2CX1A

Crystal structure of a pua domain (ape0525) from the aeropyrum pernix k1 (tartrate complex)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein APE0525
publication title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
total genus 48
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2cx1A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 2cx1A01
2AB4A 1IT8A 2Q07A 3VSEA 1WXWA 1T5YA 4DMGA 2P38A 1R3EA 1Q7HA 2AS0A 1WXXA 4Q1TA 2CX1A 3UAIA 2J5TA 1ZL3A 1IQ8A 1IT7A 3LDFA 2B78A 1R3FA 1K8WA 1SQWA 1SGVA 3D79A 2J5VA 1ZS7A 2CWWA 1ZE2A 3C0KA 1J2BA 2CX0A 1ZE1A
chains in the Genus database with same CATH superfamily
2AB4A 1RN1A 5JPPA 3KFQC 2OOVC 3F7SA 4X2HA 4BU4A 3H51A 5HOHA 3I563 4K61A 4FMBA 2H0IA 1Q40A 1SIHA 4I4KA 5AYSC 3CNMA 5BIRA 3ZG5A 1Q7HA 1RCKA 1QJGA 4Q1TA 3AMOA 4HM8B 2RSXA 3U28A 3MQKA 4HBRA 5STDA 1GY7A 5IENA 1BRNL 3IUWA 1D6UA 1GY5A 1TFOA 2D1WA 2M7OA 1O7NB 1K8WA 4N6UA 2FNQA 1IV7A 3WA2X 1RHLA 3NQYA 3G6E3 2XSHB 2W04A 5AEWB 5G1LA 2YX9A 2IYJA 1AY7A 3HJWA 1RGKA 1S5AA 3VSYA 3NUVA 3MWZA 1FGOA 2CK3H 4K90B 2EY4A 1BVIA 1RLSA 1BUQA 2GBWB 1BRJA 1HYFA 2WOHA 5IG4A 1Q7Y4 4LMIA 3DGYA 2CFKA 3SEDA 1GMQA 1W6GA 3LYGA 3PYJA 5RNTA 1ZBOA 1I3IA 3RGAA 4R80A 3S67A 2GEXA 4AEQA 1FUTA 1C7HA 2IUKA 2OCTA 2P05A 2RNTA 2Z7AA 1TE7A 2CW9A 3FSDA 1HZ1A 2RBIA 1TUHA 2WGOA 3AMOB 3EQQB 4FCJA 5M1AA 2ZDJA 1VQ43 1FUSA 1Q42A 1NNVA 1W5ZA 2STDA 3DUKA 3JUQA 3WA3A 3EE1A 1CYUA 3MYTA 2OQEC 1VZZA 2GU3A 1YVSA 2J8XB 2UX0A 1RKYA 1RRHA 3L0RA 1I2GA 3V98A 1DMMA 2W56B 1IVUA 1BNJA 1FGQA 1BSEA 2FGTA 4Q53A 3EB8A 1PYLA 1WK2A 1SJWA 1WQLB 2BO9B 4HYZA 4R9LA 3WDGB 3FG1A 2IUJA 1R3EA 9RNTA 2Z6BA 4GB5A 4HKVB 1G96A 4DKIA 3HZPA 1VQL3 2A15A 3G8ZA 4EW5A 3DH2A 1VQ53 3IJEB 1IQ8A 2B24B 4N6OB 1VQN3 2HVYA 1R3FA 7GSPA 3JUNA 1I2FA 2F98A 3F8XA 2AUSA 2W6JH 1W4NA 1OPYA 1SPUA 3EN1B 2RFKA 1WMOA 3PS8A 3D3LA 1E97A 1GOVA 4H61A 1ULJB 1WTHA 3S27A 3ZV0C 6STDA 1RGLA 1VQM3 1RRLA 2FRXA 1YHQ3 1TTOA 4LGQA 3D9RA 5CF1A 1JBSA 1B3SA 2DP9A 2YFLB 2HMNB 1R4CA 3NX0A 3MSOA 3LTCA 2Z0TA 5AIGA 1I70A 1UGIA 3LWRA 4BIRA 2CKFB 3Q2PA 1F8NA 2B1XB 4LZIA 1O7WB 1WXXA 1N9EA 3NV0A 1YNVX 2E2TA 3NM2A 1DVCA 2J5TA 3LT9A 4N6LA 5IEOA 4HAAA 3X40A 4AKZA 1UUVB 3I553 5JBSA 3LDFA 1UCKA 3B4OA 3X3YA 3CME3 1O7MB 3K7CA 1DMQA 3NHXA 1BRIA 1RCLA 1OF5A 1E3VA 2AADA 2CFGA 3G4S3 1JN5A 3PCRA 4GSPA 1N8QA 2H0HA 3FLJA 3CCE3 2GSPA 1QAKA 2IY2A 1BU4A 1RGGA 2BMQB 4N6NB 1ROVA 3EC9A 1SIIA 1JRQA 4EV2A 1XNEA 5IG3A 1JZDA 3E99A 3OX9A 3LOYA 4N3VA 4RZMA 1LOVA 2W0QA 3CCV3 5M19A 1N8R4 1DE3A 3DGMA 1SARA 3CC43 1RN7A 2O3OA 3HK4A 1ZX2A 5M18A 1JV2B 1JZOA 1GY6A 5D81A 4BL2A 1JB2A 1B2SA 2W9QA 4WYKA 4HM3B 4N6MA 3GRDA 1LNIA 4CI1B 1VQ73 3U97A 3UL5A 1AQZA 2CFDA 3CNXA 1GMRA 5G2GA 5BXQA 4R4KA 4ZM8A 4WWUC 1RGHA 1NB3I 1UOYA 2J5VA 2LQVA 5AEUB 3IPTA 1FGRA 1YIJ3 4O3VA 3D5IA 1V58A 3JVCA 3PCSA 3C0KA 4R9KA 5AIIA 2MF7A 2PNCA 1M1XB 4MMXB 4EC6A 3HIIA 3CU3A 3RGRA 1TU5A 4J9AA 1U8CB 3LMLA 3X42A 2OOVA 1KD14 1QVG2 1B27A 4XDVA 3UL6A 2JQ5A 5KP4A 3HAXA 1BSDA 2XR8B 4GL6A 4O2HA 4I5QA 3NXJA 2XRXB 5TGNA 1BNSA 1OH0A 1CQSA 2HMMB 4LEHA 3LWPA 3KZTA 1BRGA 3B8LA 2B78A 3PZWA 5KP1A 1FA3A 3M6VA 2GU1A 2D42A 3NBJA 1RDSA 2KF5A 2CWVA 3VF1A 5EQLA 3WODG 1ZS7A 4PEJA 1B21A 2BMRB 1LOYA 1FGMA 4J5KA 4AKYA 1DYUA 2JDIH 5IF6A 1YGWA 3V99A 2ML5A 3M4XA 1CEWI 2C4BA 1ROAA 3AHWA 1BGSA 3FF0A 3WOEB 3LH4A 5AYRB 3WR2A 1LQGC 5CK6A 2WGQA 4CI3B 3BB9A 1W2ZA 4STDA 1AV4A 1Q40B 1W00A 4FR9A 2GXFA 3AGNA 4MMYB 1RTUA 6GSPA 1YI23 3LT8A 3SX1A 3OWYA 1MOLA 1RMSA 2HMJB 1UI8A 4RNYA 1RJOA 2OTJ3 3DY5A 4XBTA 3GSPA 3HI7A 1W2B2 3KSED 1WMPA 3U1WA 1A67A 1RSNA 3CMA3 3J7Yd 2OQEA 5DRVA 1ISKA 1ZE2A 1DVDA 1FW7A 3AGOA 2AAEA 3T8NA 2E2VA 3CCM3 4CPKA 1FYSA 1RN4A 3G0KA 1STDA 1M9GA 2KF3A 2P0XA 4FMAA 3B4PA 2XSOB 1UUGB 1I0VA 2HMOB 3CC73 2F4YA 4ILFA 1JKGA 1ASKA 3BNDA 3F14A 2XGNA 3GZXB 1E3RA 3IMAB 4RNTA 1BRSA 1LQMB 2KF6A 2UGIA 3EN8A 5DREA 3F9SA 1UI7A 3A76A 4JRFA 4O8SA 1QVF2 3BLZA 1EQKA 3SOAA 3D79A 1ZO2A 2IMJA 3F8HA 4IIAA 5CLKA 3G16A 2E5OA 3FG3A 1B2UA 3SLUA 1OHSA 5A0OB 8RNTA 1BUJA 1WMNA 5BU4A 1ZE1A 1RGAA 2KRTA 1BSCA 1YVBI 3K0ZA 1FGTA 3SYUA 3D4AA 3X3XA 3CCU3 2RGQA 1RGFA 2CFLA 4HM5B 4WHAA 1FUWA 2INXA 4O02B 3X3ZA 4IT7A 3KE7A 3KN4A 3UNLA 1KC84 1NWWA 3HIGA 4K1VA 1IDPA 1GD4A 4MMZB 1FZUA 2Z77A 1OCVA 4K1UA 1BAOA 4OK0A 3K5TA 1BNEA 3RNTA 5IEPA 5LC7A 4HOHA 1D6YA 4GHOA 4CCVA 1G0TA 1GMPA 3S28A 2XGLA 3ER7A 3MHEA 1IVXA 4QWTA 3RDEA 5EVHA 1W6CA 5JPUA 2HMKB 5AIFA 2F5WA 1TIJA 3K63A 4NPBA 1MWSA 1RNTA 4TX4A 4XB5A 4HM4B 7RNTA 1AVLA 1IT8A 3FCSB 3A5EA 1VQK3 1N5PA 3DGLA 1BNFA 1JB5A 1VQ93 4N6TA 1MGRA 1JBTA 1CYVA 4HM2B 3KIIA 4J5GA 3SOYA 2CH9A 4FCZA 3EHCA 4HJLB 3UAIA 2WO0A 1IV9A 2OWPA 1BNRA 1CH0A 2V1LA 3GZRA 3NV0B 1UGHI 1LRAA 2K3DA 2P09A 1I0XA 1YJW3 1BIRA 1OUNA 2BNGA 4HM6B 3S29A 4BTYA 1K9M4 1IQYA 1GOYA 3BNCA 3DZLA 1M1K4 2BIRA 2CWWA 1GYBA 4L7KA 1MGWA 1J2BA 4IPBA 1EG9B 1OF5B 1QMAA 2QIYA 3LZAA 2Y73A 1JN5B 4G1MB 4XBXA 1PY3A 2LYXA 4CI2B 5D83A 3T8UA 3FF2A 5CF2A 1W02A 1YGEA 1PU4A 3CCL3 4FMDA 1T5YA 2F86B 2XFSA 2ZA4A 1TRPA 3BNBA 1TP6A 2CG0A 1Q814 1BOXA 1W01A 2XF3A 1STFI 3LXUX 5FW5A 3CPW2 2APOA 1WNHA 2CHCA 1VQ63 3S5CA 3HX8A 2K54A 2HOHA 3ZFZA 1DETA 1VQ83 1Z1SA 3KCHA 5CXOA 3QRDA 5IERA 1NB5I 1SQWA 2CIUA 3CD63 3X41A 4WYKB 3WOFB 4MJDA 1A90A 1O7GB 1ZGXA 1N9JA 1B2ZA 1OGXA 3WHOA 1JJ22 2IA7A 1X1UA 2R41A 3EBYA 3VGNA 1U5OA 1X1YA 3QK9A 1IQXA 1K41A 3ZG0A 4CDLA 4OUQA 4HM1B 3M6UA 1IVWA 1G02A 1RGCA 3KKGA 2I9WA 2L4VA 4R1KA 2SBLA 1WXWA 4FCMA 2GEYA 3MG3A 1EKMA 1T3BA 2C11A 2KKUA 3BNEA 2HMLB 2WOFA 3LJCA 1T2IA 1NDOB 3ECFA 4NHFA 1EUIC 1Q824 3WMDA 2RFRA 3F40A 1OGZA 1MWTA 3M6XA 1NO3A 3ROBA 3BIRA 2BMOB 1KWIA 3FGYA 3JUPA 1Q864 4L8PA 1IVVA 2W56A 1A2KA 3GWRA 3NBBA 5EEOA 1JB4A 2QA43 1X1WA 4KFEA 2QGUA 1K8A4 1IYYA 5KP3A 1K28A 3CCJ3 1IK3A 3GZYB 1RNBA 2UUGC 4DMGA 4EXRA 5IW9A 3CCR3 2P38A 1ULIB 2PZVA 3OV4A 2H0GA 5IG0A 4BTWA 5I97A 3N9HA 1DMNA 4HZ9B 3CCS3 1TFKA 1LXEA 2CWUA 3PGBA 3PXMA 3MG2A 1BNGA 4KFFA 2K0MA 3LTBA 3G713 1M904 3M6WA 1LNHA 1Q9EA 2Z76A 4EBGA 2OTL3 1YJN3 3SVAA 2QEX3 2FXTA 2GBXB 1B2MA 1GD3A 3DGNA 1W6YA 2ZHXB 3ALAA 1RGEA 3M8CA 1UUWB 3B7CA 3GAXA 2W03A 2BU4A 2O9UX 3LTDA 2KF4A 3DM8A 3MPHA 1VQO3 2CX0A 3NQZA 3OWUA 4HM0B 1OACA 1BNIA 1MNLA 1LVNA 5IG5A 2Q07A 2XEPA 3VSEA 3JUOA 1BRKA 2E2UA 4EYCA 2BT3A 2R4IA 6RNTA 4BL3A 4XM4A 4MEIA 3EF8A 4KT3B 3URPA 1OHOA 2L1SA 3M65A 2AS0A 1B2XA 3HOHA 4KZ1A 5BVBA 7STDA 3BU4A 3FH1A 1JBRA 2XH9A 1ZL3A 3O8YA 4RNZA 5AIHA 2RCDA 1O7HB 2CC3A 2W2CA 1JKGB 3DGOA 1N5HA 3LWQA 1UCLA 3SXXA 4HVNA 4HM7B 1LOWA 4J8TA 2F5MA 2KXGA 3DMCA 3STDA 1R4YA 2MC8A 1I2EA 1HU9A 3AHSA 1UCIA 2CG1A 1T2HA 2YFJB 3MKIA 1QAFA 1EA2A 1KSIA 1V57A 2W9PA 1TRQA 3N8BA 2CWTA 1VQQA 3EBTA 4NREA 1QALA 1D6ZA 4TZ4C 3UB1A 1BSBA 3GZBA 8CHOA 4WFOA 1X1XA 4OVMA 1US1A 2P0MA 5FGOA 3MG1A 1K734 2ZL8A 3CC23 2XFTA 4XDWA 2BHMA 1S723 2CX1A 3LWVA 1OHPA 1NU3A 1YIT3 4U13A 2F56A 3I0YA 2F99A 1B20A 3JUMA 3OW22 1S04A 5G1KA 2ML6A 2ANEA 1SGVA 4ORLA 3EX9A 3T0UA 2KAAA 3Q90A 1O7PB 3H3HA 4RBNA 3K9MC 3NM7A 1AVKA 1EEJA 1TJDA 1Y4KA 4H3UA 5HGRA 2KCDA 2CFWA 3LWOA 5D82A 5LC6A 2C10A 1YJ93 1IU7A 1LOXA 3OXAA 4X2OA 1W7CA 4BTXA 4KVHA 3CPOA 1BRHA 1GOUA 1BSAA 1UCJA 4CJNA 5ELUA 1PFPA 1L5GB 1BANA 1GSPA 3TDGA 1VQP3 5ELJA 1MWRA 4KFDA 1UW1A 3NBRA 3N54B 4LSOA 4EV5A 1UDII 5GSPA 1MWUA 2SARA 2YFIB 5AI1A 1IT7A 1GS3A 3V92A 1KQS2 4XBYA 1V74A 3Q1CA 3KSPA 1I3FA 3HJYA 1AR0A 4FMCA 3F7XA 1NJI4 1HKXA 1C54A 4N6V0 1I8VA 2Y74A 1JNQA 3DXOA 3CXC2 3UJMA 1A2VA 3FZWA 3Q3FA 4WP5A 3LTAA 3FKAA 4L8OA 3CCQ3 4JF8A 1A2PA 3D5GA 3OWSA 4LYLB 3FG4A 4HZBB 3EJVA
chains in the Genus database with same CATH topology
2AB4A 1IT8A 2Q07A 3VSEA 1WXWA 1T5YA 4DMGA 2P38A 1R3EA 1Q7HA 2AS0A 1WXXA 4Q1TA 2CX1A 3UAIA 2J5TA 1ZL3A 1IQ8A 1IT7A 3LDFA 2B78A 1R3FA 1K8WA 1SQWA 1SGVA 3D79A 2J5VA 1ZS7A 2CWWA 1ZE2A 3C0KA 1J2BA 2CX0A 1ZE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AB4 A;  1IT8 A;  2Q07 A;  3VSE A;  1WXW A;  1T5Y A;  4DMG A;  2P38 A;  1R3E A;  1Q7H A;  2AS0 A;  1WXX A;  4Q1T A;  2CX1 A;  3UAI A;  2J5T A;  1ZL3 A;  1IQ8 A;  1IT7 A;  3LDF A;  2B78 A;  1R3F A;  1K8W A;  1SQW A;  1SGV A;  3D79 A;  2J5V A;  1ZS7 A;  2CWW A;  1ZE2 A;  3C0K A;  1J2B A;  2CX0 A;  1ZE1 A; 
#chains in the Genus database with same CATH topology
 2AB4 A;  1RN1 A;  5JPP A;  3KFQ C;  2OOV C;  3F7S A;  4X2H A;  4BU4 A;  3H51 A;  5HOH A;  3I56 3;  4K61 A;  4FMB A;  2H0I A;  1Q40 A;  1SIH A;  4I4K A;  5AYS C;  3CNM A;  5BIR A;  3ZG5 A;  1Q7H A;  1RCK A;  1QJG A;  4Q1T A;  3AMO A;  4HM8 B;  2RSX A;  3U28 A;  3MQK A;  4HBR A;  5STD A;  1GY7 A;  5IEN A;  1BRN L;  3IUW A;  1D6U A;  1GY5 A;  1TFO A;  2D1W A;  2M7O A;  1O7N B;  1K8W A;  4N6U A;  2FNQ A;  1IV7 A;  3WA2 X;  1RHL A;  3NQY A;  3G6E 3;  2XSH B;  2W04 A;  5AEW B;  5G1L A;  2YX9 A;  2IYJ A;  1AY7 A;  3HJW A;  1RGK A;  1S5A A;  3VSY A;  3NUV A;  3MWZ A;  1FGO A;  2CK3 H;  4K90 B;  2EY4 A;  1BVI A;  1RLS A;  1BUQ A;  2GBW B;  1BRJ A;  1HYF A;  2WOH A;  5IG4 A;  1Q7Y 4;  4LMI A;  3DGY A;  2CFK A;  3SED A;  1GMQ A;  1W6G A;  3LYG A;  3PYJ A;  5RNT A;  1ZBO A;  1I3I A;  3RGA A;  4R80 A;  3S67 A;  2GEX A;  4AEQ A;  1FUT A;  1C7H A;  2IUK A;  2OCT A;  2P05 A;  2RNT A;  2Z7A A;  1TE7 A;  2CW9 A;  3FSD A;  1HZ1 A;  2RBI A;  1TUH A;  2WGO A;  3AMO B;  3EQQ B;  4FCJ A;  5M1A A;  2ZDJ A;  1VQ4 3;  1FUS A;  1Q42 A;  1NNV A;  1W5Z A;  2STD A;  3DUK A;  3JUQ A;  3WA3 A;  3EE1 A;  1CYU A;  3MYT A;  2OQE C;  1VZZ A;  2GU3 A;  1YVS A;  2J8X B;  2UX0 A;  1RKY A;  1RRH A;  3L0R A;  1I2G A;  3V98 A;  1DMM A;  2W56 B;  1IVU A;  1BNJ A;  1FGQ A;  1BSE A;  2FGT A;  4Q53 A;  3EB8 A;  1PYL A;  1WK2 A;  1SJW A;  1WQL B;  2BO9 B;  4HYZ A;  4R9L A;  3WDG B;  3FG1 A;  2IUJ A;  1R3E A;  9RNT A;  2Z6B A;  4GB5 A;  4HKV B;  1G96 A;  4DKI A;  3HZP A;  1VQL 3;  2A15 A;  3G8Z A;  4EW5 A;  3DH2 A;  1VQ5 3;  3IJE B;  1IQ8 A;  2B24 B;  4N6O B;  1VQN 3;  2HVY A;  1R3F A;  7GSP A;  3JUN A;  1I2F A;  2F98 A;  3F8X A;  2AUS A;  2W6J H;  1W4N A;  1OPY A;  1SPU A;  3EN1 B;  2RFK A;  1WMO A;  3PS8 A;  3D3L A;  1E97 A;  1GOV A;  4H61 A;  1ULJ B;  1WTH A;  3S27 A;  3ZV0 C;  6STD A;  1RGL A;  1VQM 3;  1RRL A;  2FRX A;  1YHQ 3;  1TTO A;  4LGQ A;  3D9R A;  5CF1 A;  1JBS A;  1B3S A;  2DP9 A;  2YFL B;  2HMN B;  1R4C A;  3NX0 A;  3MSO A;  3LTC A;  2Z0T A;  5AIG A;  1I70 A;  1UGI A;  3LWR A;  4BIR A;  2CKF B;  3Q2P A;  1F8N A;  2B1X B;  4LZI A;  1O7W B;  1WXX A;  1N9E A;  3NV0 A;  1YNV X;  2E2T A;  3NM2 A;  1DVC A;  2J5T A;  3LT9 A;  4N6L A;  5IEO A;  4HAA A;  3X40 A;  4AKZ A;  1UUV B;  3I55 3;  5JBS A;  3LDF A;  1UCK A;  3B4O A;  3X3Y A;  3CME 3;  1O7M B;  3K7C A;  1DMQ A;  3NHX A;  1BRI A;  1RCL A;  1OF5 A;  1E3V A;  2AAD A;  2CFG A;  3G4S 3;  1JN5 A;  3PCR A;  4GSP A;  1N8Q A;  2H0H A;  3FLJ A;  3CCE 3;  2GSP A;  1QAK A;  2IY2 A;  1BU4 A;  1RGG A;  2BMQ B;  4N6N B;  1ROV A;  3EC9 A;  1SII A;  1JRQ A;  4EV2 A;  1XNE A;  5IG3 A;  1JZD A;  3E99 A;  3OX9 A;  3LOY A;  4N3V A;  4RZM A;  1LOV A;  2W0Q A;  3CCV 3;  5M19 A;  1N8R 4;  1DE3 A;  3DGM A;  1SAR A;  3CC4 3;  1RN7 A;  2O3O A;  3HK4 A;  1ZX2 A;  5M18 A;  1JV2 B;  1JZO A;  1GY6 A;  5D81 A;  4BL2 A;  1JB2 A;  1B2S A;  2W9Q A;  4WYK A;  4HM3 B;  4N6M A;  3GRD A;  1LNI A;  4CI1 B;  1VQ7 3;  3U97 A;  3UL5 A;  1AQZ A;  2CFD A;  3CNX A;  1GMR A;  5G2G A;  5BXQ A;  4R4K A;  4ZM8 A;  4WWU C;  1RGH A;  1NB3 I;  1UOY A;  2J5V A;  2LQV A;  5AEU B;  3IPT A;  1FGR A;  1YIJ 3;  4O3V A;  3D5I A;  1V58 A;  3JVC A;  3PCS A;  3C0K A;  4R9K A;  5AII A;  2MF7 A;  2PNC A;  1M1X B;  4MMX B;  4EC6 A;  3HII A;  3CU3 A;  3RGR A;  1TU5 A;  4J9A A;  1U8C B;  3LML A;  3X42 A;  2OOV A;  1KD1 4;  1QVG 2;  1B27 A;  4XDV A;  3UL6 A;  2JQ5 A;  5KP4 A;  3HAX A;  1BSD A;  2XR8 B;  4GL6 A;  4O2H A;  4I5Q A;  3NXJ A;  2XRX B;  5TGN A;  1BNS A;  1OH0 A;  1CQS A;  2HMM B;  4LEH A;  3LWP A;  3KZT A;  1BRG A;  3B8L A;  2B78 A;  3PZW A;  5KP1 A;  1FA3 A;  3M6V A;  2GU1 A;  2D42 A;  3NBJ A;  1RDS A;  2KF5 A;  2CWV A;  3VF1 A;  5EQL A;  3WOD G;  1ZS7 A;  4PEJ A;  1B21 A;  2BMR B;  1LOY A;  1FGM A;  4J5K A;  4AKY A;  1DYU A;  2JDI H;  5IF6 A;  1YGW A;  3V99 A;  2ML5 A;  3M4X A;  1CEW I;  2C4B A;  1ROA A;  3AHW A;  1BGS A;  3FF0 A;  3WOE B;  3LH4 A;  5AYR B;  3WR2 A;  1LQG C;  5CK6 A;  2WGQ A;  4CI3 B;  3BB9 A;  1W2Z A;  4STD A;  1AV4 A;  1Q40 B;  1W00 A;  4FR9 A;  2GXF A;  3AGN A;  4MMY B;  1RTU A;  6GSP A;  1YI2 3;  3LT8 A;  3SX1 A;  3OWY A;  1MOL A;  1RMS A;  2HMJ B;  1UI8 A;  4RNY A;  1RJO A;  2OTJ 3;  3DY5 A;  4XBT A;  3GSP A;  3HI7 A;  1W2B 2;  3KSE D;  1WMP A;  3U1W A;  1A67 A;  1RSN A;  3CMA 3;  3J7Y d;  2OQE A;  5DRV A;  1ISK A;  1ZE2 A;  1DVD A;  1FW7 A;  3AGO A;  2AAE A;  3T8N A;  2E2V A;  3CCM 3;  4CPK A;  1FYS A;  1RN4 A;  3G0K A;  1STD A;  1M9G A;  2KF3 A;  2P0X A;  4FMA A;  3B4P A;  2XSO B;  1UUG B;  1I0V A;  2HMO B;  3CC7 3;  2F4Y A;  4ILF A;  1JKG A;  1ASK A;  3BND A;  3F14 A;  2XGN A;  3GZX B;  1E3R A;  3IMA B;  4RNT A;  1BRS A;  1LQM B;  2KF6 A;  2UGI A;  3EN8 A;  5DRE A;  3F9S A;  1UI7 A;  3A76 A;  4JRF A;  4O8S A;  1QVF 2;  3BLZ A;  1EQK A;  3SOA A;  3D79 A;  1ZO2 A;  2IMJ A;  3F8H A;  4IIA A;  5CLK A;  3G16 A;  2E5O A;  3FG3 A;  1B2U A;  3SLU A;  1OHS A;  5A0O B;  8RNT A;  1BUJ A;  1WMN A;  5BU4 A;  1ZE1 A;  1RGA A;  2KRT A;  1BSC A;  1YVB I;  3K0Z A;  1FGT A;  3SYU A;  3D4A A;  3X3X A;  3CCU 3;  2RGQ A;  1RGF A;  2CFL A;  4HM5 B;  4WHA A;  1FUW A;  2INX A;  4O02 B;  3X3Z A;  4IT7 A;  3KE7 A;  3KN4 A;  3UNL A;  1KC8 4;  1NWW A;  3HIG A;  4K1V A;  1IDP A;  1GD4 A;  4MMZ B;  1FZU A;  2Z77 A;  1OCV A;  4K1U A;  1BAO A;  4OK0 A;  3K5T A;  1BNE A;  3RNT A;  5IEP A;  5LC7 A;  4HOH A;  1D6Y A;  4GHO A;  4CCV A;  1G0T A;  1GMP A;  3S28 A;  2XGL A;  3ER7 A;  3MHE A;  1IVX A;  4QWT A;  3RDE A;  5EVH A;  1W6C A;  5JPU A;  2HMK B;  5AIF A;  2F5W A;  1TIJ A;  3K63 A;  4NPB A;  1MWS A;  1RNT A;  4TX4 A;  4XB5 A;  4HM4 B;  7RNT A;  1AVL A;  1IT8 A;  3FCS B;  3A5E A;  1VQK 3;  1N5P A;  3DGL A;  1BNF A;  1JB5 A;  1VQ9 3;  4N6T A;  1MGR A;  1JBT A;  1CYV A;  4HM2 B;  3KII A;  4J5G A;  3SOY A;  2CH9 A;  4FCZ A;  3EHC A;  4HJL B;  3UAI A;  2WO0 A;  1IV9 A;  2OWP A;  1BNR A;  1CH0 A;  2V1L A;  3GZR A;  3NV0 B;  1UGH I;  1LRA A;  2K3D A;  2P09 A;  1I0X A;  1YJW 3;  1BIR A;  1OUN A;  2BNG A;  4HM6 B;  3S29 A;  4BTY A;  1K9M 4;  1IQY A;  1GOY A;  3BNC A;  3DZL A;  1M1K 4;  2BIR A;  2CWW A;  1GYB A;  4L7K A;  1MGW A;  1J2B A;  4IPB A;  1EG9 B;  1OF5 B;  1QMA A;  2QIY A;  3LZA A;  2Y73 A;  1JN5 B;  4G1M B;  4XBX A;  1PY3 A;  2LYX A;  4CI2 B;  5D83 A;  3T8U A;  3FF2 A;  5CF2 A;  1W02 A;  1YGE A;  1PU4 A;  3CCL 3;  4FMD A;  1T5Y A;  2F86 B;  2XFS A;  2ZA4 A;  1TRP A;  3BNB A;  1TP6 A;  2CG0 A;  1Q81 4;  1BOX A;  1W01 A;  2XF3 A;  1STF I;  3LXU X;  5FW5 A;  3CPW 2;  2APO A;  1WNH A;  2CHC A;  1VQ6 3;  3S5C A;  3HX8 A;  2K54 A;  2HOH A;  3ZFZ A;  1DET A;  1VQ8 3;  1Z1S A;  3KCH A;  5CXO A;  3QRD A;  5IER A;  1NB5 I;  1SQW A;  2CIU A;  3CD6 3;  3X41 A;  4WYK B;  3WOF B;  4MJD A;  1A90 A;  1O7G B;  1ZGX A;  1N9J A;  1B2Z A;  1OGX A;  3WHO A;  1JJ2 2;  2IA7 A;  1X1U A;  2R41 A;  3EBY A;  3VGN A;  1U5O A;  1X1Y A;  3QK9 A;  1IQX A;  1K41 A;  3ZG0 A;  4CDL A;  4OUQ A;  4HM1 B;  3M6U A;  1IVW A;  1G02 A;  1RGC A;  3KKG A;  2I9W A;  2L4V A;  4R1K A;  2SBL A;  1WXW A;  4FCM A;  2GEY A;  3MG3 A;  1EKM A;  1T3B A;  2C11 A;  2KKU A;  3BNE A;  2HML B;  2WOF A;  3LJC A;  1T2I A;  1NDO B;  3ECF A;  4NHF A;  1EUI C;  1Q82 4;  3WMD A;  2RFR A;  3F40 A;  1OGZ A;  1MWT A;  3M6X A;  1NO3 A;  3ROB A;  3BIR A;  2BMO B;  1KWI A;  3FGY A;  3JUP A;  1Q86 4;  4L8P A;  1IVV A;  2W56 A;  1A2K A;  3GWR A;  3NBB A;  5EEO A;  1JB4 A;  2QA4 3;  1X1W A;  4KFE A;  2QGU A;  1K8A 4;  1IYY A;  5KP3 A;  1K28 A;  3CCJ 3;  1IK3 A;  3GZY B;  1RNB A;  2UUG C;  4DMG A;  4EXR A;  5IW9 A;  3CCR 3;  2P38 A;  1ULI B;  2PZV A;  3OV4 A;  2H0G A;  5IG0 A;  4BTW A;  5I97 A;  3N9H A;  1DMN A;  4HZ9 B;  3CCS 3;  1TFK A;  1LXE A;  2CWU A;  3PGB A;  3PXM A;  3MG2 A;  1BNG A;  4KFF A;  2K0M A;  3LTB A;  3G71 3;  1M90 4;  3M6W A;  1LNH A;  1Q9E A;  2Z76 A;  4EBG A;  2OTL 3;  1YJN 3;  3SVA A;  2QEX 3;  2FXT A;  2GBX B;  1B2M A;  1GD3 A;  3DGN A;  1W6Y A;  2ZHX B;  3ALA A;  1RGE A;  3M8C A;  1UUW B;  3B7C A;  3GAX A;  2W03 A;  2BU4 A;  2O9U X;  3LTD A;  2KF4 A;  3DM8 A;  3MPH A;  1VQO 3;  2CX0 A;  3NQZ A;  3OWU A;  4HM0 B;  1OAC A;  1BNI A;  1MNL A;  1LVN A;  5IG5 A;  2Q07 A;  2XEP A;  3VSE A;  3JUO A;  1BRK A;  2E2U A;  4EYC A;  2BT3 A;  2R4I A;  6RNT A;  4BL3 A;  4XM4 A;  4MEI A;  3EF8 A;  4KT3 B;  3URP A;  1OHO A;  2L1S A;  3M65 A;  2AS0 A;  1B2X A;  3HOH A;  4KZ1 A;  5BVB A;  7STD A;  3BU4 A;  3FH1 A;  1JBR A;  2XH9 A;  1ZL3 A;  3O8Y A;  4RNZ A;  5AIH A;  2RCD A;  1O7H B;  2CC3 A;  2W2C A;  1JKG B;  3DGO A;  1N5H A;  3LWQ A;  1UCL A;  3SXX A;  4HVN A;  4HM7 B;  1LOW A;  4J8T A;  2F5M A;  2KXG A;  3DMC A;  3STD A;  1R4Y A;  2MC8 A;  1I2E A;  1HU9 A;  3AHS A;  1UCI A;  2CG1 A;  1T2H A;  2YFJ B;  3MKI A;  1QAF A;  1EA2 A;  1KSI A;  1V57 A;  2W9P A;  1TRQ A;  3N8B A;  2CWT A;  1VQQ A;  3EBT A;  4NRE A;  1QAL A;  1D6Z A;  4TZ4 C;  3UB1 A;  1BSB A;  3GZB A;  8CHO A;  4WFO A;  1X1X A;  4OVM A;  1US1 A;  2P0M A;  5FGO A;  3MG1 A;  1K73 4;  2ZL8 A;  3CC2 3;  2XFT A;  4XDW A;  2BHM A;  1S72 3;  2CX1 A;  3LWV A;  1OHP A;  1NU3 A;  1YIT 3;  4U13 A;  2F56 A;  3I0Y A;  2F99 A;  1B20 A;  3JUM A;  3OW2 2;  1S04 A;  5G1K A;  2ML6 A;  2ANE A;  1SGV A;  4ORL A;  3EX9 A;  3T0U A;  2KAA A;  3Q90 A;  1O7P B;  3H3H A;  4RBN A;  3K9M C;  3NM7 A;  1AVK A;  1EEJ A;  1TJD A;  1Y4K A;  4H3U A;  5HGR A;  2KCD A;  2CFW A;  3LWO A;  5D82 A;  5LC6 A;  2C10 A;  1YJ9 3;  1IU7 A;  1LOX A;  3OXA A;  4X2O A;  1W7C A;  4BTX A;  4KVH A;  3CPO A;  1BRH A;  1GOU A;  1BSA A;  1UCJ A;  4CJN A;  5ELU A;  1PFP A;  1L5G B;  1BAN A;  1GSP A;  3TDG A;  1VQP 3;  5ELJ A;  1MWR A;  4KFD A;  1UW1 A;  3NBR A;  3N54 B;  4LSO A;  4EV5 A;  1UDI I;  5GSP A;  1MWU A;  2SAR A;  2YFI B;  5AI1 A;  1IT7 A;  1GS3 A;  3V92 A;  1KQS 2;  4XBY A;  1V74 A;  3Q1C A;  3KSP A;  1I3F A;  3HJY A;  1AR0 A;  4FMC A;  3F7X A;  1NJI 4;  1HKX A;  1C54 A;  4N6V 0;  1I8V A;  2Y74 A;  1JNQ A;  3DXO A;  3CXC 2;  3UJM A;  1A2V A;  3FZW A;  3Q3F A;  4WP5 A;  3LTA A;  3FKA A;  4L8O A;  3CCQ 3;  4JF8 A;  1A2P A;  3D5G A;  3OWS A;  4LYL B;  3FG4 A;  4HZB B;  3EJV A; 
#chains in the Genus database with same CATH homology
 2AB4 A;  1IT8 A;  2Q07 A;  3VSE A;  1WXW A;  1T5Y A;  4DMG A;  2P38 A;  1R3E A;  1Q7H A;  2AS0 A;  1WXX A;  4Q1T A;  2CX1 A;  3UAI A;  2J5T A;  1ZL3 A;  1IQ8 A;  1IT7 A;  3LDF A;  2B78 A;  1R3F A;  1K8W A;  1SQW A;  1SGV A;  3D79 A;  2J5V A;  1ZS7 A;  2CWW A;  1ZE2 A;  3C0K A;  1J2B A;  2CX0 A;  1ZE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...