1Y698

Rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
MISDIRKDAEVRMDKCVEAFKTQISKIRTGGGGTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title X-ray crystallography on ribosome recycling: mechanism of binding and action of RRF on the 50S ribosomal subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 37
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
8 PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1y69800
4JLRC 1WQGA 4KB2A 1EK8A 4KB4A 4OYDB 1DD5A 1ISEA 5JSBB 1Y698 3LHPS 1WQHA 3LF9A 4GFQA 4KDDA 1EH1A 1GE9A 1IS1A 4L8IA 4KAWX 4KC6A 5JSNB 5MLC9 1WQFA
chains in the Genus database with same CATH superfamily
4JLRC 4C2MA 1K83A 2A6HD 4F3EA 2WB1A 2JA7A 1TWHA 3FKIA 4KB4A 3M4AA 4OYDB 1A36A 3K5OA 3MAQA 1Q8IA 1LPQA 3SJRA 2B9SB 3K5LA 1Y698 2R92A 2O5JD 1WQHA 3LF9A 1I50A 4QCLA 3K5NA 3K59A 2BE5D 3DU6A 2Y0SA 4NOKA 4O26A 4FYDA 2R93A 1GE9A 1ZYRD 1TWFA 2R7ZA 4EJ3A 1IW7D 3GTLA 1SC7A 4FGUA 1HQMD 2A69D 1R49A 1WQGA 1EK8A 4NOLA 5CQGA 4QIWA 3WVOA 1EJ9A 3HKZA 1RRJA 3DU5A 3LHPS 2WAQA 4AYBA 2E2HA 2B63A 4KDDA 1YNJD 3H0GA 4AHCA 3K5MA 1I6VD 4H3TA 1V9MA 4AN8A 4L8IA 4KAWX 2R4GA 2VUMA 1RR8C 3KYLA 3P9AA 2CW0D 4LMOA 3GTOA 2NVYA 1ISEA 1T8IA 1Y1VA 4D3ZA 4Q5VA 2A68D 2A6ED 1TWCA 4FXDA 2JA6A 3K58A 3GTJA 1SMYD 1IS1A 1K4SA 4Q5GA 5JSNB 2E2IA 1R9TA 3CQZA 1WQFA 1TL8A 1TGOA 3GTKA 3GTPA 5C9HA 3GTMA 4KB2A 2NVXA 2JA5A 4IP8A 3K57A 1NH3A 2YU9A 1Y1WA 1DD5A 3IAYA 4IP9A 1I3QA 5JSBB 1SEUA 3GTGA 1TWGA 4GFQA 4NOMA 4D3YA 1EH1A 1A31A 1MIUA 1SFOA 1TWAA 2F4QA 1WCMA 4KC6A 3GTQA 2PMZA 5MLC9 1K4TA 1A35A 1R5ZA 1YNND
chains in the Genus database with same CATH topology
4JLRC 4C2MA 1K83A 2A6HD 4F3EA 2WB1A 2JA7A 1TWHA 3FKIA 4KB4A 3M4AA 4OYDB 1A36A 3K5OA 3MAQA 1Q8IA 1LPQA 3SJRA 2B9SB 3K5LA 1Y698 2R92A 2O5JD 1WQHA 3LF9A 1I50A 4QCLA 3K5NA 3K59A 2BE5D 3DU6A 2Y0SA 4NOKA 4O26A 4FYDA 2R93A 1GE9A 1ZYRD 1TWFA 2R7ZA 4EJ3A 1IW7D 3GTLA 1SC7A 4FGUA 1HQMD 2A69D 1R49A 1WQGA 1EK8A 4NOLA 5CQGA 4QIWA 3WVOA 1EJ9A 3HKZA 1RRJA 3DU5A 3LHPS 2WAQA 4AYBA 2E2HA 2B63A 4KDDA 1YNJD 3H0GA 4AHCA 3K5MA 1I6VD 4H3TA 1V9MA 4AN8A 4L8IA 4KAWX 2R4GA 2VUMA 1RR8C 3KYLA 3P9AA 2CW0D 4LMOA 3GTOA 2NVYA 1ISEA 1T8IA 1Y1VA 4D3ZA 4Q5VA 2A68D 2A6ED 1TWCA 4FXDA 2JA6A 3K58A 3GTJA 1SMYD 1IS1A 1K4SA 4Q5GA 5JSNB 2E2IA 1R9TA 3CQZA 1WQFA 1TL8A 1TGOA 3GTKA 3GTPA 5C9HA 3GTMA 4KB2A 2NVXA 2JA5A 4IP8A 3K57A 1NH3A 2YU9A 1Y1WA 1DD5A 3IAYA 4IP9A 1I3QA 5JSBB 1SEUA 3GTGA 1TWGA 4GFQA 4NOMA 4D3YA 1EH1A 1A31A 1MIUA 1SFOA 1TWAA 2F4QA 1WCMA 4KC6A 3GTQA 2PMZA 5MLC9 1K4TA 1A35A 1R5ZA 1YNND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLR C;  1WQG A;  4KB2 A;  1EK8 A;  4KB4 A;  4OYD B;  1DD5 A;  1ISE A;  5JSB B;  1Y69 8;  3LHP S;  1WQH A;  3LF9 A;  4GFQ A;  4KDD A;  1EH1 A;  1GE9 A;  1IS1 A;  4L8I A;  4KAW X;  4KC6 A;  5JSN B;  5MLC 9;  1WQF A; 
#chains in the Genus database with same CATH topology
 4JLR C;  4C2M A;  1K83 A;  2A6H D;  4F3E A;  2WB1 A;  2JA7 A;  1TWH A;  3FKI A;  4KB4 A;  3M4A A;  4OYD B;  1A36 A;  3K5O A;  3MAQ A;  1Q8I A;  1LPQ A;  3SJR A;  2B9S B;  3K5L A;  1Y69 8;  2R92 A;  2O5J D;  1WQH A;  3LF9 A;  1I50 A;  4QCL A;  3K5N A;  3K59 A;  2BE5 D;  3DU6 A;  2Y0S A;  4NOK A;  4O26 A;  4FYD A;  2R93 A;  1GE9 A;  1ZYR D;  1TWF A;  2R7Z A;  4EJ3 A;  1IW7 D;  3GTL A;  1SC7 A;  4FGU A;  1HQM D;  2A69 D;  1R49 A;  1WQG A;  1EK8 A;  4NOL A;  5CQG A;  4QIW A;  3WVO A;  1EJ9 A;  3HKZ A;  1RRJ A;  3DU5 A;  3LHP S;  2WAQ A;  4AYB A;  2E2H A;  2B63 A;  4KDD A;  1YNJ D;  3H0G A;  4AHC A;  3K5M A;  1I6V D;  4H3T A;  1V9M A;  4AN8 A;  4L8I A;  4KAW X;  2R4G A;  2VUM A;  1RR8 C;  3KYL A;  3P9A A;  2CW0 D;  4LMO A;  3GTO A;  2NVY A;  1ISE A;  1T8I A;  1Y1V A;  4D3Z A;  4Q5V A;  2A68 D;  2A6E D;  1TWC A;  4FXD A;  2JA6 A;  3K58 A;  3GTJ A;  1SMY D;  1IS1 A;  1K4S A;  4Q5G A;  5JSN B;  2E2I A;  1R9T A;  3CQZ A;  1WQF A;  1TL8 A;  1TGO A;  3GTK A;  3GTP A;  5C9H A;  3GTM A;  4KB2 A;  2NVX A;  2JA5 A;  4IP8 A;  3K57 A;  1NH3 A;  2YU9 A;  1Y1W A;  1DD5 A;  3IAY A;  4IP9 A;  1I3Q A;  5JSB B;  1SEU A;  3GTG A;  1TWG A;  4GFQ A;  4NOM A;  4D3Y A;  1EH1 A;  1A31 A;  1MIU A;  1SFO A;  1TWA A;  2F4Q A;  1WCM A;  4KC6 A;  3GTQ A;  2PMZ A;  5MLC 9;  1K4T A;  1A35 A;  1R5Z A;  1YNN D; 
#chains in the Genus database with same CATH homology
 4JLR C;  4C2M A;  1K83 A;  2A6H D;  4F3E A;  2WB1 A;  2JA7 A;  1TWH A;  3FKI A;  4KB4 A;  3M4A A;  4OYD B;  1A36 A;  3K5O A;  3MAQ A;  1Q8I A;  1LPQ A;  3SJR A;  2B9S B;  3K5L A;  1Y69 8;  2R92 A;  2O5J D;  1WQH A;  3LF9 A;  1I50 A;  4QCL A;  3K5N A;  3K59 A;  2BE5 D;  3DU6 A;  2Y0S A;  4NOK A;  4O26 A;  4FYD A;  2R93 A;  1GE9 A;  1ZYR D;  1TWF A;  2R7Z A;  4EJ3 A;  1IW7 D;  3GTL A;  1SC7 A;  4FGU A;  1HQM D;  2A69 D;  1R49 A;  1WQG A;  1EK8 A;  4NOL A;  5CQG A;  4QIW A;  3WVO A;  1EJ9 A;  3HKZ A;  1RRJ A;  3DU5 A;  3LHP S;  2WAQ A;  4AYB A;  2E2H A;  2B63 A;  4KDD A;  1YNJ D;  3H0G A;  4AHC A;  3K5M A;  1I6V D;  4H3T A;  1V9M A;  4AN8 A;  4L8I A;  4KAW X;  2R4G A;  2VUM A;  1RR8 C;  3KYL A;  3P9A A;  2CW0 D;  4LMO A;  3GTO A;  2NVY A;  1ISE A;  1T8I A;  1Y1V A;  4D3Z A;  4Q5V A;  2A68 D;  2A6E D;  1TWC A;  4FXD A;  2JA6 A;  3K58 A;  3GTJ A;  1SMY D;  1IS1 A;  1K4S A;  4Q5G A;  5JSN B;  2E2I A;  1R9T A;  3CQZ A;  1WQF A;  1TL8 A;  1TGO A;  3GTK A;  3GTP A;  5C9H A;  3GTM A;  4KB2 A;  2NVX A;  2JA5 A;  4IP8 A;  3K57 A;  1NH3 A;  2YU9 A;  1Y1W A;  1DD5 A;  3IAY A;  4IP9 A;  1I3Q A;  5JSB B;  1SEU A;  3GTG A;  1TWG A;  4GFQ A;  4NOM A;  4D3Y A;  1EH1 A;  1A31 A;  1MIU A;  1SFO A;  1TWA A;  2F4Q A;  1WCM A;  4KC6 A;  3GTQ A;  2PMZ A;  5MLC 9;  1K4T A;  1A35 A;  1R5Z A;  1YNN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...