3MQKA

Cbf5-nop10-gar1 complex binding with 17mer rna containing aca trinucleotide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
328
structure length
328
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA pseudouridine synthase B
publication title Structural and functional evidence of high specificity of Cbf5 for ACA trinucleotide.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 86
structure length 328
sequence length 328
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3mqkA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3mqkA02
1V9FA 1KSLA 3LWVA 1KSVA 1XPIA 3LWOA 1SGVA 3LWPA 1R3EA 2AUSA 3HJWA 3LWQA 3DH3A 2ISTA 1KSKA 3ZV0C 1V9KA 3UAIA 1PRZA 1R3FA 2APOA 3HJYA 1QYUA 3MQKA 3LWRA 3U28A 4LGTA 2HVYA 1ZL3A 2EY4A 2I82A 4LABA 1ZE2A 2RFKA 2AB4A 1K8WA 3HAXA 1ZE1A
chains in the Genus database with same CATH superfamily
1WXXA 1SGVA 3LWPA 1R3EA 1Q7HA 4CI2B 1SZWA 4CI1B 3ZV0C 3UAIA 3M6UA 1ZBOA 1QYUA 3MQKA 1T5YA 1ZE2A 1WXWA 1IT8A 1ZE1A 4CI3B 3M4XA 1KSLA 1J2BA 1XPIA 1UOYA 2B78A 2FRXA 1XNEA 2AUSA 2Q07A 1ZS7A 3LWQA 2CWWA 1Z2ZA 1ZL3A 2EY4A 1K8WA 1IT7A 1S04A 2KKUA 1KSVA 3LWVA 2CX1A 3LWOA 4Q1TA 4TZ4C 3D79A 3HJWA 1SI7A 3M6WA 1KSKA 2J5TA 3M65A 1V9KA 2CX0A 2APOA 3HJYA 2E5OA 1WK2A 3LWRA 3C0KA 2HVYA 4LGTA 2I82A 3M6XA 2RFKA 2ANEA 2AB4A 1TE7A 3HAXA 4DMGA 3VSEA 1V9FA 1SQWA 2DP9A 3LDFA 3IUWA 2Z0TA 3LJCA 2AS0A 3DH3A 2ISTA 1PRZA 1SB7A 1R3FA 3M6VA 3U28A 4LABA 1IQ8A 2P38A 2J5VA
chains in the Genus database with same CATH topology
1V9FA 1KSLA 3LWVA 1KSVA 1UOYA 1XPIA 3LWOA 1SGVA 2FRXA 3LWPA 1R3EA 2AUSA 3HJWA 1SI7A 1SZWA 3M6WA 3LWQA 3DH3A 2ISTA 1KSKA 3ZV0C 1V9KA 3UAIA 1PRZA 3M6UA 1SB7A 1R3FA 2APOA 3M6VA 3HJYA 1QYUA 3MQKA 3LWRA 1Z2ZA 3U28A 4LGTA 2HVYA 1ZL3A 2EY4A 2I82A 4LABA 3M6XA 1ZE2A 2RFKA 2AB4A 1K8WA 3HAXA 1ZE1A 3M4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9F A;  1KSL A;  3LWV A;  1KSV A;  1XPI A;  3LWO A;  1SGV A;  3LWP A;  1R3E A;  2AUS A;  3HJW A;  3LWQ A;  3DH3 A;  2IST A;  1KSK A;  3ZV0 C;  1V9K A;  3UAI A;  1PRZ A;  1R3F A;  2APO A;  3HJY A;  1QYU A;  3MQK A;  3LWR A;  3U28 A;  4LGT A;  2HVY A;  1ZL3 A;  2EY4 A;  2I82 A;  4LAB A;  1ZE2 A;  2RFK A;  2AB4 A;  1K8W A;  3HAX A;  1ZE1 A; 
#chains in the Genus database with same CATH topology
 1WXX A;  1SGV A;  3LWP A;  1R3E A;  1Q7H A;  4CI2 B;  1SZW A;  4CI1 B;  3ZV0 C;  3UAI A;  3M6U A;  1ZBO A;  1QYU A;  3MQK A;  1T5Y A;  1ZE2 A;  1WXW A;  1IT8 A;  1ZE1 A;  4CI3 B;  3M4X A;  1KSL A;  1J2B A;  1XPI A;  1UOY A;  2B78 A;  2FRX A;  1XNE A;  2AUS A;  2Q07 A;  1ZS7 A;  3LWQ A;  2CWW A;  1Z2Z A;  1ZL3 A;  2EY4 A;  1K8W A;  1IT7 A;  1S04 A;  2KKU A;  1KSV A;  3LWV A;  2CX1 A;  3LWO A;  4Q1T A;  4TZ4 C;  3D79 A;  3HJW A;  1SI7 A;  3M6W A;  1KSK A;  2J5T A;  3M65 A;  1V9K A;  2CX0 A;  2APO A;  3HJY A;  2E5O A;  1WK2 A;  3LWR A;  3C0K A;  2HVY A;  4LGT A;  2I82 A;  3M6X A;  2RFK A;  2ANE A;  2AB4 A;  1TE7 A;  3HAX A;  4DMG A;  3VSE A;  1V9F A;  1SQW A;  2DP9 A;  3LDF A;  3IUW A;  2Z0T A;  3LJC A;  2AS0 A;  3DH3 A;  2IST A;  1PRZ A;  1SB7 A;  1R3F A;  3M6V A;  3U28 A;  4LAB A;  1IQ8 A;  2P38 A;  2J5V A; 
#chains in the Genus database with same CATH homology
 1V9F A;  1KSL A;  3LWV A;  1KSV A;  1UOY A;  1XPI A;  3LWO A;  1SGV A;  2FRX A;  3LWP A;  1R3E A;  2AUS A;  3HJW A;  1SI7 A;  1SZW A;  3M6W A;  3LWQ A;  3DH3 A;  2IST A;  1KSK A;  3ZV0 C;  1V9K A;  3UAI A;  1PRZ A;  3M6U A;  1SB7 A;  1R3F A;  2APO A;  3M6V A;  3HJY A;  1QYU A;  3MQK A;  3LWR A;  1Z2Z A;  3U28 A;  4LGT A;  2HVY A;  1ZL3 A;  2EY4 A;  2I82 A;  4LAB A;  3M6X A;  1ZE2 A;  2RFK A;  2AB4 A;  1K8W A;  3HAX A;  1ZE1 A;  3M4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...