1Y698

Rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
MISDIRKDAEVRMDKCVEAFKTQISKIRTGGGGTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallography on ribosome recycling: mechanism of binding and action of RRF on the 50S ribosomal subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 37
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
8 PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1y69800
3LF9A 1EH1A 3LHPS 4KDDA 1WQHA 4KC6A 4JLRC 1DD5A 4OYDB 4KB2A 4KAWX 1WQFA 5JSBB 1Y698 5MLC9 4KB4A 1WQGA 1ISEA 1GE9A 1EK8A 4L8IA 5JSNB 1IS1A 4GFQA
chains in the Genus database with same CATH superfamily
1TWCA 2Y0SA 1TGOA 3CQZA 4IP9A 1TWAA 1Y1VA 1EH1A 1TL8A 3K5NA 4EJ3A 4F3EA 3GTGA 1DD5A 3HKZA 4KB2A 4OYDB 4D3YA 1K4TA 1WQFA 4FGUA 4AYBA 1Y698 1YNJD 3IAYA 2R93A 2WB1A 1IW7D 1T8IA 3K57A 4FYDA 1ISEA 3P9AA 3GTPA 2A6HD 1EK8A 1R9TA 1I6VD 1TWFA 3DU6A 3FKIA 1V9MA 4QCLA 2NVXA 4Q5VA 4FXDA 3LHPS 3GTKA 4KC6A 1YNND 1RR8C 3GTOA 1A31A 5JSBB 4NOLA 2VUMA 2E2IA 3MAQA 1WCMA 3K58A 1TWHA 2R7ZA 1SMYD 2A69D 1Y1WA 1ZYRD 1MIUA 2A68D 3H0GA 5C9HA 1SEUA 2YU9A 3GTLA 4LMOA 2WAQA 4NOMA 3M4AA 1RRJA 1SC7A 3GTQA 1TWGA 3KYLA 4KDDA 4Q5GA 1EJ9A 2E2HA 1WQHA 1NH3A 2B63A 2O5JD 4NOKA 2A6ED 2JA7A 1LPQA 1R49A 4D3ZA 1I50A 5MLC9 2R4GA 4H3TA 4O26A 3GTJA 2R92A 4AN8A 2NVYA 2BE5D 1WQGA 1K83A 1HQMD 4QIWA 4C2MA 5CQGA 1K4SA 4L8IA 1IS1A 3DU5A 3LF9A 2CW0D 3K5OA 2PMZA 4AHCA 1A36A 1I3QA 4IP8A 3K5LA 1R5ZA 2B9SB 1SFOA 4JLRC 2JA5A 3K5MA 3SJRA 4KAWX 2F4QA 3WVOA 2JA6A 3K59A 4KB4A 3GTMA 1GE9A 1A35A 5JSNB 1Q8IA 4GFQA
chains in the Genus database with same CATH topology
1TWCA 2Y0SA 1TGOA 3CQZA 4IP9A 1TWAA 1Y1VA 1EH1A 1TL8A 3K5NA 4EJ3A 4F3EA 3GTGA 1DD5A 3HKZA 4KB2A 4OYDB 4D3YA 1K4TA 1WQFA 4FGUA 4AYBA 1Y698 1YNJD 3IAYA 2R93A 2WB1A 1IW7D 1T8IA 3K57A 4FYDA 1ISEA 3P9AA 3GTPA 2A6HD 1EK8A 1R9TA 1I6VD 1TWFA 3DU6A 3FKIA 1V9MA 4QCLA 2NVXA 4Q5VA 4FXDA 3LHPS 3GTKA 4KC6A 1YNND 1RR8C 3GTOA 1A31A 5JSBB 4NOLA 2VUMA 2E2IA 3MAQA 1WCMA 3K58A 1TWHA 2R7ZA 1SMYD 2A69D 1Y1WA 1ZYRD 1MIUA 2A68D 3H0GA 5C9HA 1SEUA 2YU9A 3GTLA 4LMOA 2WAQA 4NOMA 3M4AA 1RRJA 1SC7A 3GTQA 1TWGA 3KYLA 4KDDA 4Q5GA 1EJ9A 2E2HA 1WQHA 1NH3A 2B63A 2O5JD 4NOKA 2A6ED 2JA7A 1LPQA 1R49A 4D3ZA 1I50A 5MLC9 2R4GA 4H3TA 4O26A 3GTJA 2R92A 4AN8A 2NVYA 2BE5D 1WQGA 1K83A 1HQMD 4QIWA 4C2MA 5CQGA 1K4SA 4L8IA 1IS1A 3DU5A 3LF9A 2CW0D 3K5OA 2PMZA 4AHCA 1A36A 1I3QA 4IP8A 3K5LA 1R5ZA 2B9SB 1SFOA 4JLRC 2JA5A 3K5MA 3SJRA 4KAWX 2F4QA 3WVOA 2JA6A 3K59A 4KB4A 3GTMA 1GE9A 1A35A 5JSNB 1Q8IA 4GFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LF9 A;  1EH1 A;  3LHP S;  4KDD A;  1WQH A;  4KC6 A;  4JLR C;  1DD5 A;  4OYD B;  4KB2 A;  4KAW X;  1WQF A;  5JSB B;  1Y69 8;  5MLC 9;  4KB4 A;  1WQG A;  1ISE A;  1GE9 A;  1EK8 A;  4L8I A;  5JSN B;  1IS1 A;  4GFQ A; 
#chains in the Genus database with same CATH topology
 1TWC A;  2Y0S A;  1TGO A;  3CQZ A;  4IP9 A;  1TWA A;  1Y1V A;  1EH1 A;  1TL8 A;  3K5N A;  4EJ3 A;  4F3E A;  3GTG A;  1DD5 A;  3HKZ A;  4KB2 A;  4OYD B;  4D3Y A;  1K4T A;  1WQF A;  4FGU A;  4AYB A;  1Y69 8;  1YNJ D;  3IAY A;  2R93 A;  2WB1 A;  1IW7 D;  1T8I A;  3K57 A;  4FYD A;  1ISE A;  3P9A A;  3GTP A;  2A6H D;  1EK8 A;  1R9T A;  1I6V D;  1TWF A;  3DU6 A;  3FKI A;  1V9M A;  4QCL A;  2NVX A;  4Q5V A;  4FXD A;  3LHP S;  3GTK A;  4KC6 A;  1YNN D;  1RR8 C;  3GTO A;  1A31 A;  5JSB B;  4NOL A;  2VUM A;  2E2I A;  3MAQ A;  1WCM A;  3K58 A;  1TWH A;  2R7Z A;  1SMY D;  2A69 D;  1Y1W A;  1ZYR D;  1MIU A;  2A68 D;  3H0G A;  5C9H A;  1SEU A;  2YU9 A;  3GTL A;  4LMO A;  2WAQ A;  4NOM A;  3M4A A;  1RRJ A;  1SC7 A;  3GTQ A;  1TWG A;  3KYL A;  4KDD A;  4Q5G A;  1EJ9 A;  2E2H A;  1WQH A;  1NH3 A;  2B63 A;  2O5J D;  4NOK A;  2A6E D;  2JA7 A;  1LPQ A;  1R49 A;  4D3Z A;  1I50 A;  5MLC 9;  2R4G A;  4H3T A;  4O26 A;  3GTJ A;  2R92 A;  4AN8 A;  2NVY A;  2BE5 D;  1WQG A;  1K83 A;  1HQM D;  4QIW A;  4C2M A;  5CQG A;  1K4S A;  4L8I A;  1IS1 A;  3DU5 A;  3LF9 A;  2CW0 D;  3K5O A;  2PMZ A;  4AHC A;  1A36 A;  1I3Q A;  4IP8 A;  3K5L A;  1R5Z A;  2B9S B;  1SFO A;  4JLR C;  2JA5 A;  3K5M A;  3SJR A;  4KAW X;  2F4Q A;  3WVO A;  2JA6 A;  3K59 A;  4KB4 A;  3GTM A;  1GE9 A;  1A35 A;  5JSN B;  1Q8I A;  4GFQ A; 
#chains in the Genus database with same CATH homology
 1TWC A;  2Y0S A;  1TGO A;  3CQZ A;  4IP9 A;  1TWA A;  1Y1V A;  1EH1 A;  1TL8 A;  3K5N A;  4EJ3 A;  4F3E A;  3GTG A;  1DD5 A;  3HKZ A;  4KB2 A;  4OYD B;  4D3Y A;  1K4T A;  1WQF A;  4FGU A;  4AYB A;  1Y69 8;  1YNJ D;  3IAY A;  2R93 A;  2WB1 A;  1IW7 D;  1T8I A;  3K57 A;  4FYD A;  1ISE A;  3P9A A;  3GTP A;  2A6H D;  1EK8 A;  1R9T A;  1I6V D;  1TWF A;  3DU6 A;  3FKI A;  1V9M A;  4QCL A;  2NVX A;  4Q5V A;  4FXD A;  3LHP S;  3GTK A;  4KC6 A;  1YNN D;  1RR8 C;  3GTO A;  1A31 A;  5JSB B;  4NOL A;  2VUM A;  2E2I A;  3MAQ A;  1WCM A;  3K58 A;  1TWH A;  2R7Z A;  1SMY D;  2A69 D;  1Y1W A;  1ZYR D;  1MIU A;  2A68 D;  3H0G A;  5C9H A;  1SEU A;  2YU9 A;  3GTL A;  4LMO A;  2WAQ A;  4NOM A;  3M4A A;  1RRJ A;  1SC7 A;  3GTQ A;  1TWG A;  3KYL A;  4KDD A;  4Q5G A;  1EJ9 A;  2E2H A;  1WQH A;  1NH3 A;  2B63 A;  2O5J D;  4NOK A;  2A6E D;  2JA7 A;  1LPQ A;  1R49 A;  4D3Z A;  1I50 A;  5MLC 9;  2R4G A;  4H3T A;  4O26 A;  3GTJ A;  2R92 A;  4AN8 A;  2NVY A;  2BE5 D;  1WQG A;  1K83 A;  1HQM D;  4QIW A;  4C2M A;  5CQG A;  1K4S A;  4L8I A;  1IS1 A;  3DU5 A;  3LF9 A;  2CW0 D;  3K5O A;  2PMZ A;  4AHC A;  1A36 A;  1I3Q A;  4IP8 A;  3K5L A;  1R5Z A;  2B9S B;  1SFO A;  4JLR C;  2JA5 A;  3K5M A;  3SJR A;  4KAW X;  2F4Q A;  3WVO A;  2JA6 A;  3K59 A;  4KB4 A;  3GTM A;  1GE9 A;  1A35 A;  5JSN B;  1Q8I A;  4GFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...