2CX1A

Crystal structure of a pua domain (ape0525) from the aeropyrum pernix k1 (tartrate complex)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein APE0525
publication title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)
rcsb
source organism Aeropyrum pernix
total genus 48
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2cx1A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 2cx1A01
1T5YA 3C0KA 2AB4A 1R3FA 1SQWA 1IQ8A 3VSEA 1SGVA 1ZE2A 2Q07A 1IT7A 1WXXA 1R3EA 2J5VA 2CX1A 1ZS7A 2J5TA 3D79A 2P38A 1WXWA 1J2BA 2AS0A 1IT8A 4Q1TA 1Q7HA 3LDFA 1ZE1A 2B78A 2CWWA 1ZL3A 3UAIA 2CX0A 4DMGA 1K8WA
chains in the Genus database with same CATH superfamily
3X41A 1O7MB 3M6UA 1LQMB 1BSCA 3LYGA 3X3XA 1K28A 4XBTA 3VSEA 3FH1A 2Q07A 1IT7A 3LWRA 3S67A 4L7KA 3HX8A 3ROBA 1UDII 1YGWA 3FSDA 2BU4A 4AKYA 1ZS7A 1T2HA 4H3UA 3EC9A 2SBLA 3J7Yd 3RNTA 2J5TA 3M65A 4WFOA 4CDLA 1QAFA 1UCKA 2F5WA 2F86B 1TUHA 1GY7A 2GSPA 2HMNB 2MF7A 3PGBA 1TRPA 2IMJA 1I8VA 4HJLB 1Q40A 1SIIA 1E3RA 1GMRA 2O3OA 3M8CA 3AGNA 3K63A 2HMOB 5JBSA 1BRJA 4LMIA 1W2ZA 2B78A 3UAIA 3F7SA 3DM8A 3T8UA 1M904 1I70A 3G6E3 5EQLA 1B2ZA 4KZ1A 3S27A 2GU3A 1W01A 2OCTA 1FUWA 4EV2A 3I553 4R4KA 4MEIA 1IQ8A 1GOUA 3ECFA 4PEJA 7RNTA 2V1LA 3F40A 5DRVA 5IG3A 5FGOA 3Q1CA 2KF4A 2FGTA 2E5OA 2W56B 1U8CB 2QIYA 2CFGA 2GU1A 2W9PA 3PS8A 4XBXA 1O7PB 3EJVA 1KC84 3D79A 3D5IA 2WO0A 3IPTA 3KKGA 1VQ53 4BTXA 4EW5A 1B27A 1ZGXA 2QEX3 1G02A 2BHMA 1RN7A 4KT3B 4NREA 4X2OA 1AQZA 1YNVX 4IT7A 3ALAA 1JRQA 1BNFA 4N6UA 3F7XA 5M1AA 2XGLA 1D6YA 2F4YA 4BIRA 3CNXA 3T8NA 4EYCA 3B8LA 1TFOA 3LXUX 1JN5A 3Q2PA 7GSPA 2HMKB 1W6GA 3AHWA 3HOHA 3KZTA 1OHSA 4WWUC 1WXXA 5EVHA 2RGQA 2Y74A 4RZMA 5DREA 2BIRA 2Y73A 3BB9A 1O7HB 2MC8A 4BL2A 4MJDA 3DZLA 2CG1A 2CWTA 2ZHXB 3K0ZA 1YGEA 3LTCA 5ELUA 5IG5A 1EQKA 5HGRA 5BXQA 1ZBOA 1YJW3 2GEXA 1NNVA 4J5KA 2YX9A 3KSPA 1VZZA 2FNQA 3JUMA 4STDA 4EXRA 4FMDA 3EN8A 1GYBA 2IA7A 3CU3A 2I9WA 1JJ22 1BRNL 3CCL3 1ZO2A 1DVDA 4MMXB 1BAOA 1LOVA 2XEPA 3GZXB 1LQGC 3NV0A 1YJN3 3DGYA 1SQWA 1UOYA 1WK2A 3A5EA 2W0QA 1QAKA 1RTUA 4WYKB 1B2UA 1I3FA 1IU7A 4L8OA 1SARA 3SOAA 1S723 5EEOA 3EBTA 4GHOA 2CC3A 1U5OA 4FCZA 1BNEA 3CCQ3 1C7HA 4I4KA 1KQS2 1UW1A 1CH0A 4K61A 1K9M4 1IV7A 1LNHA 4AEQA 5AEUB 5I97A 2QA43 3AMOB 1VQM3 1D6ZA 1JBSA 1VQ43 3D4AA 3NM7A 2KKUA 1I2FA 1RGLA 3VGNA 4MMYB 3CCJ3 2CWWA 3DY5A 2H0IA 2HMLB 4DMGA 4CI2B 3EF8A 3MYTA 2BNGA 5BU4A 3G4S3 1K41A 3BNBA 1UUWB 1K734 5STDA 1T3BA 2C11A 3G713 1W4NA 6GSPA 4GL6A 2UGIA 3CC23 3NHXA 1FGQA 2OWPA 3D5GA 3MWZA 1JZOA 3CD63 9RNTA 2R41A 2BMQB 2CG0A 4XM4A 3M6XA 1OF5A 2XH9A 4IPBA 4N6OB 3G0KA 3CNMA 1FGTA 3SVAA 5D83A 8RNTA 4WYKA 1WTHA 1EKMA 2P05A 1BRHA 2XR8B 3K7CA 3OWUA 3PXMA 2H0GA 1DMQA 4FMCA 5CK6A 4HM6B 1WXWA 1FGMA 1RJOA 2HMJB 1TU5A 1RGCA 3BLZA 3T0UA 3CCR3 1UCJA 2UX0A 1CQSA 3KN4A 3X3YA 3GZRA 4Q1TA 2L4VA 3MG1A 3PZWA 3EBYA 1ZE1A 2P09A 2P0MA 3AMOA 1ULIB 3L0RA 1BRGA 3GZBA 1OHOA 3HIGA 4KFFA 3GZYB 3V99A 3IJEB 1N9JA 1YVSA 1F8NA 1TIJA 3OWSA 4G1MB 4J9AA 3WA2X 1X1XA 1BNRA 5HOHA 1SJWA 1A90A 4FMAA 3EB8A 2J5VA 2GXFA 1US1A 1QVG2 3EN1B 4CPKA 4LEHA 1YHQ3 1STFI 4N3VA 5IG0A 1O7GB 1Q42A 4I5QA 2C10A 3NBBA 3IMAB 5BVBA 1M9GA 1I2EA 2XRXB 5D82A 3KE7A 1BUQA 1BU4A 1BSAA 1VQP3 3LWQA 3LDFA 1RSNA 2AAEA 4FMBA 4AKZA 2IY2A 3OX9A 1UUVB 2ML5A 3U97A 1QVF2 1MWSA 1RRLA 3DGLA 3JUNA 3NQZA 4XDWA 3OV4A 1S5AA 3WOFB 1PYLA 3D3LA 3VSYA 3FF2A 4N6V0 1PFPA 1Q7Y4 1YI23 2GEYA 1VQ63 1VQN3 1RGAA 4QWTA 1S04A 2ANEA 1B2XA 3QRDA 3LOYA 2HVYA 3WOEB 5AEWB 1Q824 3BNCA 4N6MA 2M7OA 1N8QA 2A15A 1BANA 4BU4A 1N9EA 1WQLB 1DMMA 3EHCA 1QALA 3F8HA 3X42A 5IEOA 3FKAA 6RNTA 2W04A 1MGRA 3PCSA 3U28A 2E2TA 6STDA 5KP1A 1JKGB 1OCVA 1YJ93 5CLKA 1Q9EA 4ILFA 2RCDA 5BIRA 3CCV3 3UL6A 4DKIA 1OGZA 1M1XB 2CFLA 1RGHA 2RNTA 2RFRA 3NUVA 4OK0A 1YIT3 2F56A 1OUNA 3KCHA 4BTYA 5G1KA 1MWUA 2QGUA 2O9UX 3MG2A 3MKIA 4EV5A 3LMLA 4ORLA 1A2VA 1BUJA 1L5GB 1W02A 1GD4A 4KFEA 4XBYA 2CH9A 1R3EA 1TJDA 4O2HA 3ER7A 3X3ZA 1IVUA 3H3HA 1O7NB 2EY4A 5IF6A 1OACA 1QJGA 3GSPA 2KXGA 3URPA 1I2GA 2Z7AA 2C4BA 1D6UA 2K0MA 3AHSA 4HM8B 1UUGB 3TDGA 3E99A 1TP6A 2CW9A 2W56A 3KFQC 4HM0B 1VQL3 1RMSA 3FGYA 3U1WA 2CX0A 1A2PA 1QMAA 3F14A 2CHCA 3CMA3 4K90B 4N6NB 4CCVA 1RN1A 1W7CA 1EEJA 2RBIA 1IQYA 5RNTA 3OWYA 1BOXA 1ISKA 1UCLA 4KFDA 5JPUA 3RGRA 3LT8A 3SX1A 3STDA 1DETA 1JV2B 2GBWB 4RNYA 1TTOA 1HZ1A 4NHFA 4FCJA 5LC6A 1RGGA 2XFSA 2AADA 1GMPA 2BMRB 1CYUA 1FA3A 2WOFA 1X1YA 3S5CA 2K54A 4HAAA 2PZVA 2WGQA 4OUQA 2WOHA 2JDIH 3I563 1Z1SA 1Q7HA 1TFKA 1FUTA 3Q90A 4O3VA 4FCMA 2FRXA 1ZL3A 1I0VA 2UUGC 4R80A 1VQO3 2D1WA 1FUSA 3MG3A 1JB5A 4HBRA 4KVHA 1MOLA 3CPOA 4RNTA 1UGHI 1X1UA 2BO9B 1Y4KA 5AI1A 1JBTA 1B21A 2BT3A 4L8PA 1VQ93 2IUKA 1VQQA 3UB1A 1FGRA 3RDEA 2OOVC 2LQVA 1MWRA 3M4XA 3HIIA 3ZG0A 3CME3 1NB3I 2WGOA 3GAXA 1RHLA 4HOHA 3FG4A 3VF1A 5ELJA 1IQXA 1GY5A 3MQKA 3WDGB 1OGXA 2OQEC 1J2BA 3FLJA 3BIRA 5LC7A 2K3DA 4O8SA 4EC6A 1E3VA 3DH2A 4FR9A 3HK4A 3DXOA 1AVKA 1HU9A 1KWIA 1ULJB 2XFTA 1ROVA 4R1KA 5G1LA 1BSBA 1N5HA 5GSPA 3WMDA 3LJCA 1IK3A 1KSIA 3NBRA 2Z6BA 3MPHA 1T5YA 1FYSA 4HZ9B 1BIRA 1W6CA 5KP3A 3N8BA 1W00A 3LT9A 3F9SA 5TGNA 4HVNA 3OXAA 1XNEA 3B4PA 4O02B 3HI7A 3HJWA 1FZUA 1BRIA 2ML6A 3BNDA 1IVVA 5AIHA 3S29A 4CI1B 3UJMA 1VQ73 3X40A 2YFLB 4BTWA 1RRHA 3GRDA 3PYJA 2KAAA 1STDA 1MGWA 1MWTA 1NJI4 2YFJB 1DMNA 1PU4A 5D81A 1OH0A 4CJNA 1SIHA 2KRTA 1IVXA 1EG9B 4X2HA 1LOYA 2AUSA 1FGOA 4TX4A 3SOYA 1AVLA 4HM5B 2J8XB 3NX0A 4LZIA 1GD3A 3QK9A 5JPPA 3JUOA 3C0KA 1GMQA 2HMMB 2E2VA 1AR0A 1CYVA 3DUKA 1V74A 3EQQB 1VQ83 2KF5A 2BMOB 3RGAA 2XGNA 1TRQA 4ZM8A 5CF1A 1RGFA 1BRKA 4U13A 1JB2A 1NO3A 3PCRA 2B24B 3KIIA 1Q814 3Q3FA 3G8ZA 1LXEA 3BU4A 3KSED 5IG4A 2F99A 2STDA 5M18A 1BNJA 4K1UA 2XSOB 3NXJA 3FF0A 1RCLA 2CK3H 2R4IA 1I0XA 3CCM3 2ZL8A 4Q53A 1BNIA 4WHAA 1YVBI 1WMOA 4HKVB 5IEPA 3SLUA 2L1SA 1BRSA 2XSHB 5M19A 1JN5B 1RN4A 5AYRB 5IERA 1TE7A 1UI8A 4K1VA 1Q864 1NU3A 3SEDA 3K9MC 7STDA 3DGOA 3N9HA 3WR2A 1N5PA 1B20A 1RKYA 3LWVA 3AGOA 3B7CA 5AIFA 1B3SA 1AV4A 3M6VA 4CI3B 4HM3B 3ZG5A 3D9RA 1G0TA 1NDOB 1JNQA 3MHEA 3FG1A 3V92A 1IVWA 1X1WA 2CWUA 1SPUA 2F98A 1LVNA 3ZFZA 5A0OB 4MMZB 3LTBA 1AY7A 3LWPA 3LTDA 2F5MA 5KP4A 1RGKA 5AYSC 1BSEA 3V98A 1GS3A 2Z0TA 1RGEA 3JVCA 4HM7B 3NV0B 1BVIA 1GSPA 1G96A 3HAXA 5CF2A 3CC73 1JB4A 3CCS3 1JKGA 1V57A 4R9LA 3SYUA 2CFKA 2GBXB 1ASKA 1V58A 1NWWA 1T2IA 3FG3A 4GB5A 4XDVA 1K8A4 3HJYA 3CC43 2OOVA 2KF6A 1BSDA 3O8YA 4J5GA 2INXA 1IDPA 1WNHA 3HZPA 3WHOA 3MSOA 3CXC2 3B4OA 4IIAA 1HKXA 3LZAA 2CWVA 4JRFA 2P38A 1RLSA 1EA2A 2OQEA 2IUJA 4JF8A 4WP5A 1E97A 4NPBA 4H61A 1BGSA 1JBRA 1LOWA 3LH4A 1IT8A 1DE3A 2E2UA 2LYXA 2ZDJA 2D42A 1UGIA 3ZV0C 1O7WB 1OPYA 1PY3A 3NQYA 5G2GA 3H51A 4LGQA 4HZBB 1UI7A 2H0HA 1N8R4 3I0YA 3JUQA 1OF5B 2AB4A 8CHOA 5AIGA 1R3FA 4TZ4C 3UNLA 1A67A 2SARA 2W03A 3OW22 1GOYA 4RBNA 5CXOA 2CFDA 2Z77A 1DVCA 4N6TA 1IV9A 1IYYA 2XF3A 2CFWA 3DMCA 3CPW2 2HOHA 1A2KA 1YIJ3 1C54A 2FXTA 2RFKA 4R9KA 5IENA 3WA3A 3EE1A 3S28A 4RNZA 2DP9A 2RSXA 3FCSB 3UL5A 1M1K4 2KF3A 5AIIA 4HYZA 1W5ZA 3IUWA 2Z76A 1CEWI 4LSOA 5IW9A 1EUIC 3K5TA 1WMNA 3DGMA 1W2B2 1GY6A 3N54B 1KD14 2JQ5A 1RNBA 1LOXA 1LNIA 3LTAA 1NB5I 4J8TA 2OTL3 1VQK3 3M6WA 3CCE3 1B2MA 2APOA 3NBJA 1SGVA 1ZE2A 1LRAA 1R4CA 2YFIB 3F8XA 4N6LA 3G16A 4XB5A 2PNCA 4EBGA 1FW7A 3A76A 3BNEA 3GWRA 2CX1A 3JUPA 1RNTA 2OTJ3 4OVMA 3EX9A 5FW5A 1Q40B 1DYUA 3WODG 1JZDA 1BNSA 1OHPA 1UCIA 1BNGA 1B2SA 1GOVA 1RCKA 2IYJA 2KCDA 1HYFA 1MNLA 3CCU3 4BL3A 4LYLB 2AS0A 1WMPA 2B1XB 2P0XA 2W2CA 2W9QA 2ZA4A 1RDSA 3FZWA 4HM1B 4HM4B 1W6YA 3SXXA 1R4YA 3DGNA 3NM2A 1I3IA 4GSPA 3LWOA 1ZX2A 2CKFB 2CIUA 1K8WA 2W6JH 4HM2B 1ROAA
chains in the Genus database with same CATH topology
1T5YA 3C0KA 2AB4A 1R3FA 1SQWA 1IQ8A 3VSEA 1SGVA 1ZE2A 2Q07A 1IT7A 1WXXA 1R3EA 2J5VA 2CX1A 1ZS7A 2J5TA 3D79A 2P38A 1WXWA 1J2BA 2AS0A 1IT8A 4Q1TA 1Q7HA 3LDFA 1ZE1A 2B78A 2CWWA 1ZL3A 3UAIA 2CX0A 4DMGA 1K8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T5Y A;  3C0K A;  2AB4 A;  1R3F A;  1SQW A;  1IQ8 A;  3VSE A;  1SGV A;  1ZE2 A;  2Q07 A;  1IT7 A;  1WXX A;  1R3E A;  2J5V A;  2CX1 A;  1ZS7 A;  2J5T A;  3D79 A;  2P38 A;  1WXW A;  1J2B A;  2AS0 A;  1IT8 A;  4Q1T A;  1Q7H A;  3LDF A;  1ZE1 A;  2B78 A;  2CWW A;  1ZL3 A;  3UAI A;  2CX0 A;  4DMG A;  1K8W A; 
#chains in the Genus database with same CATH topology
 3X41 A;  1O7M B;  3M6U A;  1LQM B;  1BSC A;  3LYG A;  3X3X A;  1K28 A;  4XBT A;  3VSE A;  3FH1 A;  2Q07 A;  1IT7 A;  3LWR A;  3S67 A;  4L7K A;  3HX8 A;  3ROB A;  1UDI I;  1YGW A;  3FSD A;  2BU4 A;  4AKY A;  1ZS7 A;  1T2H A;  4H3U A;  3EC9 A;  2SBL A;  3J7Y d;  3RNT A;  2J5T A;  3M65 A;  4WFO A;  4CDL A;  1QAF A;  1UCK A;  2F5W A;  2F86 B;  1TUH A;  1GY7 A;  2GSP A;  2HMN B;  2MF7 A;  3PGB A;  1TRP A;  2IMJ A;  1I8V A;  4HJL B;  1Q40 A;  1SII A;  1E3R A;  1GMR A;  2O3O A;  3M8C A;  3AGN A;  3K63 A;  2HMO B;  5JBS A;  1BRJ A;  4LMI A;  1W2Z A;  2B78 A;  3UAI A;  3F7S A;  3DM8 A;  3T8U A;  1M90 4;  1I70 A;  3G6E 3;  5EQL A;  1B2Z A;  4KZ1 A;  3S27 A;  2GU3 A;  1W01 A;  2OCT A;  1FUW A;  4EV2 A;  3I55 3;  4R4K A;  4MEI A;  1IQ8 A;  1GOU A;  3ECF A;  4PEJ A;  7RNT A;  2V1L A;  3F40 A;  5DRV A;  5IG3 A;  5FGO A;  3Q1C A;  2KF4 A;  2FGT A;  2E5O A;  2W56 B;  1U8C B;  2QIY A;  2CFG A;  2GU1 A;  2W9P A;  3PS8 A;  4XBX A;  1O7P B;  3EJV A;  1KC8 4;  3D79 A;  3D5I A;  2WO0 A;  3IPT A;  3KKG A;  1VQ5 3;  4BTX A;  4EW5 A;  1B27 A;  1ZGX A;  2QEX 3;  1G02 A;  2BHM A;  1RN7 A;  4KT3 B;  4NRE A;  4X2O A;  1AQZ A;  1YNV X;  4IT7 A;  3ALA A;  1JRQ A;  1BNF A;  4N6U A;  3F7X A;  5M1A A;  2XGL A;  1D6Y A;  2F4Y A;  4BIR A;  3CNX A;  3T8N A;  4EYC A;  3B8L A;  1TFO A;  3LXU X;  1JN5 A;  3Q2P A;  7GSP A;  2HMK B;  1W6G A;  3AHW A;  3HOH A;  3KZT A;  1OHS A;  4WWU C;  1WXX A;  5EVH A;  2RGQ A;  2Y74 A;  4RZM A;  5DRE A;  2BIR A;  2Y73 A;  3BB9 A;  1O7H B;  2MC8 A;  4BL2 A;  4MJD A;  3DZL A;  2CG1 A;  2CWT A;  2ZHX B;  3K0Z A;  1YGE A;  3LTC A;  5ELU A;  5IG5 A;  1EQK A;  5HGR A;  5BXQ A;  1ZBO A;  1YJW 3;  2GEX A;  1NNV A;  4J5K A;  2YX9 A;  3KSP A;  1VZZ A;  2FNQ A;  3JUM A;  4STD A;  4EXR A;  4FMD A;  3EN8 A;  1GYB A;  2IA7 A;  3CU3 A;  2I9W A;  1JJ2 2;  1BRN L;  3CCL 3;  1ZO2 A;  1DVD A;  4MMX B;  1BAO A;  1LOV A;  2XEP A;  3GZX B;  1LQG C;  3NV0 A;  1YJN 3;  3DGY A;  1SQW A;  1UOY A;  1WK2 A;  3A5E A;  2W0Q A;  1QAK A;  1RTU A;  4WYK B;  1B2U A;  1I3F A;  1IU7 A;  4L8O A;  1SAR A;  3SOA A;  1S72 3;  5EEO A;  3EBT A;  4GHO A;  2CC3 A;  1U5O A;  4FCZ A;  1BNE A;  3CCQ 3;  1C7H A;  4I4K A;  1KQS 2;  1UW1 A;  1CH0 A;  4K61 A;  1K9M 4;  1IV7 A;  1LNH A;  4AEQ A;  5AEU B;  5I97 A;  2QA4 3;  3AMO B;  1VQM 3;  1D6Z A;  1JBS A;  1VQ4 3;  3D4A A;  3NM7 A;  2KKU A;  1I2F A;  1RGL A;  3VGN A;  4MMY B;  3CCJ 3;  2CWW A;  3DY5 A;  2H0I A;  2HML B;  4DMG A;  4CI2 B;  3EF8 A;  3MYT A;  2BNG A;  5BU4 A;  3G4S 3;  1K41 A;  3BNB A;  1UUW B;  1K73 4;  5STD A;  1T3B A;  2C11 A;  3G71 3;  1W4N A;  6GSP A;  4GL6 A;  2UGI A;  3CC2 3;  3NHX A;  1FGQ A;  2OWP A;  3D5G A;  3MWZ A;  1JZO A;  3CD6 3;  9RNT A;  2R41 A;  2BMQ B;  2CG0 A;  4XM4 A;  3M6X A;  1OF5 A;  2XH9 A;  4IPB A;  4N6O B;  3G0K A;  3CNM A;  1FGT A;  3SVA A;  5D83 A;  8RNT A;  4WYK A;  1WTH A;  1EKM A;  2P05 A;  1BRH A;  2XR8 B;  3K7C A;  3OWU A;  3PXM A;  2H0G A;  1DMQ A;  4FMC A;  5CK6 A;  4HM6 B;  1WXW A;  1FGM A;  1RJO A;  2HMJ B;  1TU5 A;  1RGC A;  3BLZ A;  3T0U A;  3CCR 3;  1UCJ A;  2UX0 A;  1CQS A;  3KN4 A;  3X3Y A;  3GZR A;  4Q1T A;  2L4V A;  3MG1 A;  3PZW A;  3EBY A;  1ZE1 A;  2P09 A;  2P0M A;  3AMO A;  1ULI B;  3L0R A;  1BRG A;  3GZB A;  1OHO A;  3HIG A;  4KFF A;  3GZY B;  3V99 A;  3IJE B;  1N9J A;  1YVS A;  1F8N A;  1TIJ A;  3OWS A;  4G1M B;  4J9A A;  3WA2 X;  1X1X A;  1BNR A;  5HOH A;  1SJW A;  1A90 A;  4FMA A;  3EB8 A;  2J5V A;  2GXF A;  1US1 A;  1QVG 2;  3EN1 B;  4CPK A;  4LEH A;  1YHQ 3;  1STF I;  4N3V A;  5IG0 A;  1O7G B;  1Q42 A;  4I5Q A;  2C10 A;  3NBB A;  3IMA B;  5BVB A;  1M9G A;  1I2E A;  2XRX B;  5D82 A;  3KE7 A;  1BUQ A;  1BU4 A;  1BSA A;  1VQP 3;  3LWQ A;  3LDF A;  1RSN A;  2AAE A;  4FMB A;  4AKZ A;  2IY2 A;  3OX9 A;  1UUV B;  2ML5 A;  3U97 A;  1QVF 2;  1MWS A;  1RRL A;  3DGL A;  3JUN A;  3NQZ A;  4XDW A;  3OV4 A;  1S5A A;  3WOF B;  1PYL A;  3D3L A;  3VSY A;  3FF2 A;  4N6V 0;  1PFP A;  1Q7Y 4;  1YI2 3;  2GEY A;  1VQ6 3;  1VQN 3;  1RGA A;  4QWT A;  1S04 A;  2ANE A;  1B2X A;  3QRD A;  3LOY A;  2HVY A;  3WOE B;  5AEW B;  1Q82 4;  3BNC A;  4N6M A;  2M7O A;  1N8Q A;  2A15 A;  1BAN A;  4BU4 A;  1N9E A;  1WQL B;  1DMM A;  3EHC A;  1QAL A;  3F8H A;  3X42 A;  5IEO A;  3FKA A;  6RNT A;  2W04 A;  1MGR A;  3PCS A;  3U28 A;  2E2T A;  6STD A;  5KP1 A;  1JKG B;  1OCV A;  1YJ9 3;  5CLK A;  1Q9E A;  4ILF A;  2RCD A;  5BIR A;  3CCV 3;  3UL6 A;  4DKI A;  1OGZ A;  1M1X B;  2CFL A;  1RGH A;  2RNT A;  2RFR A;  3NUV A;  4OK0 A;  1YIT 3;  2F56 A;  1OUN A;  3KCH A;  4BTY A;  5G1K A;  1MWU A;  2QGU A;  2O9U X;  3MG2 A;  3MKI A;  4EV5 A;  3LML A;  4ORL A;  1A2V A;  1BUJ A;  1L5G B;  1W02 A;  1GD4 A;  4KFE A;  4XBY A;  2CH9 A;  1R3E A;  1TJD A;  4O2H A;  3ER7 A;  3X3Z A;  1IVU A;  3H3H A;  1O7N B;  2EY4 A;  5IF6 A;  1OAC A;  1QJG A;  3GSP A;  2KXG A;  3URP A;  1I2G A;  2Z7A A;  2C4B A;  1D6U A;  2K0M A;  3AHS A;  4HM8 B;  1UUG B;  3TDG A;  3E99 A;  1TP6 A;  2CW9 A;  2W56 A;  3KFQ C;  4HM0 B;  1VQL 3;  1RMS A;  3FGY A;  3U1W A;  2CX0 A;  1A2P A;  1QMA A;  3F14 A;  2CHC A;  3CMA 3;  4K90 B;  4N6N B;  4CCV A;  1RN1 A;  1W7C A;  1EEJ A;  2RBI A;  1IQY A;  5RNT A;  3OWY A;  1BOX A;  1ISK A;  1UCL A;  4KFD A;  5JPU A;  3RGR A;  3LT8 A;  3SX1 A;  3STD A;  1DET A;  1JV2 B;  2GBW B;  4RNY A;  1TTO A;  1HZ1 A;  4NHF A;  4FCJ A;  5LC6 A;  1RGG A;  2XFS A;  2AAD A;  1GMP A;  2BMR B;  1CYU A;  1FA3 A;  2WOF A;  1X1Y A;  3S5C A;  2K54 A;  4HAA A;  2PZV A;  2WGQ A;  4OUQ A;  2WOH A;  2JDI H;  3I56 3;  1Z1S A;  1Q7H A;  1TFK A;  1FUT A;  3Q90 A;  4O3V A;  4FCM A;  2FRX A;  1ZL3 A;  1I0V A;  2UUG C;  4R80 A;  1VQO 3;  2D1W A;  1FUS A;  3MG3 A;  1JB5 A;  4HBR A;  4KVH A;  1MOL A;  3CPO A;  4RNT A;  1UGH I;  1X1U A;  2BO9 B;  1Y4K A;  5AI1 A;  1JBT A;  1B21 A;  2BT3 A;  4L8P A;  1VQ9 3;  2IUK A;  1VQQ A;  3UB1 A;  1FGR A;  3RDE A;  2OOV C;  2LQV A;  1MWR A;  3M4X A;  3HII A;  3ZG0 A;  3CME 3;  1NB3 I;  2WGO A;  3GAX A;  1RHL A;  4HOH A;  3FG4 A;  3VF1 A;  5ELJ A;  1IQX A;  1GY5 A;  3MQK A;  3WDG B;  1OGX A;  2OQE C;  1J2B A;  3FLJ A;  3BIR A;  5LC7 A;  2K3D A;  4O8S A;  4EC6 A;  1E3V A;  3DH2 A;  4FR9 A;  3HK4 A;  3DXO A;  1AVK A;  1HU9 A;  1KWI A;  1ULJ B;  2XFT A;  1ROV A;  4R1K A;  5G1L A;  1BSB A;  1N5H A;  5GSP A;  3WMD A;  3LJC A;  1IK3 A;  1KSI A;  3NBR A;  2Z6B A;  3MPH A;  1T5Y A;  1FYS A;  4HZ9 B;  1BIR A;  1W6C A;  5KP3 A;  3N8B A;  1W00 A;  3LT9 A;  3F9S A;  5TGN A;  4HVN A;  3OXA A;  1XNE A;  3B4P A;  4O02 B;  3HI7 A;  3HJW A;  1FZU A;  1BRI A;  2ML6 A;  3BND A;  1IVV A;  5AIH A;  3S29 A;  4CI1 B;  3UJM A;  1VQ7 3;  3X40 A;  2YFL B;  4BTW A;  1RRH A;  3GRD A;  3PYJ A;  2KAA A;  1STD A;  1MGW A;  1MWT A;  1NJI 4;  2YFJ B;  1DMN A;  1PU4 A;  5D81 A;  1OH0 A;  4CJN A;  1SIH A;  2KRT A;  1IVX A;  1EG9 B;  4X2H A;  1LOY A;  2AUS A;  1FGO A;  4TX4 A;  3SOY A;  1AVL A;  4HM5 B;  2J8X B;  3NX0 A;  4LZI A;  1GD3 A;  3QK9 A;  5JPP A;  3JUO A;  3C0K A;  1GMQ A;  2HMM B;  2E2V A;  1AR0 A;  1CYV A;  3DUK A;  1V74 A;  3EQQ B;  1VQ8 3;  2KF5 A;  2BMO B;  3RGA A;  2XGN A;  1TRQ A;  4ZM8 A;  5CF1 A;  1RGF A;  1BRK A;  4U13 A;  1JB2 A;  1NO3 A;  3PCR A;  2B24 B;  3KII A;  1Q81 4;  3Q3F A;  3G8Z A;  1LXE A;  3BU4 A;  3KSE D;  5IG4 A;  2F99 A;  2STD A;  5M18 A;  1BNJ A;  4K1U A;  2XSO B;  3NXJ A;  3FF0 A;  1RCL A;  2CK3 H;  2R4I A;  1I0X A;  3CCM 3;  2ZL8 A;  4Q53 A;  1BNI A;  4WHA A;  1YVB I;  1WMO A;  4HKV B;  5IEP A;  3SLU A;  2L1S A;  1BRS A;  2XSH B;  5M19 A;  1JN5 B;  1RN4 A;  5AYR B;  5IER A;  1TE7 A;  1UI8 A;  4K1V A;  1Q86 4;  1NU3 A;  3SED A;  3K9M C;  7STD A;  3DGO A;  3N9H A;  3WR2 A;  1N5P A;  1B20 A;  1RKY A;  3LWV A;  3AGO A;  3B7C A;  5AIF A;  1B3S A;  1AV4 A;  3M6V A;  4CI3 B;  4HM3 B;  3ZG5 A;  3D9R A;  1G0T A;  1NDO B;  1JNQ A;  3MHE A;  3FG1 A;  3V92 A;  1IVW A;  1X1W A;  2CWU A;  1SPU A;  2F98 A;  1LVN A;  3ZFZ A;  5A0O B;  4MMZ B;  3LTB A;  1AY7 A;  3LWP A;  3LTD A;  2F5M A;  5KP4 A;  1RGK A;  5AYS C;  1BSE A;  3V98 A;  1GS3 A;  2Z0T A;  1RGE A;  3JVC A;  4HM7 B;  3NV0 B;  1BVI A;  1GSP A;  1G96 A;  3HAX A;  5CF2 A;  3CC7 3;  1JB4 A;  3CCS 3;  1JKG A;  1V57 A;  4R9L A;  3SYU A;  2CFK A;  2GBX B;  1ASK A;  1V58 A;  1NWW A;  1T2I A;  3FG3 A;  4GB5 A;  4XDV A;  1K8A 4;  3HJY A;  3CC4 3;  2OOV A;  2KF6 A;  1BSD A;  3O8Y A;  4J5G A;  2INX A;  1IDP A;  1WNH A;  3HZP A;  3WHO A;  3MSO A;  3CXC 2;  3B4O A;  4IIA A;  1HKX A;  3LZA A;  2CWV A;  4JRF A;  2P38 A;  1RLS A;  1EA2 A;  2OQE A;  2IUJ A;  4JF8 A;  4WP5 A;  1E97 A;  4NPB A;  4H61 A;  1BGS A;  1JBR A;  1LOW A;  3LH4 A;  1IT8 A;  1DE3 A;  2E2U A;  2LYX A;  2ZDJ A;  2D42 A;  1UGI A;  3ZV0 C;  1O7W B;  1OPY A;  1PY3 A;  3NQY A;  5G2G A;  3H51 A;  4LGQ A;  4HZB B;  1UI7 A;  2H0H A;  1N8R 4;  3I0Y A;  3JUQ A;  1OF5 B;  2AB4 A;  8CHO A;  5AIG A;  1R3F A;  4TZ4 C;  3UNL A;  1A67 A;  2SAR A;  2W03 A;  3OW2 2;  1GOY A;  4RBN A;  5CXO A;  2CFD A;  2Z77 A;  1DVC A;  4N6T A;  1IV9 A;  1IYY A;  2XF3 A;  2CFW A;  3DMC A;  3CPW 2;  2HOH A;  1A2K A;  1YIJ 3;  1C54 A;  2FXT A;  2RFK A;  4R9K A;  5IEN A;  3WA3 A;  3EE1 A;  3S28 A;  4RNZ A;  2DP9 A;  2RSX A;  3FCS B;  3UL5 A;  1M1K 4;  2KF3 A;  5AII A;  4HYZ A;  1W5Z A;  3IUW A;  2Z76 A;  1CEW I;  4LSO A;  5IW9 A;  1EUI C;  3K5T A;  1WMN A;  3DGM A;  1W2B 2;  1GY6 A;  3N54 B;  1KD1 4;  2JQ5 A;  1RNB A;  1LOX A;  1LNI A;  3LTA A;  1NB5 I;  4J8T A;  2OTL 3;  1VQK 3;  3M6W A;  3CCE 3;  1B2M A;  2APO A;  3NBJ A;  1SGV A;  1ZE2 A;  1LRA A;  1R4C A;  2YFI B;  3F8X A;  4N6L A;  3G16 A;  4XB5 A;  2PNC A;  4EBG A;  1FW7 A;  3A76 A;  3BNE A;  3GWR A;  2CX1 A;  3JUP A;  1RNT A;  2OTJ 3;  4OVM A;  3EX9 A;  5FW5 A;  1Q40 B;  1DYU A;  3WOD G;  1JZD A;  1BNS A;  1OHP A;  1UCI A;  1BNG A;  1B2S A;  1GOV A;  1RCK A;  2IYJ A;  2KCD A;  1HYF A;  1MNL A;  3CCU 3;  4BL3 A;  4LYL B;  2AS0 A;  1WMP A;  2B1X B;  2P0X A;  2W2C A;  2W9Q A;  2ZA4 A;  1RDS A;  3FZW A;  4HM1 B;  4HM4 B;  1W6Y A;  3SXX A;  1R4Y A;  3DGN A;  3NM2 A;  1I3I A;  4GSP A;  3LWO A;  1ZX2 A;  2CKF B;  2CIU A;  1K8W A;  2W6J H;  4HM2 B;  1ROA A; 
#chains in the Genus database with same CATH homology
 1T5Y A;  3C0K A;  2AB4 A;  1R3F A;  1SQW A;  1IQ8 A;  3VSE A;  1SGV A;  1ZE2 A;  2Q07 A;  1IT7 A;  1WXX A;  1R3E A;  2J5V A;  2CX1 A;  1ZS7 A;  2J5T A;  3D79 A;  2P38 A;  1WXW A;  1J2B A;  2AS0 A;  1IT8 A;  4Q1T A;  1Q7H A;  3LDF A;  1ZE1 A;  2B78 A;  2CWW A;  1ZL3 A;  3UAI A;  2CX0 A;  4DMG A;  1K8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...