A;  5IEN A;  1IQX A;  3B8L A;  1VQL 3;  2C11 A;  1NO3 A;  3I0Y A;  3JUP A;  4TX4 A;  3MWZ A;  2ZA4 A;  3CCR 3;  3K5T A;  1FA3 A;  2E2V A;  3M6X A;  1W6C A;  3FGY A;  4BIR A;  2Y74 A;  1B2S A;  3BNC A;  5JBS A;  1W00 A;  1TFK A;  2CFD A;  1Q40 B;  2RBI A;  3DGY A;  3DY5 A;  3NBR A;  4HJL B;  3PXM A;  1XNE A;  3UAI A;  1WQL B;  2OCT A;  3LWO A;  3GZB A;  3J7Y d;  4KFD A;  3FG1 A;  4OK0 A;  1BVI A;  3LXU X;  1VZZ A;  4R9K A;  3DGO A;  1D6U A;  3DM8 A;  3EBT A;  1UW1 A;  1Q82 4;  2CKF B;  1FGO A;  2XFS A;  1UCJ A;  1VQ5 3;  2IUK A;  1MWS A;  3U28 A;  3FF2 A;  3CC2 3;  1T2I A;  2GSP A;  3F14 A;  3NUV A;  4FMD A;  1N8R 4;  1UCL A;  4BTX A;  1K8W A;  2KAA A;  3MHE A;  1MGR A;  1JJ2 2;  4LYL B;  4WP5 A;  3MQK A;  1LQG C;  4MMZ B;  1JB4 A;  3CCJ 3;  4CCV A;  2Y73 A;  5M19 A;  3EBY A;  1I2G A;  4XBX A;  3URP A;  3CXC 2;  1BSC A;  1YI2 3;  1RGH A;  2BIR A;  5M18 A;  1YJN 3;  1I2F A;  3JUO A;  2P38 A;  1O7H B;  4NRE A;  7RNT A;  3WOE B;  4EYC A;  5CF1 A;  3I55 3;  1EKM A;  1BRI A;  1AVL A;  1W2B 2;  3EQQ B;  1NNV A;  3G6E 3;  3PZW A;  1BAO A;  1OUN A;  1JBS A;  3LTD A;  1IQY A;  5EVH A;  4L7K A;  2O3O A;  3LYG A;  3FG4 A;  4XBT A;  1RSN A;  3RNT A;  1IT8 A;  1ZX2 A;  3NHX A;  3K63 A;  5EEO A;  1LRA A;  5D82 A;  2STD A;  2KF6 A;  4O2H A;  3M6U A;  2OTJ 3;  4XB5 A;  3M6V A;  1LQM B;  1TFO A;  1U8C B;  1MNL A;  4LGQ A;  1BUQ A;  4GSP A;  1IQ8 A;  1GD4 A;  1BNR A;  2YX9 A;  3U97 A;  1NB3 I;  2ZL8 A;  1QVF 2;  3NQZ A;  1D6Z A;  1LNH A;  3BNE A;  3MSO A;  1RCL A;  1SJW A;  2HMM B;  2CFL A;  4WHA A;  5M1A A;  3D79 A;  1I0V A;  6STD A;  1LVN A;  5BU4 A;  3BU4 A;  3IJE B;  3X42 A;  1BU4 A;  3CCQ 3;  2D42 A;  3HII A;  3I56 3;  1FGQ A;  1MWU A;  2BT3 A;  3GZR A;  3KSP A;  1MGW A;  1CYU A;  4G1M B;  1BNF A;  1RHL A;  1QAF A;  2BMO B;  3HI7 A;  3BIR A;  3NX0 A;  1UI7 A;  1N5P A;  3CPO A;  4RNT A;  3CCV 3;  2P05 A;  1BAN A;  2Q07 A;  1LXE A;  3DZL A;  3K0Z A;  3T0U A;  3OWU A;  1YNV X;  3ZG5 A;  1RTU A;  1RRL A;  3KE7 A;  3LT8 A;  2H0G A;  2QA4 3;  4Q1T A;  2J8X B;  2H0I A;  1VQ4 3;  1FGR A;  5BXQ A;  1MWR A;  1O7G B;  1YJ9 3;  1YJW 3;  2JDI H;  1NU3 A;  1KD1 4;  4HZ9 B;  1JB5 A;  2PZV A;  2HML B;  1RKY A;  3UB1 A;  2YFI B;  4J5K A;  1X1W A;  1JNQ A;  4EW5 A;  1JBT A;  1TIJ A;  1E3V A;  1SII A;  3EX9 A;  1B2M A;  2IUJ A;  2CH9 A;  4N6T A;  3WA2 X;  1NDO B;  1VQN 3;  1FW7 A;  5IW9 A;  5LC7 A;  4KT3 B;  1NWW A;  1B21 A;  1QJG A;  3HIG A;  4N6O B;  1Q7Y 4;  2LYX A;  3DH2 A;  4HM4 B;  1CQS A;  1W01 A;  3T8U A;  7GSP A;  1BNI A;  1RGL A;  1EA2 A;  1FUT A;  3M8C A;  1K73 4;  2L1S A;  1IU7 A;  1LOW A;  1BNG A;  1WTH A;  3D5G A;  4CDL A;  4CI1 B;  1BRN L;  1B2Z A;  4QWT A;  1TUH A;  4HM0 B;  3WMD A;  1IV7 A;  3GZY B;  3NBB A;  4EV2 A;  1GYB A;  2CHC A;  4LZI A;  3X3Y A;  4XDW A;  2GEX A;  4X2O A;  1GOY A;  1KQS 2;  4STD A;  3RGA A;  1DET A;  1BRK A;  2CX0 A;  1RCK A;  1UUV B;  3BNB A;  3MYT A;  1TJD A;  3S27 A;  1GY7 A;  1FUW A;  4R1K A;  1RN7 A;  1NJI 4;  1KWI A;  1OGZ A;  4O3V A;  3HJW A;  2CFW A;  1US1 A;  1STF I;  1EUI C;  2B24 B;  1B2U A;  1HZ1 A;  3JUM A;  4HOH A;  3B7C A;  1BUJ A;  1JZO A;  2K54 A;  8RNT A;  4AKZ A;  2AS0 A;  4N6V 0;  1VQK 3;  5IER A;  3F40 A;  3N8B A;  1ZGX A;  2XGL A;  4ILF A;  1ROV A;  2E5O A;  3DGN A;  1SQW A;  1UCK A;  2XSO B;  3OXA A;  1DVD A;  5ELU A;  2UUG C;  5DRE A;  3IUW A;  2W04 A;  1M90 4;  3BB9 A;  3NM2 A;  3NXJ A;  4N6U A;  4X2H A;  1E3R A;  5AIG A;  1ZE1 A;  2CG0 A;  3GAX A;  2FXT A;  2HMO B;  2BHM A;  2F56 A;  2XFT A;  3AGO A;  1T2H A;  4LEH A;  3GWR A;  2OTL 3;  2FNQ A;  1IYY A;  1GD3 A;  2W56 B;  1BRJ A;  3BLZ A;  4FCJ A;  4N6L A;  1ASK A;  4CI2 B;  1BRG A;  1B2X A;  2XF3 A;  4RNY A;  1YIT 3;  4HM7 B;  1IVU A;  3M65 A;  1FYS A;  2AUS A;  1HU9 A;  3Q2P A;  4KZ1 A;  3G71 3;  2KF5 A;  1AV4 A;  3EB8 A;  1YGE A;  4MMY B;  1JKG B;  2W6J H;  3AGN A;  4H61 A;  1VQ7 3;  2PNC A;  4HM2 B;  1RNT A;  3ZV0 C;  3CPW 2;  5RNT A;  2FRX A;  1DMQ A;  2MF7 A;  5CLK A;  4HAA A;  1IVV A;  3SOY A;  1GSP A;  1L5G B;  4FMB A;  3A76 A;  2K0M A;  4L8O A;  3AHS A;  5JPP A;  1KSI A;  3ER7 A;  1A2P A;  3Q90 A;  5KP1 A;  1Z1S A;  1N9J A;  2R41 A;  4XBY A;  5IG4 A;  2P09 A;  2W2C A;  3VSE A;  2GEY A;  1Q40 A;  1W2Z A;  3RDE A;  3SVA A;  1HKX A;  2CWU A;  1IV9 A;  3K9M C;  1HYF A;  3Q3F A;  4FCM A;  5EQL A;  3UL6 A;  1TU5 A;  1BNS A;  2WOH A;  4WWU C;  3UL5 A;  2H0H A;  1C7H A;  3DGL A;  3RGR A;  1GMR A;  2BNG A;  2OWP A;  3LWR A;  4N6N B;  3NM7 A;  1OHS A;  1RGA A;  1G96 A;  1O7M B;  4EXR A;  3V98 A;  1OHP A;  1NB5 I;  5TGN A;  3KZT A;  5AEW B;  4L8P A;  2OQE A;  3B4O A;  3JUN A;  1BOX A;  3SX1 A;  1VQP 3;  3X3Z A;  6GSP A;  3WA3 A;  1RN1 A;  2Z6B A;  2W9P A;  1TE7 A;  1O7N B;  2CWW A;  1Q42 A;  1RGG A;  3HX8 A;  5KP4 A;  2Z76 A;  3FKA A;  3N9H A;  3CCS 3;  5BVB A;  2WGO A;  2UX0 A;  3CCL 3;  1BRH A;  3WR2 A;  3DGM A;  2XH9 A;  4J5G A;  1OF5 B;  3ROB A;  3DMC A;  3O8Y A;  8CHO A;  3NV0 A;  3CCU 3;  4R4K A;  3ZG0 A;  1OAC A;  2HMN B;  1Q9E A;  1EQK A;  2EY4 A;  1DMM A;  2GBX B;  1VQO 3;  3A5E A;  4H3U A;  3CC4 3;  4HBR A;  3LOY A;  3F9S A;  2YFL B;  3LT9 A;  4N6M A;  2CW9 A;  1E97 A;  1WNH A;  4FMA A;  3Q1C A;  1ZBO A;  1I70 A;  1W7C A;  5AYR B;  1ZO2 A;  3AMO B;  4OVM A;  3ZFZ A;  3WOD G;  2KKU A;  1YHQ 3;  3NBJ A;  2XR8 B;  3FLJ A;  2CG1 A;  3CCM 3;  3HK4 A;  1SGV A;  2ML6 A;  1WMN A;  4IPB A;  2ZDJ A;  2KRT A;  3LWQ A;  1OHO A;  4EC6 A;  5LC6 A;  3D5I A;  1V58 A;  3BND A;  4MJD A;  5AI1 A;  5G1K A;  3CD6 3;  4FR9 A;  1Q7H A;  2CWT A;  1UGI A;  1TP6 A;  3IMA B;  1I3F A;  1RDS A;  3L0R A;  2AAD A;  4O02 B;  2WOF A;  1TRQ A;  4XDV A;  3LDF A;  2B1X B;  1MWT A;  4EBG A;  1A2V A;  3AHW A;  3WHO A;  1OGX A;  1N9E A;  1OPY A;  1UUW B;  3GSP A;  3M4X A;  4FMC A;  3EC9 A;  2C4B A;  2B78 A;  1B20 A;  5IG0 A;  4DMG A;  3OWS A;  1BSB A;  1I3I A;  3V99 A;  3B4P A;  2Z0T A;  4GB5 A;  4K61 A;  4NHF A;  4OUQ A;  3EN1 B;  1MOL A;  1GMQ A;  1UCI A;  1UOY A;  1RJO A;  3OV4 A;  3EN8 A;  5BIR A;  1ZS7 A;  1PFP A;  1IVX A;  1RGC A;  2HVY A;  1U5O A;  4KVH A;  2KF4 A;  4U13 A;  4BL2 A;  2AAE A;  2LQV A;  2Z77 A;  3X41 A;  1UUG B;  2IYJ A;  1GOV A;  3E99 A;  3QK9 A;  4HM8 B;  4KFE A;  1Q86 4;  1SPU A;  1ISK A;  1YGW A;  3PS8 A;  2GU1 A;  3AMO A;  1WXX A;  5FW5 A;  3X40 A;  1S5A A;  3LTA A;  1ULJ B;  3F7S A;  3JUQ A;  3OX9 A;  2ANE A;  1BSD A;  4LSO A;  1GY5 A;  2K3D A;  1AVK A;  3DXO A;  5KP3 A;  3S5C A;  1RN4 A;  2HOH A;  2P0M A;  1QMA A;  2F98 A;  3V92 A;  2HMJ B;  1V57 A;  3PGB A;  3GRD A;  1SIH A;  1WMP A;  1PYL A;  4KFF A;  4HKV B;  3G16 A;  4WYK B;  2E2U A;  2SBL A;  3F7X A;  5GSP A;  2Z7A A;  5IG5 A;  5IG3 A;  5A0O B;  1BGS A;  1UGH I;  1J2B A;  1W6G A;  2W9Q A;  3VF1 A;  2I9W A;  5D83 A;  1QAL A;  1AQZ A;  4DKI A;  3EF8 A;  1JN5 A;  5CXO A;  1FZU A;  1B3S A;  2INX A;  1LOY A;  2O9U X;  2OQE C;  3FF0 A;  2QIY A;  1WK2 A;  3T8N A;  3NQY A;  4I4K A;  3D4A A;  4XM4 A;  2IA7 A;  1ULI B;  2AB4 A;  1N8Q A;  2QGU A;  5AIF A;  3CC7 3;  2KF3 A;  1R3F A;  2QEX 3;  3H3H A;  2WO0 A;  3LTC A;  1A67 A;  2F86 B;  4K1U A;  1R4Y A;  2RSX A;  1LNI A;  4HZB B;  3HOH A;  1QVG 2;  4J8T A;  3S67 A;  3MG3 A;  2CX1 A;  1KC8 4;  1VQ9 3;  2APO A;  3PCR A;  3UNL A;  2XGN A;  4K90 B;  3G0K A;  3X3X A;  5HGR A;  1O7W B;  1N5H A;  3F8X A;  1RNB A;  2V1L A;  2W03 A;  4HYZ A;  1ROA A;  1K28 A;  1RGK A;  3LWV A;  4IT7 A;  3VGN A;  3CMA 3;  1VQ6 3;  1C54 A;  1DYU A;  2E2T A;  2YFJ B;  1S72 3;  1DMN A;  4BTY A;  4WYK A;  1AY7 A;  2HMK B;  2RGQ A;  1IDP A;  3KSE D;  4HM1 B;  3C0K A;  3F8H A;  4MEI A;  5DRV A;  1Y4K A;  3D9R A;  4BTW A;  7STD A;  3IPT A;  5G1L A;  1ZE2 A;  2A15 A;  2MC8 A;  1EEJ A;  1WMO A;  1RLS A;  1JKG A;  3PCS A;  5IEP A;  2BO9 B;  2R4I A;  1STD A;  4IIA A;  4JF8 A;  1CYV A;  3MPH A;  5AYS C;  1G02 A;  1SAR A;  1GMP A;  1YVS A;  1BNJ A;  1M9G A;  3LH4 A;  4NPB A;  5STD A;  2CWV A;  3VSY A;  4WFO A;  1R3E A;  1GS3 A;  3FZW A;  2W0Q A;  3UJM A;  3H51 A;  3KFQ C;  2GU3 A;  1O7P B;  3GZX B;  1YVB I;  2BU4 A;  2XEP A;  4ORL A;  1K8A 4;  3OWY A;  3FG3 A;  1K9M 4;  4J9A A;  3EJV A;  1BSA A;  1I0X A;  4BL3 A;  3KII A;  3MG1 A;  3MKI A;  4HM5 B;  2F5M A;  1F8N A;  4N3V A;  3LTB A;  3ECF A;  5AIH A;  2DP9 A;  1K41 A;  3U1W A;  4LMI A;  2ZHX B;  3G8Z A;  1JRQ A;  4R80 A;  4EV5 A;  1VQQ A;  3LML A;  3SOA A;  3CNX A;  1A2K A;  3STD A;  5G2G A;  5IF6 A;  4GL6 A;  3HAX A;  3SXX A;  1RGE A;  2CFG A;  1YIJ 3;  1JV2 B;  2P0X A;  3EHC A;  2FGT A;  1S04 A;  1A90 A;  3S29 A;  1JBR A;  2BMQ B;  3TDG A;  1D6Y A;  1UI8 A;  2BMR B;  2KCD A;  3FH1 A;  2GBW B;  3HJY A;  2CK3 H;  3CNM A;  1W02 A;  3OW2 2;  2RFR A;  1EG9 B;  2CFK A;  1PU4 A;  1QAK A;  1X1U A;  4AKY A;  2IY2 A;  1OCV A;  2RFK A;  2OOV C;  5D81 A;  2F4Y A;  5HOH A;  1OH0 A;  4RBN A;  1AR0 A;  1ZL3 A;  4ZM8 A;  1DE3 A;  1IT7 A;  2CIU A;  4I5Q A;  1BSE A;  1RMS A;  2ML5 A;  2CC3 A;  1VQ8 3;  3S28 A;  1X1Y A;  1IVW A;  1CH0 A;  1T3B A;  1V74 A;  2RNT A;  3D3L A;  5CF2 A;  1OF5 A;  4JRF A;  2D1W A;  9RNT A;  4HM6 B;  3SED A;  1W6Y A;  1G0T A;  5ELJ A;  1CEW I;  3CME 3;  1BIR A;  1PY3 A;  1UDI I;  3SLU A;  3JVC A;  2W56 A;  1TTO A;  2XSH B;  3HZP A;  4O8S A;  2F5W A;  1JN5 B;  2SAR A;  3LJC A;  4HM3 B;  1JZD A;  5CK6 A;  3KCH A;  1LOX A;  3ALA A;  3CU3 A;  3SYU A;  4K1V A;  1T5Y A;  1BRS A;  2IMJ A;  4CJN A;  1BNE A;  3G4S 3;  1W5Z A;  2KXG A;  2UGI A;  3CCE 3;  2WGQ A;  3PYJ A;  1I2E A;  1JB2 A;  2RCD A;  3LWP A;  2J5T A;  4BU4 A;  3M6W A;  5IEO A;  5FGO A;  1X1X A;  1Q81 4;  4FCZ A;  1RRH A;  1FGT A;  3QRD A;  5AII A;  1I8V A;  2C10 A;  4PEJ A;  1W4N A;  3K7C A;  3NV0 B;  4CPK A;  4HVN A;  3WOF B;  2F99 A;  2XRX B;  3KKG A;  2JQ5 A;  4Q53 A;  4RNZ A;  3FSD A;  4CI3 B;  1M1X B;  5JPU A;  1DVC A;  3MG2 A;  3N54 B;  1VQM 3;  3EE1 A;  2J5V A;  2GXF A; 
#chains in the Genus database with same CATH homology
 1ZS7 A;  1WXW A;  2P38 A;  3UAI A;  1J2B A;  1SGV A;  3D79 A;  2CWW A;  2CX0 A;  1T5Y A;  3VSE A;  1WXX A;  1Q7H A;  3C0K A;  2J5T A;  1IT8 A;  1ZL3 A;  1ZE2 A;  1IT7 A;  2Q07 A;  2AS0 A;  3LDF A;  2AB4 A;  1R3F A;  1K8W A;  2B78 A;  1SQW A;  4DMG A;  4Q1T A;  1R3E A;  1IQ8 A;  2CX1 A;  2J5V A;  1ZE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...