2HVYA

Crystal structure of an h/aca box rnp from pyrococcus furiosus
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
327
structure length
320
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/biosynthetic protein/rna
molecule keywords H/ACA RNA
publication title Crystal structure of an H/ACA box ribonucleoprotein particle
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 90
structure length 320
sequence length 327
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 2hvyA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 2hvyA02
3LWRA 4LABA 4LGTA 2ISTA 3U28A 1R3EA 1ZE1A 1QYUA 3LWPA 3LWVA 3LWOA 3HJWA 2APOA 3ZV0C 1V9FA 2EY4A 1KSVA 1R3FA 2I82A 1ZL3A 3UAIA 3DH3A 2HVYA 2AB4A 1KSKA 3MQKA 3LWQA 1SGVA 2RFKA 3HAXA 2AUSA 1XPIA 3HJYA 1K8WA 1PRZA 1KSLA 1V9KA 1ZE2A
chains in the Genus database with same CATH superfamily
3LWVA 3LWOA 2CWWA 3IUWA 4TZ4C 2I82A 1IT8A 1KSKA 1UOYA 1J2BA 2DP9A 2Q07A 1TE7A 1WXXA 1ZE2A 3LWRA 4LGTA 3U28A 3M6VA 2J5TA 1ZE1A 2Z0TA 3HJWA 3M65A 4Q1TA 2EY4A 3M6XA 2J5VA 1IT7A 3DH3A 1WXWA 2AB4A 3MQKA 3D79A 2P38A 3LWQA 2AUSA 3HAXA 1PRZA 4DMGA 4LABA 1S04A 1T5YA 2CX1A 3LWPA 4CI2B 2APOA 2FRXA 1KSVA 3UAIA 1IQ8A 2HVYA 3M6UA 2KKUA 2RFKA 2ANEA 1Z2ZA 1SQWA 2E5OA 1K8WA 3HJYA 2CX0A 2B78A 1ZBOA 3VSEA 1V9KA 2AS0A 1SZWA 2ISTA 1R3EA 1SB7A 3LDFA 1QYUA 4CI1B 1Q7HA 1ZS7A 4CI3B 3ZV0C 3LJCA 1V9FA 1R3FA 1WK2A 3M6WA 1ZL3A 3C0KA 1SI7A 1SGVA 3M4XA 1XPIA 1XNEA 1KSLA
chains in the Genus database with same CATH topology
3LWRA 4LABA 4LGTA 1SZWA 2ISTA 3U28A 1R3EA 3M6VA 1SB7A 1ZE1A 1QYUA 3LWPA 3LWVA 3LWOA 3HJWA 2APOA 2FRXA 3ZV0C 1V9FA 2EY4A 1KSVA 1R3FA 3M6XA 2I82A 3M6WA 1ZL3A 3UAIA 3DH3A 2HVYA 2AB4A 1KSKA 3MQKA 3M6UA 1SI7A 1UOYA 3LWQA 1SGVA 2RFKA 3M4XA 2AUSA 3HAXA 1Z2ZA 1XPIA 3HJYA 1K8WA 1PRZA 1KSLA 1V9KA 1ZE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWR A;  4LAB A;  4LGT A;  2IST A;  3U28 A;  1R3E A;  1ZE1 A;  1QYU A;  3LWP A;  3LWV A;  3LWO A;  3HJW A;  2APO A;  3ZV0 C;  1V9F A;  2EY4 A;  1KSV A;  1R3F A;  2I82 A;  1ZL3 A;  3UAI A;  3DH3 A;  2HVY A;  2AB4 A;  1KSK A;  3MQK A;  3LWQ A;  1SGV A;  2RFK A;  3HAX A;  2AUS A;  1XPI A;  3HJY A;  1K8W A;  1PRZ A;  1KSL A;  1V9K A;  1ZE2 A; 
#chains in the Genus database with same CATH topology
 3LWV A;  3LWO A;  2CWW A;  3IUW A;  4TZ4 C;  2I82 A;  1IT8 A;  1KSK A;  1UOY A;  1J2B A;  2DP9 A;  2Q07 A;  1TE7 A;  1WXX A;  1ZE2 A;  3LWR A;  4LGT A;  3U28 A;  3M6V A;  2J5T A;  1ZE1 A;  2Z0T A;  3HJW A;  3M65 A;  4Q1T A;  2EY4 A;  3M6X A;  2J5V A;  1IT7 A;  3DH3 A;  1WXW A;  2AB4 A;  3MQK A;  3D79 A;  2P38 A;  3LWQ A;  2AUS A;  3HAX A;  1PRZ A;  4DMG A;  4LAB A;  1S04 A;  1T5Y A;  2CX1 A;  3LWP A;  4CI2 B;  2APO A;  2FRX A;  1KSV A;  3UAI A;  1IQ8 A;  2HVY A;  3M6U A;  2KKU A;  2RFK A;  2ANE A;  1Z2Z A;  1SQW A;  2E5O A;  1K8W A;  3HJY A;  2CX0 A;  2B78 A;  1ZBO A;  3VSE A;  1V9K A;  2AS0 A;  1SZW A;  2IST A;  1R3E A;  1SB7 A;  3LDF A;  1QYU A;  4CI1 B;  1Q7H A;  1ZS7 A;  4CI3 B;  3ZV0 C;  3LJC A;  1V9F A;  1R3F A;  1WK2 A;  3M6W A;  1ZL3 A;  3C0K A;  1SI7 A;  1SGV A;  3M4X A;  1XPI A;  1XNE A;  1KSL A; 
#chains in the Genus database with same CATH homology
 3LWR A;  4LAB A;  4LGT A;  1SZW A;  2IST A;  3U28 A;  1R3E A;  3M6V A;  1SB7 A;  1ZE1 A;  1QYU A;  3LWP A;  3LWV A;  3LWO A;  3HJW A;  2APO A;  2FRX A;  3ZV0 C;  1V9F A;  2EY4 A;  1KSV A;  1R3F A;  3M6X A;  2I82 A;  3M6W A;  1ZL3 A;  3UAI A;  3DH3 A;  2HVY A;  2AB4 A;  1KSK A;  3MQK A;  3M6U A;  1SI7 A;  1UOY A;  3LWQ A;  1SGV A;  2RFK A;  3M4X A;  2AUS A;  3HAX A;  1Z2Z A;  1XPI A;  3HJY A;  1K8W A;  1PRZ A;  1KSL A;  1V9K A;  1ZE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...