2CX1A

Crystal structure of a pua domain (ape0525) from the aeropyrum pernix k1 (tartrate complex)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
b'HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein APE0525
publication title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
total genus 48
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2cx1A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 2cx1A01
2CX0A 1Q7HA 3D79A 1K8WA 1ZE2A 1R3FA 2P38A 1ZS7A 1T5YA 1SQWA 2B78A 1IQ8A 3VSEA 2AB4A 3C0KA 1WXXA 1J2BA 1WXWA 2CWWA 3UAIA 1SGVA 3LDFA 4DMGA 1R3EA 2J5VA 4Q1TA 2AS0A 2Q07A 1ZE1A 1IT8A 2CX1A 1IT7A 1ZL3A 2J5TA
chains in the Genus database with same CATH superfamily
3KSED 3CXC2 2XGNA 1SIIA 2CWUA 1D6UA 3GZBA 1ROVA 1A2KA 3BB9A 4RZMA 1UCKA 1LOVA 2GXFA 4FCZA 4KFEA 1IVXA 4WHAA 4R9KA 3EE1A 1G0TA 3HK4A 3PCRA 4XBYA 3BNEA 1RSNA 4RNZA 3LTBA 1W6GA 3ECFA 1W2B2 2F5MA 6RNTA 1EKMA 1W7CA 3D5IA 3EBYA 1GY7A 1UDII 3UAIA 3FG4A 3LDFA 2OOVA 4CPKA 2FGTA 1BOXA 1OGZA 2XSHB 3CPOA 2HMNB 3LTCA 2O3OA 4GL6A 4HM8B 3SXXA 1YVSA 3S29A 1JB4A 2Z6BA 3V99A 1S723 5STDA 1WNHA 4NPBA 1T2IA 1YHQ3 2CWTA 4R4KA 3T8UA 2EY4A 1BRKA 1MWSA 1RGGA 1NB5I 1N8R4 2GEXA 1JV2B 4BU4A 1R4CA 1A67A 1C54A 1N8QA 3JUMA 1AVLA 3UL6A 4RBNA 2RGQA 5AYSC 1T5YA 1TTOA 4R9LA 2H0GA 1RHLA 2W04A 1OHOA 4L8OA 5IF6A 2IYJA 2W03A 2ML5A 1NU3A 2XRXB 1BUJA 2YX9A 1F8NA 1EA2A 1IDPA 3ALAA 4LZIA 1ROAA 4HAAA 3RGRA 3DGLA 5CXOA 2OTL3 1MGRA 3LT9A 2GEYA 3K0ZA 4WP5A 5GSPA 3WHOA 1ZE1A 1KD14 3K9MC 2OTJ3 4N6MA 4BTWA 5JBSA 2W2CA 3SLUA 3WMDA 4FMCA 1RNTA 4LMIA 1MNLA 3AMOB 4O3VA 1NDOB 1Q864 3X3XA 2OWPA 3RGAA 1IK3A 2MF7A 3U28A 1YJ93 2APOA 3D79A 1BAOA 2OQEC 5AIFA 5IG0A 1EUIC 3RNTA 2GU1A 1QMAA 1K8WA 3B7CA 3KFQC 5IEPA 2CHCA 3CCV3 1QAKA 1R3FA 1ULIB 1IYYA 1QJGA 3CCU3 1LRAA 1B2XA 3BLZA 4N6TA 1TFOA 3EF8A 1FGRA 5EVHA 3LWPA 3BNDA 3RDEA 1J2BA 2CWWA 4J5GA 1TRPA 3K7CA 2Z77A 1GS3A 1GYBA 1I2FA 3WR2A 1AVKA 2XH9A 2BMRB 1UUVB 2CWVA 3AMOA 3EB8A 4R80A 4STDA 2M7OA 3URPA 3FG1A 3FZWA 9RNTA 3MKIA 1VQQA 5AIGA 1ZGXA 3E99A 2BHMA 5G2GA 1IV7A 1JN5B 3H51A 3OWUA 4MMYB 1HKXA 4MEIA 3NX0A 3FF2A 1WK2A 2Z0TA 1C7HA 1RDSA 2SARA 1GD3A 5D81A 1CYVA 3CPW2 3FF0A 3LWOA 4K61A 1R4YA 5AEWB 1ZO2A 1JNQA 1Q40B 4GSPA 3KIIA 1KQS2 3A76A 4HM2B 4FMAA 1RGAA 1PY3A 1A90A 3S27A 1VQP3 2XSOB 4HJLB 4KZ1A 2C10A 3LXUX 3K63A 3JUNA 4CI2B 1NO3A 3Q90A 1RCLA 4HBRA 4LSOA 1W01A 1OCVA 1MWTA 1GY5A 3LZAA 3JUPA 2ANEA 1WMPA 1WXWA 1BNEA 2C11A 1JBTA 1NNVA 3GZYB 3ZFZA 4N3VA 3QK9A 1DETA 3JVCA 2XFSA 1JN5A 2OQEA 4J5KA 2MC8A 3HJWA 2H0HA 5JPPA 3S67A 3F8HA 1RNBA 1UUGB 1STFI 4FCJA 1Q40A 1ULJB 5IG4A 3LJCA 3BU4A 1VQN3 2W0QA 3FCSB 3CCE3 3D4AA 3F40A 1LOXA 2CFDA 1OHPA 1ISKA 3UNLA 3LH4A 1YIT3 3F7XA 3M6UA 4AKYA 1RKYA 1WMOA 4R1KA 3B4OA 2KAAA 1BRIA 1L5GB 1VQ93 2IUJA 2E2VA 3I563 4BIRA 4HM3B 1HZ1A 5IG3A 1RGCA 2XR8B 4O2HA 3TDGA 2H0IA 1BRSA 4X2HA 3MPHA 1NWWA 2XGLA 1V58A 3STDA 1A2VA 1QAFA 4Q53A 1OH0A 3DM8A 1JRQA 4WYKB 1W4NA 1KSIA 3KKGA 4ILFA 1ZX2A 3HIGA 3CCJ3 5I97A 1E3RA 3SX1A 1B2MA 5ELUA 1I3IA 1OHSA 5ELJA 5KP4A 3CC73 2PZVA 1Q814 1ZS7A 1FUSA 2E5OA 3MHEA 2D42A 2JDIH 3EN1B 2B1XB 3D5GA 4CJNA 1CQSA 4GHOA 4KT3B 1E3VA 1I2EA 1IQYA 2SBLA 2E2TA 2INXA 1BSEA 2JQ5A 4HOHA 1N5HA 2P0XA 4WFOA 7STDA 1N9JA 1RN4A 1UGHI 1SPUA 3KCHA 2C4BA 2CX1A 4L7KA 1BVIA 4WYKA 5FGOA 4HKVB 1GMQA 1T3BA 2HOHA 5BIRA 4HM0B 3KSPA 2HVYA 3NQYA 5BXQA 3LTDA 1FUWA 2W9PA 3F14A 4K90B 5TGNA 5AEUB 1RGFA 2XF3A 5D83A 1US1A 1XNEA 2CX0A 3M65A 1GMRA 1N9EA 3LWRA 1M9GA 3UJMA 1YI23 3SVAA 3GAXA 1U8CB 2KXGA 5M18A 1K8A4 1ZE2A 3HJYA 1UOYA 3CCR3 2CG1A 1O7NB 2BNGA 3NXJA 2IMJA 1I0VA 1JBSA 3HOHA 3PXMA 4ORLA 3GSPA 5M1AA 1YJW3 5AI1A 3OWSA 1E97A 3B4PA 1JZOA 1MGWA 1RGEA 1K28A 1Y4KA 1UCIA 2HMJB 3LWQA 1GD4A 2QA43 2KF6A 1FGTA 2IUKA 2BMQB 1A2PA 1UCLA 5AIIA 1EQKA 2KCDA 3G0KA 1LOWA 1RTUA 2K0MA 4N6NB 2RFKA 1B27A 1G02A 2B24B 3OX9A 5CLKA 1BSCA 1I0XA 1KWIA 2F5WA 2P05A 1OACA 3Q2PA 5HGRA 3U97A 5LC7A 2WGQA 1UGIA 2AADA 3N54B 1RGKA 3OW22 4EYCA 1IV9A 3G8ZA 1BANA 4KVHA 3G16A 3O8YA 4K1VA 1MWRA 1BNSA 3UL5A 1O7HB 5CF2A 2IY2A 1JKGB 2BT3A 3H3HA 3LYGA 3DGMA 4BTXA 5KP1A 4XBTA 3IUWA 3FGYA 1DMNA 1BNIA 1KC84 2E2UA 4EBGA 1BRHA 2UX0A 3AHWA 2J5VA 3NV0B 5IERA 3DH2A 2Y73A 2GU3A 2L1SA 3SOAA 1IT7A 4HZ9B 3M8CA 3M6WA 5RNTA 1JB2A 3F9SA 1LNIA 2P0MA 1LQMB 6GSPA 1VQK3 3X3YA 1X1UA 1STDA 5G1KA 5AYRB 1GOYA 1UI7A 1DE3A 1YVBI 3ER7A 3X42A 1S04A 3NUVA 3PGBA 2R41A 3HAXA 3HZPA 4BL3A 1TFKA 2STDA 3CMA3 1JKGA 2CIUA 3M4XA 2F86B 3NBBA 4HM7B 3X3ZA 5HOHA 2RBIA 3SOYA 3CC43 2L4VA 1BUQA 3C0KA 1EEJA 4EXRA 1Q7Y4 4JRFA 3NV0A 1RLSA 3MWZA 1YGWA 1FYSA 1Z1SA 3MG3A 3NBJA 4NREA 2CH9A 1R3EA 2W6JH 3CNMA 1LVNA 1UCJA 1IQXA 5AIHA 5IEOA 2PNCA 3F7SA 3VGNA 1FW7A 5EEOA 5IG5A 3V92A 2D1WA 4OUQA 1BNJA 4HYZA 3ROBA 1K9M4 4MMZB 1LNHA 3AHSA 1VQ63 3MQKA 1WQLB 2CFKA 1CEWI 1Q7HA 1BSAA 1BSBA 3NBRA 1YGEA 3QRDA 4H61A 5KP3A 3SEDA 3WODG 3WOFB 1I2GA 1MWUA 1IU7A 1BRJA 1O7GB 2Y74A 4IPBA 2AAEA 3S5CA 1G96A 3G713 2XEPA 1QVF2 3EN8A 2XFTA 3DY5A 3FG3A 4HM1B 5IENA 2J8XB 3VSEA 3EHCA 1FGQA 3CD63 1AQZA 3ZG5A 1SGVA 3LMLA 2QEX3 1B21A 2FRXA 4FCMA 1VQO3 1QVG2 2Z76A 2YFIB 1TIJA 1O7MB 1ASKA 2CFGA 2YFLB 1ZL3A 1Q42A 3NM7A 3I0YA 3DZLA 3WA2X 1RN1A 1B20A 4XDWA 2CK3H 2GSPA 3D9RA 4NHFA 1CH0A 1D6ZA 1HU9A 2HMLB 3GZRA 3EBTA 1DYUA 4XM4A 1IVVA 3VSYA 1SARA 3WOEB 1SQWA 1W6YA 1IQ8A 8RNTA 3OV4A 1PU4A 1TUHA 3IJEB 1IVWA 1UW1A 3K5TA 8CHOA 1YIJ3 1WXXA 1TE7A 1RRLA 4XB5A 2LQVA 2OCTA 2FNQA 1DMMA 2QIYA 3BNBA 3CU3A 4MJDA 1RCKA 4RNTA 4Q1TA 3UB1A 4O8SA 2Q07A 5M19A 2UGIA 1BSDA 3G4S3 1VQ73 4TZ4C 1SIHA 5A0OB 3J7Yd 2GBWB 1VQL3 3CCL3 1RGHA 3NHXA 2QGUA 1RN7A 3U1WA 1RRHA 1ZBOA 3Q3FA 4U13A 4L8PA 2WOHA 4J9AA 4CI3B 3ZV0C 4EV2A 1M904 1UUWB 1VQ83 1HYFA 3F8XA 2F98A 1V57A 4KFFA 3DGNA 3IPTA 3OWYA 5BVBA 2F99A 1JB5A 3JUOA 3V98A 2AB4A 1WMNA 4H3UA 2K3DA 3LT8A 3T8NA 3WDGB 3Q1CA 1N5PA 1W5ZA 3GZXB 1AV4A 4DMGA 3MG2A 1RGLA 3LOYA 4N6LA 5CK6A 1EG9B 4HM4B 1T2HA 4HZBB 2RNTA 3SYUA 4K1UA 3N9HA 1YNVX 3DGOA 1BRNL 3CME3 1PYLA 2KF3A 3PCSA 4ZM8A 1Q9EA 4AEQA 2HMOB 1I8VA 3IMAB 4HVNA 5D82A 3ZG0A 1FA3A 4CDLA 1PFPA 1TJDA 3DUKA 2BIRA 2Z7AA 3FSDA 4CI1B 4QWTA 4I5QA 2RFRA 2CFWA 2P38A 4HM5B 4DKIA 1LQGC 1VQ43 1FZUA 1GOVA 1O7PB 3FKAA 1LXEA 3DMCA 1SJWA 2CW9A 1VZZA 2HMKB 1OUNA 4LEHA 4IT7A 3A5EA 2RCDA 1AR0A 3L0RA 4I4KA 1BNFA 1DMQA 2CFLA 1W02A 2ZHXB 3M6VA 1GSPA 3KN4A 1V74A 1IT8A 2UUGC 3JUQA 3PZWA 2KKUA 5LC6A 5BU4A 1W00A 3FH1A 2AUSA 3WA3A 1GMPA 2W9QA 1W2ZA 4N6UA 2BMOB 3D3LA 1VQM3 3AGNA 3HI7A 3N8BA 4J8TA 3X41A 4JF8A 3EQQB 6STDA 1TU5A 1K734 2HMMB 3PS8A 2IA7A 4FMBA 4PEJA 4BTYA 3CCM3 1GY6A 2BU4A 1JBRA 1NJI4 1M1XB 1W6CA 3T0UA 2A15A 2DP9A 2F56A 2P09A 2KF5A 1JZDA 2ZA4A 1GOUA 3EC9A 3AGOA 4WWUC 3BIRA 2K54A 1M1K4 1QALA 3DXOA 3M6XA 2F4YA 1FGMA 2ML6A 1DVDA 3PYJA 1OF5B 1X1WA 4GB5A 1JJ22 4EV5A 3CCQ3 3HIIA 2J5TA 1K41A 3GWRA 1Q824 4LGQA 2KRTA 1YJN3 2WGOA 4XDVA 1B2UA 2KF4A 5FW5A 3EX9A 1B2ZA 1O7WB 1TP6A 3DGYA 5G1LA 1AY7A 1OGXA 1X1YA 4N6OB 5JPUA 3OXAA 2W56B 3LTAA 4OVMA 1D6YA 5DREA 4AKZA 3G6E3 1BNRA 2I9WA 3MYTA 3KE7A 4IIAA 3KZTA 5CF1A 4RNYA 3LWVA 1RJOA 1WTHA 4KFDA 1FGOA 1OF5A 7RNTA 1IVUA 4MMXB 2R4IA 2YFJB 4TX4A 1LOYA 1OPYA 1FUTA 3I553 4OK0A 4EW5A 1VQ53 2ZL8A 4N6V0 5DRVA 1BNGA 1TRQA 3B8LA 1S5AA 4HM6B 1BIRA 1RMSA 2RSXA 3BNCA 2CC3A 2CKFB 2OOVC 4FR9A 2W56A 3MG1A 1UI8A 3GRDA 3HX8A 1CYUA 3CCS3 4BL2A 1NB3I 2GBXB 3VF1A 1BU4A 1DVCA 3MSOA 2FXTA 3CNXA 3FLJA 1B3SA 5EQLA 2B78A 1X1XA 1U5OA 1BGSA 1BRGA 2CG0A 2O9UX 4EC6A 4XBXA 1MOLA 2LYXA 1I3FA 3EJVA 4LYLB 1B2SA 3S28A 3CC23 1I70A 2V1LA 4CCVA 7GSPA 3X40A 2AS0A 2WOFA 2ZDJA 4G1MB 4X2OA 3NM2A 4FMDA 2BO9B 5IW9A 2WO0A 4O02B 3NQZA
chains in the Genus database with same CATH topology
2CX0A 1Q7HA 3D79A 1K8WA 1ZE2A 1R3FA 2P38A 1ZS7A 1T5YA 1SQWA 2B78A 1IQ8A 3VSEA 2AB4A 3C0KA 1WXXA 1J2BA 1WXWA 2CWWA 3UAIA 1SGVA 3LDFA 4DMGA 1R3EA 2J5VA 4Q1TA 2AS0A 2Q07A 1ZE1A 1IT8A 2CX1A 1IT7A 1ZL3A 2J5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CX0 A;  1Q7H A;  3D79 A;  1K8W A;  1ZE2 A;  1R3F A;  2P38 A;  1ZS7 A;  1T5Y A;  1SQW A;  2B78 A;  1IQ8 A;  3VSE A;  2AB4 A;  3C0K A;  1WXX A;  1J2B A;  1WXW A;  2CWW A;  3UAI A;  1SGV A;  3LDF A;  4DMG A;  1R3E A;  2J5V A;  4Q1T A;  2AS0 A;  2Q07 A;  1ZE1 A;  1IT8 A;  2CX1 A;  1IT7 A;  1ZL3 A;  2J5T A; 
#chains in the Genus database with same CATH topology
 3KSE D;  3CXC 2;  2XGN A;  1SII A;  2CWU A;  1D6U A;  3GZB A;  1ROV A;  1A2K A;  3BB9 A;  4RZM A;  1UCK A;  1LOV A;  2GXF A;  4FCZ A;  4KFE A;  1IVX A;  4WHA A;  4R9K A;  3EE1 A;  1G0T A;  3HK4 A;  3PCR A;  4XBY A;  3BNE A;  1RSN A;  4RNZ A;  3LTB A;  1W6G A;  3ECF A;  1W2B 2;  2F5M A;  6RNT A;  1EKM A;  1W7C A;  3D5I A;  3EBY A;  1GY7 A;  1UDI I;  3UAI A;  3FG4 A;  3LDF A;  2OOV A;  4CPK A;  2FGT A;  1BOX A;  1OGZ A;  2XSH B;  3CPO A;  2HMN B;  3LTC A;  2O3O A;  4GL6 A;  4HM8 B;  3SXX A;  1YVS A;  3S29 A;  1JB4 A;  2Z6B A;  3V99 A;  1S72 3;  5STD A;  1WNH A;  4NPB A;  1T2I A;  1YHQ 3;  2CWT A;  4R4K A;  3T8U A;  2EY4 A;  1BRK A;  1MWS A;  1RGG A;  1NB5 I;  1N8R 4;  2GEX A;  1JV2 B;  4BU4 A;  1R4C A;  1A67 A;  1C54 A;  1N8Q A;  3JUM A;  1AVL A;  3UL6 A;  4RBN A;  2RGQ A;  5AYS C;  1T5Y A;  1TTO A;  4R9L A;  2H0G A;  1RHL A;  2W04 A;  1OHO A;  4L8O A;  5IF6 A;  2IYJ A;  2W03 A;  2ML5 A;  1NU3 A;  2XRX B;  1BUJ A;  2YX9 A;  1F8N A;  1EA2 A;  1IDP A;  3ALA A;  4LZI A;  1ROA A;  4HAA A;  3RGR A;  3DGL A;  5CXO A;  2OTL 3;  1MGR A;  3LT9 A;  2GEY A;  3K0Z A;  4WP5 A;  5GSP A;  3WHO A;  1ZE1 A;  1KD1 4;  3K9M C;  2OTJ 3;  4N6M A;  4BTW A;  5JBS A;  2W2C A;  3SLU A;  3WMD A;  4FMC A;  1RNT A;  4LMI A;  1MNL A;  3AMO B;  4O3V A;  1NDO B;  1Q86 4;  3X3X A;  2OWP A;  3RGA A;  1IK3 A;  2MF7 A;  3U28 A;  1YJ9 3;  2APO A;  3D79 A;  1BAO A;  2OQE C;  5AIF A;  5IG0 A;  1EUI C;  3RNT A;  2GU1 A;  1QMA A;  1K8W A;  3B7C A;  3KFQ C;  5IEP A;  2CHC A;  3CCV 3;  1QAK A;  1R3F A;  1ULI B;  1IYY A;  1QJG A;  3CCU 3;  1LRA A;  1B2X A;  3BLZ A;  4N6T A;  1TFO A;  3EF8 A;  1FGR A;  5EVH A;  3LWP A;  3BND A;  3RDE A;  1J2B A;  2CWW A;  4J5G A;  1TRP A;  3K7C A;  2Z77 A;  1GS3 A;  1GYB A;  1I2F A;  3WR2 A;  1AVK A;  2XH9 A;  2BMR B;  1UUV B;  2CWV A;  3AMO A;  3EB8 A;  4R80 A;  4STD A;  2M7O A;  3URP A;  3FG1 A;  3FZW A;  9RNT A;  3MKI A;  1VQQ A;  5AIG A;  1ZGX A;  3E99 A;  2BHM A;  5G2G A;  1IV7 A;  1JN5 B;  3H51 A;  3OWU A;  4MMY B;  1HKX A;  4MEI A;  3NX0 A;  3FF2 A;  1WK2 A;  2Z0T A;  1C7H A;  1RDS A;  2SAR A;  1GD3 A;  5D81 A;  1CYV A;  3CPW 2;  3FF0 A;  3LWO A;  4K61 A;  1R4Y A;  5AEW B;  1ZO2 A;  1JNQ A;  1Q40 B;  4GSP A;  3KII A;  1KQS 2;  3A76 A;  4HM2 B;  4FMA A;  1RGA A;  1PY3 A;  1A90 A;  3S27 A;  1VQP 3;  2XSO B;  4HJL B;  4KZ1 A;  2C10 A;  3LXU X;  3K63 A;  3JUN A;  4CI2 B;  1NO3 A;  3Q90 A;  1RCL A;  4HBR A;  4LSO A;  1W01 A;  1OCV A;  1MWT A;  1GY5 A;  3LZA A;  3JUP A;  2ANE A;  1WMP A;  1WXW A;  1BNE A;  2C11 A;  1JBT A;  1NNV A;  3GZY B;  3ZFZ A;  4N3V A;  3QK9 A;  1DET A;  3JVC A;  2XFS A;  1JN5 A;  2OQE A;  4J5K A;  2MC8 A;  3HJW A;  2H0H A;  5JPP A;  3S67 A;  3F8H A;  1RNB A;  1UUG B;  1STF I;  4FCJ A;  1Q40 A;  1ULJ B;  5IG4 A;  3LJC A;  3BU4 A;  1VQN 3;  2W0Q A;  3FCS B;  3CCE 3;  3D4A A;  3F40 A;  1LOX A;  2CFD A;  1OHP A;  1ISK A;  3UNL A;  3LH4 A;  1YIT 3;  3F7X A;  3M6U A;  4AKY A;  1RKY A;  1WMO A;  4R1K A;  3B4O A;  2KAA A;  1BRI A;  1L5G B;  1VQ9 3;  2IUJ A;  2E2V A;  3I56 3;  4BIR A;  4HM3 B;  1HZ1 A;  5IG3 A;  1RGC A;  2XR8 B;  4O2H A;  3TDG A;  2H0I A;  1BRS A;  4X2H A;  3MPH A;  1NWW A;  2XGL A;  1V58 A;  3STD A;  1A2V A;  1QAF A;  4Q53 A;  1OH0 A;  3DM8 A;  1JRQ A;  4WYK B;  1W4N A;  1KSI A;  3KKG A;  4ILF A;  1ZX2 A;  3HIG A;  3CCJ 3;  5I97 A;  1E3R A;  3SX1 A;  1B2M A;  5ELU A;  1I3I A;  1OHS A;  5ELJ A;  5KP4 A;  3CC7 3;  2PZV A;  1Q81 4;  1ZS7 A;  1FUS A;  2E5O A;  3MHE A;  2D42 A;  2JDI H;  3EN1 B;  2B1X B;  3D5G A;  4CJN A;  1CQS A;  4GHO A;  4KT3 B;  1E3V A;  1I2E A;  1IQY A;  2SBL A;  2E2T A;  2INX A;  1BSE A;  2JQ5 A;  4HOH A;  1N5H A;  2P0X A;  4WFO A;  7STD A;  1N9J A;  1RN4 A;  1UGH I;  1SPU A;  3KCH A;  2C4B A;  2CX1 A;  4L7K A;  1BVI A;  4WYK A;  5FGO A;  4HKV B;  1GMQ A;  1T3B A;  2HOH A;  5BIR A;  4HM0 B;  3KSP A;  2HVY A;  3NQY A;  5BXQ A;  3LTD A;  1FUW A;  2W9P A;  3F14 A;  4K90 B;  5TGN A;  5AEU B;  1RGF A;  2XF3 A;  5D83 A;  1US1 A;  1XNE A;  2CX0 A;  3M65 A;  1GMR A;  1N9E A;  3LWR A;  1M9G A;  3UJM A;  1YI2 3;  3SVA A;  3GAX A;  1U8C B;  2KXG A;  5M18 A;  1K8A 4;  1ZE2 A;  3HJY A;  1UOY A;  3CCR 3;  2CG1 A;  1O7N B;  2BNG A;  3NXJ A;  2IMJ A;  1I0V A;  1JBS A;  3HOH A;  3PXM A;  4ORL A;  3GSP A;  5M1A A;  1YJW 3;  5AI1 A;  3OWS A;  1E97 A;  3B4P A;  1JZO A;  1MGW A;  1RGE A;  1K28 A;  1Y4K A;  1UCI A;  2HMJ B;  3LWQ A;  1GD4 A;  2QA4 3;  2KF6 A;  1FGT A;  2IUK A;  2BMQ B;  1A2P A;  1UCL A;  5AII A;  1EQK A;  2KCD A;  3G0K A;  1LOW A;  1RTU A;  2K0M A;  4N6N B;  2RFK A;  1B27 A;  1G02 A;  2B24 B;  3OX9 A;  5CLK A;  1BSC A;  1I0X A;  1KWI A;  2F5W A;  2P05 A;  1OAC A;  3Q2P A;  5HGR A;  3U97 A;  5LC7 A;  2WGQ A;  1UGI A;  2AAD A;  3N54 B;  1RGK A;  3OW2 2;  4EYC A;  1IV9 A;  3G8Z A;  1BAN A;  4KVH A;  3G16 A;  3O8Y A;  4K1V A;  1MWR A;  1BNS A;  3UL5 A;  1O7H B;  5CF2 A;  2IY2 A;  1JKG B;  2BT3 A;  3H3H A;  3LYG A;  3DGM A;  4BTX A;  5KP1 A;  4XBT A;  3IUW A;  3FGY A;  1DMN A;  1BNI A;  1KC8 4;  2E2U A;  4EBG A;  1BRH A;  2UX0 A;  3AHW A;  2J5V A;  3NV0 B;  5IER A;  3DH2 A;  2Y73 A;  2GU3 A;  2L1S A;  3SOA A;  1IT7 A;  4HZ9 B;  3M8C A;  3M6W A;  5RNT A;  1JB2 A;  3F9S A;  1LNI A;  2P0M A;  1LQM B;  6GSP A;  1VQK 3;  3X3Y A;  1X1U A;  1STD A;  5G1K A;  5AYR B;  1GOY A;  1UI7 A;  1DE3 A;  1YVB I;  3ER7 A;  3X42 A;  1S04 A;  3NUV A;  3PGB A;  2R41 A;  3HAX A;  3HZP A;  4BL3 A;  1TFK A;  2STD A;  3CMA 3;  1JKG A;  2CIU A;  3M4X A;  2F86 B;  3NBB A;  4HM7 B;  3X3Z A;  5HOH A;  2RBI A;  3SOY A;  3CC4 3;  2L4V A;  1BUQ A;  3C0K A;  1EEJ A;  4EXR A;  1Q7Y 4;  4JRF A;  3NV0 A;  1RLS A;  3MWZ A;  1YGW A;  1FYS A;  1Z1S A;  3MG3 A;  3NBJ A;  4NRE A;  2CH9 A;  1R3E A;  2W6J H;  3CNM A;  1LVN A;  1UCJ A;  1IQX A;  5AIH A;  5IEO A;  2PNC A;  3F7S A;  3VGN A;  1FW7 A;  5EEO A;  5IG5 A;  3V92 A;  2D1W A;  4OUQ A;  1BNJ A;  4HYZ A;  3ROB A;  1K9M 4;  4MMZ B;  1LNH A;  3AHS A;  1VQ6 3;  3MQK A;  1WQL B;  2CFK A;  1CEW I;  1Q7H A;  1BSA A;  1BSB A;  3NBR A;  1YGE A;  3QRD A;  4H61 A;  5KP3 A;  3SED A;  3WOD G;  3WOF B;  1I2G A;  1MWU A;  1IU7 A;  1BRJ A;  1O7G B;  2Y74 A;  4IPB A;  2AAE A;  3S5C A;  1G96 A;  3G71 3;  2XEP A;  1QVF 2;  3EN8 A;  2XFT A;  3DY5 A;  3FG3 A;  4HM1 B;  5IEN A;  2J8X B;  3VSE A;  3EHC A;  1FGQ A;  3CD6 3;  1AQZ A;  3ZG5 A;  1SGV A;  3LML A;  2QEX 3;  1B21 A;  2FRX A;  4FCM A;  1VQO 3;  1QVG 2;  2Z76 A;  2YFI B;  1TIJ A;  1O7M B;  1ASK A;  2CFG A;  2YFL B;  1ZL3 A;  1Q42 A;  3NM7 A;  3I0Y A;  3DZL A;  3WA2 X;  1RN1 A;  1B20 A;  4XDW A;  2CK3 H;  2GSP A;  3D9R A;  4NHF A;  1CH0 A;  1D6Z A;  1HU9 A;  2HML B;  3GZR A;  3EBT A;  1DYU A;  4XM4 A;  1IVV A;  3VSY A;  1SAR A;  3WOE B;  1SQW A;  1W6Y A;  1IQ8 A;  8RNT A;  3OV4 A;  1PU4 A;  1TUH A;  3IJE B;  1IVW A;  1UW1 A;  3K5T A;  8CHO A;  1YIJ 3;  1WXX A;  1TE7 A;  1RRL A;  4XB5 A;  2LQV A;  2OCT A;  2FNQ A;  1DMM A;  2QIY A;  3BNB A;  3CU3 A;  4MJD A;  1RCK A;  4RNT A;  4Q1T A;  3UB1 A;  4O8S A;  2Q07 A;  5M19 A;  2UGI A;  1BSD A;  3G4S 3;  1VQ7 3;  4TZ4 C;  1SIH A;  5A0O B;  3J7Y d;  2GBW B;  1VQL 3;  3CCL 3;  1RGH A;  3NHX A;  2QGU A;  1RN7 A;  3U1W A;  1RRH A;  1ZBO A;  3Q3F A;  4U13 A;  4L8P A;  2WOH A;  4J9A A;  4CI3 B;  3ZV0 C;  4EV2 A;  1M90 4;  1UUW B;  1VQ8 3;  1HYF A;  3F8X A;  2F98 A;  1V57 A;  4KFF A;  3DGN A;  3IPT A;  3OWY A;  5BVB A;  2F99 A;  1JB5 A;  3JUO A;  3V98 A;  2AB4 A;  1WMN A;  4H3U A;  2K3D A;  3LT8 A;  3T8N A;  3WDG B;  3Q1C A;  1N5P A;  1W5Z A;  3GZX B;  1AV4 A;  4DMG A;  3MG2 A;  1RGL A;  3LOY A;  4N6L A;  5CK6 A;  1EG9 B;  4HM4 B;  1T2H A;  4HZB B;  2RNT A;  3SYU A;  4K1U A;  3N9H A;  1YNV X;  3DGO A;  1BRN L;  3CME 3;  1PYL A;  2KF3 A;  3PCS A;  4ZM8 A;  1Q9E A;  4AEQ A;  2HMO B;  1I8V A;  3IMA B;  4HVN A;  5D82 A;  3ZG0 A;  1FA3 A;  4CDL A;  1PFP A;  1TJD A;  3DUK A;  2BIR A;  2Z7A A;  3FSD A;  4CI1 B;  4QWT A;  4I5Q A;  2RFR A;  2CFW A;  2P38 A;  4HM5 B;  4DKI A;  1LQG C;  1VQ4 3;  1FZU A;  1GOV A;  1O7P B;  3FKA A;  1LXE A;  3DMC A;  1SJW A;  2CW9 A;  1VZZ A;  2HMK B;  1OUN A;  4LEH A;  4IT7 A;  3A5E A;  2RCD A;  1AR0 A;  3L0R A;  4I4K A;  1BNF A;  1DMQ A;  2CFL A;  1W02 A;  2ZHX B;  3M6V A;  1GSP A;  3KN4 A;  1V74 A;  1IT8 A;  2UUG C;  3JUQ A;  3PZW A;  2KKU A;  5LC6 A;  5BU4 A;  1W00 A;  3FH1 A;  2AUS A;  3WA3 A;  1GMP A;  2W9Q A;  1W2Z A;  4N6U A;  2BMO B;  3D3L A;  1VQM 3;  3AGN A;  3HI7 A;  3N8B A;  4J8T A;  3X41 A;  4JF8 A;  3EQQ B;  6STD A;  1TU5 A;  1K73 4;  2HMM B;  3PS8 A;  2IA7 A;  4FMB A;  4PEJ A;  4BTY A;  3CCM 3;  1GY6 A;  2BU4 A;  1JBR A;  1NJI 4;  1M1X B;  1W6C A;  3T0U A;  2A15 A;  2DP9 A;  2F56 A;  2P09 A;  2KF5 A;  1JZD A;  2ZA4 A;  1GOU A;  3EC9 A;  3AGO A;  4WWU C;  3BIR A;  2K54 A;  1M1K 4;  1QAL A;  3DXO A;  3M6X A;  2F4Y A;  1FGM A;  2ML6 A;  1DVD A;  3PYJ A;  1OF5 B;  1X1W A;  4GB5 A;  1JJ2 2;  4EV5 A;  3CCQ 3;  3HII A;  2J5T A;  1K41 A;  3GWR A;  1Q82 4;  4LGQ A;  2KRT A;  1YJN 3;  2WGO A;  4XDV A;  1B2U A;  2KF4 A;  5FW5 A;  3EX9 A;  1B2Z A;  1O7W B;  1TP6 A;  3DGY A;  5G1L A;  1AY7 A;  1OGX A;  1X1Y A;  4N6O B;  5JPU A;  3OXA A;  2W56 B;  3LTA A;  4OVM A;  1D6Y A;  5DRE A;  4AKZ A;  3G6E 3;  1BNR A;  2I9W A;  3MYT A;  3KE7 A;  4IIA A;  3KZT A;  5CF1 A;  4RNY A;  3LWV A;  1RJO A;  1WTH A;  4KFD A;  1FGO A;  1OF5 A;  7RNT A;  1IVU A;  4MMX B;  2R4I A;  2YFJ B;  4TX4 A;  1LOY A;  1OPY A;  1FUT A;  3I55 3;  4OK0 A;  4EW5 A;  1VQ5 3;  2ZL8 A;  4N6V 0;  5DRV A;  1BNG A;  1TRQ A;  3B8L A;  1S5A A;  4HM6 B;  1BIR A;  1RMS A;  2RSX A;  3BNC A;  2CC3 A;  2CKF B;  2OOV C;  4FR9 A;  2W56 A;  3MG1 A;  1UI8 A;  3GRD A;  3HX8 A;  1CYU A;  3CCS 3;  4BL2 A;  1NB3 I;  2GBX B;  3VF1 A;  1BU4 A;  1DVC A;  3MSO A;  2FXT A;  3CNX A;  3FLJ A;  1B3S A;  5EQL A;  2B78 A;  1X1X A;  1U5O A;  1BGS A;  1BRG A;  2CG0 A;  2O9U X;  4EC6 A;  4XBX A;  1MOL A;  2LYX A;  1I3F A;  3EJV A;  4LYL B;  1B2S A;  3S28 A;  3CC2 3;  1I70 A;  2V1L A;  4CCV A;  7GSP A;  3X40 A;  2AS0 A;  2WOF A;  2ZDJ A;  4G1M B;  4X2O A;  3NM2 A;  4FMD A;  2BO9 B;  5IW9 A;  2WO0 A;  4O02 B;  3NQZ A; 
#chains in the Genus database with same CATH homology
 2CX0 A;  1Q7H A;  3D79 A;  1K8W A;  1ZE2 A;  1R3F A;  2P38 A;  1ZS7 A;  1T5Y A;  1SQW A;  2B78 A;  1IQ8 A;  3VSE A;  2AB4 A;  3C0K A;  1WXX A;  1J2B A;  1WXW A;  2CWW A;  3UAI A;  1SGV A;  3LDF A;  4DMG A;  1R3E A;  2J5V A;  4Q1T A;  2AS0 A;  2Q07 A;  1ZE1 A;  1IT8 A;  2CX1 A;  1IT7 A;  1ZL3 A;  2J5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...