3MQKA

Cbf5-nop10-gar1 complex binding with 17mer rna containing aca trinucleotide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
328
structure length
328
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/rna binding protein/rna
molecule keywords tRNA pseudouridine synthase B
publication title Structural and functional evidence of high specificity of Cbf5 for ACA trinucleotide.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 86
structure length 328
sequence length 328
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3mqkA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3mqkA02
4LABA 3LWVA 2RFKA 3MQKA 1QYUA 3LWQA 4LGTA 1R3FA 1V9FA 3U28A 1ZL3A 1XPIA 3HJWA 3LWPA 1V9KA 3UAIA 3HJYA 3LWOA 1ZE1A 2I82A 2AUSA 3LWRA 2ISTA 1KSVA 3HAXA 3ZV0C 1K8WA 2HVYA 3DH3A 1ZE2A 1KSKA 1SGVA 2AB4A 1PRZA 2EY4A 1R3EA 1KSLA 2APOA
chains in the Genus database with same CATH superfamily
1T5YA 2CX0A 4LABA 3MQKA 1ZL3A 1UOYA 3HJYA 3HAXA 3LJCA 1KSKA 2E5OA 1WXWA 3LWVA 2RFKA 2ANEA 3M6VA 1R3FA 1V9FA 1WK2A 4CI2B 1XPIA 2CX1A 1IT8A 1Q7HA 4CI1B 3LDFA 1ZE1A 2AUSA 3M6UA 1KSVA 1S04A 1K8WA 4Q1TA 1ZE2A 1SB7A 3C0KA 3D79A 1KSLA 2ISTA 2APOA 1SGVA 3IUWA 3M6WA 1WXXA 2KKUA 3LWQA 2Q07A 1SI7A 3U28A 2J5VA 1SQWA 3HJWA 3LWPA 1V9KA 1IQ8A 3M65A 3UAIA 1TE7A 1SZWA 2I82A 3M4XA 1J2BA 3LWRA 1IT7A 3ZV0C 2HVYA 3DH3A 2DP9A 3VSEA 2AB4A 2AS0A 1XNEA 2EY4A 4DMGA 4CI3B 1ZBOA 2Z0TA 2CWWA 4TZ4C 1QYUA 4LGTA 2B78A 3LWOA 1ZS7A 2J5TA 3M6XA 1PRZA 1Z2ZA 2FRXA 2P38A 1R3EA
chains in the Genus database with same CATH topology
3M6WA 4LABA 3LWVA 2RFKA 3MQKA 1QYUA 3M6VA 3LWQA 4LGTA 1R3FA 1SI7A 1V9FA 3U28A 1ZL3A 1XPIA 3HJWA 1UOYA 3LWPA 1V9KA 3UAIA 3HJYA 1SZWA 3LWOA 1ZE1A 2I82A 2AUSA 3M4XA 3LWRA 2ISTA 3M6UA 1KSVA 3HAXA 3ZV0C 1K8WA 2HVYA 3DH3A 1ZE2A 1KSKA 1SGVA 1SB7A 2AB4A 3M6XA 1PRZA 1Z2ZA 2EY4A 2FRXA 1R3EA 1KSLA 2APOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAB A;  3LWV A;  2RFK A;  3MQK A;  1QYU A;  3LWQ A;  4LGT A;  1R3F A;  1V9F A;  3U28 A;  1ZL3 A;  1XPI A;  3HJW A;  3LWP A;  1V9K A;  3UAI A;  3HJY A;  3LWO A;  1ZE1 A;  2I82 A;  2AUS A;  3LWR A;  2IST A;  1KSV A;  3HAX A;  3ZV0 C;  1K8W A;  2HVY A;  3DH3 A;  1ZE2 A;  1KSK A;  1SGV A;  2AB4 A;  1PRZ A;  2EY4 A;  1R3E A;  1KSL A;  2APO A; 
#chains in the Genus database with same CATH topology
 1T5Y A;  2CX0 A;  4LAB A;  3MQK A;  1ZL3 A;  1UOY A;  3HJY A;  3HAX A;  3LJC A;  1KSK A;  2E5O A;  1WXW A;  3LWV A;  2RFK A;  2ANE A;  3M6V A;  1R3F A;  1V9F A;  1WK2 A;  4CI2 B;  1XPI A;  2CX1 A;  1IT8 A;  1Q7H A;  4CI1 B;  3LDF A;  1ZE1 A;  2AUS A;  3M6U A;  1KSV A;  1S04 A;  1K8W A;  4Q1T A;  1ZE2 A;  1SB7 A;  3C0K A;  3D79 A;  1KSL A;  2IST A;  2APO A;  1SGV A;  3IUW A;  3M6W A;  1WXX A;  2KKU A;  3LWQ A;  2Q07 A;  1SI7 A;  3U28 A;  2J5V A;  1SQW A;  3HJW A;  3LWP A;  1V9K A;  1IQ8 A;  3M65 A;  3UAI A;  1TE7 A;  1SZW A;  2I82 A;  3M4X A;  1J2B A;  3LWR A;  1IT7 A;  3ZV0 C;  2HVY A;  3DH3 A;  2DP9 A;  3VSE A;  2AB4 A;  2AS0 A;  1XNE A;  2EY4 A;  4DMG A;  4CI3 B;  1ZBO A;  2Z0T A;  2CWW A;  4TZ4 C;  1QYU A;  4LGT A;  2B78 A;  3LWO A;  1ZS7 A;  2J5T A;  3M6X A;  1PRZ A;  1Z2Z A;  2FRX A;  2P38 A;  1R3E A; 
#chains in the Genus database with same CATH homology
 3M6W A;  4LAB A;  3LWV A;  2RFK A;  3MQK A;  1QYU A;  3M6V A;  3LWQ A;  4LGT A;  1R3F A;  1SI7 A;  1V9F A;  3U28 A;  1ZL3 A;  1XPI A;  3HJW A;  1UOY A;  3LWP A;  1V9K A;  3UAI A;  3HJY A;  1SZW A;  3LWO A;  1ZE1 A;  2I82 A;  2AUS A;  3M4X A;  3LWR A;  2IST A;  3M6U A;  1KSV A;  3HAX A;  3ZV0 C;  1K8W A;  2HVY A;  3DH3 A;  1ZE2 A;  1KSK A;  1SGV A;  1SB7 A;  2AB4 A;  3M6X A;  1PRZ A;  1Z2Z A;  2EY4 A;  2FRX A;  1R3E A;  1KSL A;  2APO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...