1Y698

Rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
MISDIRKDAEVRMDKCVEAFKTQISKIRTGGGGTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title X-ray crystallography on ribosome recycling: mechanism of binding and action of RRF on the 50S ribosomal subunit
pubmed doi rcsb
source organism Escherichia coli
total genus 37
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
8 PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1y69800
4KB2A 1ISEA 3LF9A 1WQFA 4OYDB 4JLRC 5MLC9 3LHPS 1EK8A 1WQHA 4GFQA 4KB4A 1IS1A 1GE9A 5JSBB 1WQGA 1Y698 4KAWX 1EH1A 5JSNB 4KDDA 4KC6A 4L8IA 1DD5A
chains in the Genus database with same CATH superfamily
3SJRA 4C2MA 3K5LA 2NVXA 4O26A 3FKIA 1WCMA 2NVYA 5CQGA 4NOMA 4IP8A 5MLC9 4AN8A 1EK8A 3M4AA 2A68D 4GFQA 3K5OA 4FYDA 1RR8C 1GE9A 1MIUA 4Q5VA 1WQGA 4D3ZA 3WVOA 1LPQA 1EH1A 1SC7A 2CW0D 1Q8IA 2PMZA 1Y1VA 3IAYA 4L8IA 2R92A 2B9SB 1V9MA 1K4SA 1TWAA 4KB2A 4AYBA 1ISEA 3DU5A 1WQFA 4OYDB 2E2HA 4JLRC 4EJ3A 1NH3A 5C9HA 1WQHA 3GTKA 1IS1A 2A6ED 1TL8A 3P9AA 3K5NA 2E2IA 5JSBB 1TWCA 3GTQA 2A6HD 1Y1WA 4QCLA 4AHCA 1K83A 2R7ZA 1R9TA 1YNJD 2B63A 1TWGA 3K58A 1K4TA 3H0GA 3K5MA 2BE5D 1IW7D 2WB1A 1A36A 1SMYD 4D3YA 3LHPS 4KB4A 2VUMA 3CQZA 4NOKA 1SEUA 2R93A 3DU6A 3HKZA 1Y698 1YNND 3MAQA 4H3TA 3GTLA 1TGOA 1TWHA 2Y0SA 2YU9A 4LMOA 2O5JD 3GTGA 1R49A 3GTPA 4IP9A 5JSNB 4FXDA 4KC6A 2R4GA 2F4QA 1DD5A 2JA6A 4QIWA 2JA7A 3KYLA 1T8IA 1A35A 3K57A 3LF9A 1TWFA 1I50A 2WAQA 4NOLA 1I6VD 3K59A 1ZYRD 4F3EA 2JA5A 4Q5GA 3GTJA 1I3QA 4FGUA 4KAWX 2A69D 1RRJA 3GTMA 3GTOA 1A31A 1SFOA 1R5ZA 1EJ9A 4KDDA 1HQMD
chains in the Genus database with same CATH topology
3SJRA 4C2MA 3K5LA 2NVXA 4O26A 3FKIA 1WCMA 2NVYA 5CQGA 4NOMA 4IP8A 5MLC9 4AN8A 1EK8A 3M4AA 2A68D 4GFQA 3K5OA 4FYDA 1RR8C 1GE9A 1MIUA 4Q5VA 1WQGA 4D3ZA 3WVOA 1LPQA 1EH1A 1SC7A 2CW0D 1Q8IA 2PMZA 1Y1VA 3IAYA 4L8IA 2R92A 2B9SB 1V9MA 1K4SA 1TWAA 4KB2A 4AYBA 1ISEA 3DU5A 1WQFA 4OYDB 2E2HA 4JLRC 4EJ3A 1NH3A 5C9HA 1WQHA 3GTKA 1IS1A 2A6ED 1TL8A 3P9AA 3K5NA 2E2IA 5JSBB 1TWCA 3GTQA 2A6HD 1Y1WA 4QCLA 4AHCA 1K83A 2R7ZA 1R9TA 1YNJD 2B63A 1TWGA 3K58A 1K4TA 3H0GA 3K5MA 2BE5D 1IW7D 2WB1A 1A36A 1SMYD 4D3YA 3LHPS 4KB4A 2VUMA 3CQZA 4NOKA 1SEUA 2R93A 3DU6A 3HKZA 1Y698 1YNND 3MAQA 4H3TA 3GTLA 1TGOA 1TWHA 2Y0SA 2YU9A 4LMOA 2O5JD 3GTGA 1R49A 3GTPA 4IP9A 5JSNB 4FXDA 4KC6A 2R4GA 2F4QA 1DD5A 2JA6A 4QIWA 2JA7A 3KYLA 1T8IA 1A35A 3K57A 3LF9A 1TWFA 1I50A 2WAQA 4NOLA 1I6VD 3K59A 1ZYRD 4F3EA 2JA5A 4Q5GA 3GTJA 1I3QA 4FGUA 4KAWX 2A69D 1RRJA 3GTMA 3GTOA 1A31A 1SFOA 1R5ZA 1EJ9A 4KDDA 1HQMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KB2 A;  1ISE A;  3LF9 A;  1WQF A;  4OYD B;  4JLR C;  5MLC 9;  3LHP S;  1EK8 A;  1WQH A;  4GFQ A;  4KB4 A;  1IS1 A;  1GE9 A;  5JSB B;  1WQG A;  1Y69 8;  4KAW X;  1EH1 A;  5JSN B;  4KDD A;  4KC6 A;  4L8I A;  1DD5 A; 
#chains in the Genus database with same CATH topology
 3SJR A;  4C2M A;  3K5L A;  2NVX A;  4O26 A;  3FKI A;  1WCM A;  2NVY A;  5CQG A;  4NOM A;  4IP8 A;  5MLC 9;  4AN8 A;  1EK8 A;  3M4A A;  2A68 D;  4GFQ A;  3K5O A;  4FYD A;  1RR8 C;  1GE9 A;  1MIU A;  4Q5V A;  1WQG A;  4D3Z A;  3WVO A;  1LPQ A;  1EH1 A;  1SC7 A;  2CW0 D;  1Q8I A;  2PMZ A;  1Y1V A;  3IAY A;  4L8I A;  2R92 A;  2B9S B;  1V9M A;  1K4S A;  1TWA A;  4KB2 A;  4AYB A;  1ISE A;  3DU5 A;  1WQF A;  4OYD B;  2E2H A;  4JLR C;  4EJ3 A;  1NH3 A;  5C9H A;  1WQH A;  3GTK A;  1IS1 A;  2A6E D;  1TL8 A;  3P9A A;  3K5N A;  2E2I A;  5JSB B;  1TWC A;  3GTQ A;  2A6H D;  1Y1W A;  4QCL A;  4AHC A;  1K83 A;  2R7Z A;  1R9T A;  1YNJ D;  2B63 A;  1TWG A;  3K58 A;  1K4T A;  3H0G A;  3K5M A;  2BE5 D;  1IW7 D;  2WB1 A;  1A36 A;  1SMY D;  4D3Y A;  3LHP S;  4KB4 A;  2VUM A;  3CQZ A;  4NOK A;  1SEU A;  2R93 A;  3DU6 A;  3HKZ A;  1Y69 8;  1YNN D;  3MAQ A;  4H3T A;  3GTL A;  1TGO A;  1TWH A;  2Y0S A;  2YU9 A;  4LMO A;  2O5J D;  3GTG A;  1R49 A;  3GTP A;  4IP9 A;  5JSN B;  4FXD A;  4KC6 A;  2R4G A;  2F4Q A;  1DD5 A;  2JA6 A;  4QIW A;  2JA7 A;  3KYL A;  1T8I A;  1A35 A;  3K57 A;  3LF9 A;  1TWF A;  1I50 A;  2WAQ A;  4NOL A;  1I6V D;  3K59 A;  1ZYR D;  4F3E A;  2JA5 A;  4Q5G A;  3GTJ A;  1I3Q A;  4FGU A;  4KAW X;  2A69 D;  1RRJ A;  3GTM A;  3GTO A;  1A31 A;  1SFO A;  1R5Z A;  1EJ9 A;  4KDD A;  1HQM D; 
#chains in the Genus database with same CATH homology
 3SJR A;  4C2M A;  3K5L A;  2NVX A;  4O26 A;  3FKI A;  1WCM A;  2NVY A;  5CQG A;  4NOM A;  4IP8 A;  5MLC 9;  4AN8 A;  1EK8 A;  3M4A A;  2A68 D;  4GFQ A;  3K5O A;  4FYD A;  1RR8 C;  1GE9 A;  1MIU A;  4Q5V A;  1WQG A;  4D3Z A;  3WVO A;  1LPQ A;  1EH1 A;  1SC7 A;  2CW0 D;  1Q8I A;  2PMZ A;  1Y1V A;  3IAY A;  4L8I A;  2R92 A;  2B9S B;  1V9M A;  1K4S A;  1TWA A;  4KB2 A;  4AYB A;  1ISE A;  3DU5 A;  1WQF A;  4OYD B;  2E2H A;  4JLR C;  4EJ3 A;  1NH3 A;  5C9H A;  1WQH A;  3GTK A;  1IS1 A;  2A6E D;  1TL8 A;  3P9A A;  3K5N A;  2E2I A;  5JSB B;  1TWC A;  3GTQ A;  2A6H D;  1Y1W A;  4QCL A;  4AHC A;  1K83 A;  2R7Z A;  1R9T A;  1YNJ D;  2B63 A;  1TWG A;  3K58 A;  1K4T A;  3H0G A;  3K5M A;  2BE5 D;  1IW7 D;  2WB1 A;  1A36 A;  1SMY D;  4D3Y A;  3LHP S;  4KB4 A;  2VUM A;  3CQZ A;  4NOK A;  1SEU A;  2R93 A;  3DU6 A;  3HKZ A;  1Y69 8;  1YNN D;  3MAQ A;  4H3T A;  3GTL A;  1TGO A;  1TWH A;  2Y0S A;  2YU9 A;  4LMO A;  2O5J D;  3GTG A;  1R49 A;  3GTP A;  4IP9 A;  5JSN B;  4FXD A;  4KC6 A;  2R4G A;  2F4Q A;  1DD5 A;  2JA6 A;  4QIW A;  2JA7 A;  3KYL A;  1T8I A;  1A35 A;  3K57 A;  3LF9 A;  1TWF A;  1I50 A;  2WAQ A;  4NOL A;  1I6V D;  3K59 A;  1ZYR D;  4F3E A;  2JA5 A;  4Q5G A;  3GTJ A;  1I3Q A;  4FGU A;  4KAW X;  2A69 D;  1RRJ A;  3GTM A;  3GTO A;  1A31 A;  1SFO A;  1R5Z A;  1EJ9 A;  4KDD A;  1HQM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...