1Y698

Rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
b'MISDIRKDAEVRMDKCVEAFKTQISKIRTGGGGTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title X-ray crystallography on ribosome recycling: mechanism of binding and action of RRF on the 50S ribosomal subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 37
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
8 PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1y69800
4KC6A 1EK8A 1WQGA 5MLC9 1Y698 1GE9A 4KB4A 4OYDB 5JSBB 1EH1A 3LF9A 1WQFA 3LHPS 4KAWX 1WQHA 4JLRC 4KB2A 4KDDA 1ISEA 5JSNB 1IS1A 1DD5A 4GFQA 4L8IA
chains in the Genus database with same CATH superfamily
4FGUA 1EK8A 4Q5VA 2R93A 3K5LA 1WQGA 2O5JD 4NOLA 4KB4A 1TWHA 4D3YA 2R7ZA 3H0GA 4OYDB 3K57A 3K58A 2A6ED 2B9SB 3P9AA 1Y1VA 1A35A 1SC7A 1WQHA 4Q5GA 1SMYD 3FKIA 4KDDA 4AN8A 4AYBA 3GTGA 1IS1A 1TWAA 1TGOA 1TWGA 3GTPA 1V9MA 4QCLA 4IP8A 2B63A 3GTQA 2WB1A 2A69D 4KC6A 1SFOA 1I3QA 1R9TA 3M4AA 2R92A 4D3ZA 1I6VD 2R4GA 1K4TA 1YNND 1EH1A 4NOMA 5CQGA 4AHCA 3CQZA 1T8IA 1WQFA 4FYDA 1A36A 3LHPS 1NH3A 2JA6A 3IAYA 3GTKA 4FXDA 1SEUA 2F4QA 2E2IA 1RRJA 3K5NA 2BE5D 1DD5A 3K59A 1RR8C 1Y1WA 3WVOA 2NVYA 1TWCA 4IP9A 3K5MA 1WCMA 2JA5A 2JA7A 5MLC9 1Y698 3GTOA 1GE9A 3DU5A 4H3TA 4LMOA 4F3EA 1R49A 1YNJD 4JLRC 4NOKA 1TWFA 4KB2A 3GTLA 1ZYRD 4QIWA 1K4SA 1K83A 2Y0SA 4O26A 4GFQA 1R5ZA 2PMZA 1A31A 3GTJA 2WAQA 1MIUA 4EJ3A 3HKZA 5C9HA 2YU9A 5JSBB 3LF9A 4C2MA 1I50A 3KYLA 3DU6A 1LPQA 4KAWX 1HQMD 1Q8IA 2CW0D 1EJ9A 2VUMA 1ISEA 3K5OA 5JSNB 2NVXA 4L8IA 3SJRA 2A68D 3MAQA 3GTMA 2E2HA 1IW7D 2A6HD 1TL8A
chains in the Genus database with same CATH topology
4FGUA 1EK8A 4Q5VA 2R93A 3K5LA 1WQGA 2O5JD 4NOLA 4KB4A 1TWHA 4D3YA 2R7ZA 3H0GA 4OYDB 3K57A 3K58A 2A6ED 2B9SB 3P9AA 1Y1VA 1A35A 1SC7A 1WQHA 4Q5GA 1SMYD 3FKIA 4KDDA 4AN8A 4AYBA 3GTGA 1IS1A 1TWAA 1TGOA 1TWGA 3GTPA 1V9MA 4QCLA 4IP8A 2B63A 3GTQA 2WB1A 2A69D 4KC6A 1SFOA 1I3QA 1R9TA 3M4AA 2R92A 4D3ZA 1I6VD 2R4GA 1K4TA 1YNND 1EH1A 4NOMA 5CQGA 4AHCA 3CQZA 1T8IA 1WQFA 4FYDA 1A36A 3LHPS 1NH3A 2JA6A 3IAYA 3GTKA 4FXDA 1SEUA 2F4QA 2E2IA 1RRJA 3K5NA 2BE5D 1DD5A 3K59A 1RR8C 1Y1WA 3WVOA 2NVYA 1TWCA 4IP9A 3K5MA 1WCMA 2JA5A 2JA7A 5MLC9 1Y698 3GTOA 1GE9A 3DU5A 4H3TA 4LMOA 4F3EA 1R49A 1YNJD 4JLRC 4NOKA 1TWFA 4KB2A 3GTLA 1ZYRD 4QIWA 1K4SA 1K83A 2Y0SA 4O26A 4GFQA 1R5ZA 2PMZA 1A31A 3GTJA 2WAQA 1MIUA 4EJ3A 3HKZA 5C9HA 2YU9A 5JSBB 3LF9A 4C2MA 1I50A 3KYLA 3DU6A 1LPQA 4KAWX 1HQMD 1Q8IA 2CW0D 1EJ9A 2VUMA 1ISEA 3K5OA 5JSNB 2NVXA 4L8IA 3SJRA 2A68D 3MAQA 3GTMA 2E2HA 1IW7D 2A6HD 1TL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KC6 A;  1EK8 A;  1WQG A;  5MLC 9;  1Y69 8;  1GE9 A;  4KB4 A;  4OYD B;  5JSB B;  1EH1 A;  3LF9 A;  1WQF A;  3LHP S;  4KAW X;  1WQH A;  4JLR C;  4KB2 A;  4KDD A;  1ISE A;  5JSN B;  1IS1 A;  1DD5 A;  4GFQ A;  4L8I A; 
#chains in the Genus database with same CATH topology
 4FGU A;  1EK8 A;  4Q5V A;  2R93 A;  3K5L A;  1WQG A;  2O5J D;  4NOL A;  4KB4 A;  1TWH A;  4D3Y A;  2R7Z A;  3H0G A;  4OYD B;  3K57 A;  3K58 A;  2A6E D;  2B9S B;  3P9A A;  1Y1V A;  1A35 A;  1SC7 A;  1WQH A;  4Q5G A;  1SMY D;  3FKI A;  4KDD A;  4AN8 A;  4AYB A;  3GTG A;  1IS1 A;  1TWA A;  1TGO A;  1TWG A;  3GTP A;  1V9M A;  4QCL A;  4IP8 A;  2B63 A;  3GTQ A;  2WB1 A;  2A69 D;  4KC6 A;  1SFO A;  1I3Q A;  1R9T A;  3M4A A;  2R92 A;  4D3Z A;  1I6V D;  2R4G A;  1K4T A;  1YNN D;  1EH1 A;  4NOM A;  5CQG A;  4AHC A;  3CQZ A;  1T8I A;  1WQF A;  4FYD A;  1A36 A;  3LHP S;  1NH3 A;  2JA6 A;  3IAY A;  3GTK A;  4FXD A;  1SEU A;  2F4Q A;  2E2I A;  1RRJ A;  3K5N A;  2BE5 D;  1DD5 A;  3K59 A;  1RR8 C;  1Y1W A;  3WVO A;  2NVY A;  1TWC A;  4IP9 A;  3K5M A;  1WCM A;  2JA5 A;  2JA7 A;  5MLC 9;  1Y69 8;  3GTO A;  1GE9 A;  3DU5 A;  4H3T A;  4LMO A;  4F3E A;  1R49 A;  1YNJ D;  4JLR C;  4NOK A;  1TWF A;  4KB2 A;  3GTL A;  1ZYR D;  4QIW A;  1K4S A;  1K83 A;  2Y0S A;  4O26 A;  4GFQ A;  1R5Z A;  2PMZ A;  1A31 A;  3GTJ A;  2WAQ A;  1MIU A;  4EJ3 A;  3HKZ A;  5C9H A;  2YU9 A;  5JSB B;  3LF9 A;  4C2M A;  1I50 A;  3KYL A;  3DU6 A;  1LPQ A;  4KAW X;  1HQM D;  1Q8I A;  2CW0 D;  1EJ9 A;  2VUM A;  1ISE A;  3K5O A;  5JSN B;  2NVX A;  4L8I A;  3SJR A;  2A68 D;  3MAQ A;  3GTM A;  2E2H A;  1IW7 D;  2A6H D;  1TL8 A; 
#chains in the Genus database with same CATH homology
 4FGU A;  1EK8 A;  4Q5V A;  2R93 A;  3K5L A;  1WQG A;  2O5J D;  4NOL A;  4KB4 A;  1TWH A;  4D3Y A;  2R7Z A;  3H0G A;  4OYD B;  3K57 A;  3K58 A;  2A6E D;  2B9S B;  3P9A A;  1Y1V A;  1A35 A;  1SC7 A;  1WQH A;  4Q5G A;  1SMY D;  3FKI A;  4KDD A;  4AN8 A;  4AYB A;  3GTG A;  1IS1 A;  1TWA A;  1TGO A;  1TWG A;  3GTP A;  1V9M A;  4QCL A;  4IP8 A;  2B63 A;  3GTQ A;  2WB1 A;  2A69 D;  4KC6 A;  1SFO A;  1I3Q A;  1R9T A;  3M4A A;  2R92 A;  4D3Z A;  1I6V D;  2R4G A;  1K4T A;  1YNN D;  1EH1 A;  4NOM A;  5CQG A;  4AHC A;  3CQZ A;  1T8I A;  1WQF A;  4FYD A;  1A36 A;  3LHP S;  1NH3 A;  2JA6 A;  3IAY A;  3GTK A;  4FXD A;  1SEU A;  2F4Q A;  2E2I A;  1RRJ A;  3K5N A;  2BE5 D;  1DD5 A;  3K59 A;  1RR8 C;  1Y1W A;  3WVO A;  2NVY A;  1TWC A;  4IP9 A;  3K5M A;  1WCM A;  2JA5 A;  2JA7 A;  5MLC 9;  1Y69 8;  3GTO A;  1GE9 A;  3DU5 A;  4H3T A;  4LMO A;  4F3E A;  1R49 A;  1YNJ D;  4JLR C;  4NOK A;  1TWF A;  4KB2 A;  3GTL A;  1ZYR D;  4QIW A;  1K4S A;  1K83 A;  2Y0S A;  4O26 A;  4GFQ A;  1R5Z A;  2PMZ A;  1A31 A;  3GTJ A;  2WAQ A;  1MIU A;  4EJ3 A;  3HKZ A;  5C9H A;  2YU9 A;  5JSB B;  3LF9 A;  4C2M A;  1I50 A;  3KYL A;  3DU6 A;  1LPQ A;  4KAW X;  1HQM D;  1Q8I A;  2CW0 D;  1EJ9 A;  2VUM A;  1ISE A;  3K5O A;  5JSN B;  2NVX A;  4L8I A;  3SJR A;  2A68 D;  3MAQ A;  3GTM A;  2E2H A;  1IW7 D;  2A6H D;  1TL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...