4JLRC

Crystal structure of a designed respiratory syncytial virus immunogen in complex with motavizumab
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
100
Chain Sequence
KDAERRFDKFVEAAKNKFDKFKAALDIKEERRKDMKKLARKEAEQARRAVRNRLSELLSKINDMPITNDQKKLMSNDVLKFAAEAEKKIEALAADAEDKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Motavizumab Fab heavy chain
publication title Proof of principle for epitope-focused vaccine design.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 100
sequence length 103
chains with identical sequence S
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4jlrC00
1EH1A 4KB2A 1EK8A 5MLC9 1WQHA 1ISEA 3LF9A 5JSNB 1GE9A 3LHPS 4KAWX 4GFQA 4KDDA 4KC6A 5JSBB 1WQGA 1WQFA 1Y698 4JLRC 4L8IA 4KB4A 4OYDB 1DD5A 1IS1A
chains in the Genus database with same CATH superfamily
1K83A 2CW0D 1T8IA 1R9TA 2A6ED 2R93A 2B63A 1EK8A 1ZYRD 2NVXA 3K5LA 3FKIA 2WB1A 1TWCA 1RRJA 2R92A 4KDDA 1SEUA 4C2MA 1Y1WA 2JA7A 1V9MA 1WQGA 1WQFA 3GTPA 4JLRC 2JA5A 5CQGA 2F4QA 1SFOA 3GTOA 1EJ9A 1DD5A 3M4AA 3GTMA 3DU5A 2VUMA 4KB2A 1R5ZA 1SC7A 1TWGA 3GTKA 3MAQA 4AN8A 1A36A 3K59A 2JA6A 1SMYD 1I50A 2YU9A 2B9SB 4KAWX 1Y1VA 1LPQA 1R49A 4GFQA 3KYLA 3SJRA 3GTJA 2R4GA 1TL8A 2PMZA 4FYDA 2E2HA 2E2IA 4LMOA 4F3EA 2A6HD 4QCLA 1I6VD 4QIWA 4D3YA 3CQZA 1HQMD 1EH1A 2A69D 4Q5VA 3WVOA 4IP8A 1RR8C 3H0GA 5MLC9 4NOKA 5C9HA 2O5JD 3LF9A 3P9AA 4D3ZA 4H3TA 5JSNB 4NOMA 1GE9A 3LHPS 1K4TA 1TWAA 2WAQA 1TWFA 2NVYA 3K5OA 2BE5D 3K57A 4Q5GA 1K4SA 3GTGA 5JSBB 2Y0SA 1A31A 1Y698 4KB4A 1IS1A 4NOLA 4IP9A 3HKZA 4FGUA 4O26A 1WCMA 1YNJD 1WQHA 1ISEA 2R7ZA 1IW7D 1NH3A 3K5MA 3IAYA 3K5NA 4FXDA 1TGOA 3K58A 1YNND 4AYBA 1A35A 4KC6A 1Q8IA 3GTLA 4AHCA 2A68D 4L8IA 4EJ3A 1TWHA 3GTQA 1MIUA 4OYDB 1I3QA 3DU6A
chains in the Genus database with same CATH topology
1K83A 2CW0D 1T8IA 1R9TA 2A6ED 2R93A 2B63A 1EK8A 1ZYRD 2NVXA 3K5LA 3FKIA 2WB1A 1TWCA 1RRJA 2R92A 4KDDA 1SEUA 4C2MA 1Y1WA 2JA7A 1V9MA 1WQGA 1WQFA 3GTPA 4JLRC 2JA5A 5CQGA 2F4QA 1SFOA 3GTOA 1EJ9A 1DD5A 3M4AA 3GTMA 3DU5A 2VUMA 4KB2A 1R5ZA 1SC7A 1TWGA 3GTKA 3MAQA 4AN8A 1A36A 3K59A 2JA6A 1SMYD 1I50A 2YU9A 2B9SB 4KAWX 1Y1VA 1LPQA 1R49A 4GFQA 3KYLA 3SJRA 3GTJA 2R4GA 1TL8A 2PMZA 4FYDA 2E2HA 2E2IA 4LMOA 4F3EA 2A6HD 4QCLA 1I6VD 4QIWA 4D3YA 3CQZA 1HQMD 1EH1A 2A69D 4Q5VA 3WVOA 4IP8A 1RR8C 3H0GA 5MLC9 4NOKA 5C9HA 2O5JD 3LF9A 3P9AA 4D3ZA 4H3TA 5JSNB 4NOMA 1GE9A 3LHPS 1K4TA 1TWAA 2WAQA 1TWFA 2NVYA 3K5OA 2BE5D 3K57A 4Q5GA 1K4SA 3GTGA 5JSBB 2Y0SA 1A31A 1Y698 4KB4A 1IS1A 4NOLA 4IP9A 3HKZA 4FGUA 4O26A 1WCMA 1YNJD 1WQHA 1ISEA 2R7ZA 1IW7D 1NH3A 3K5MA 3IAYA 3K5NA 4FXDA 1TGOA 3K58A 1YNND 4AYBA 1A35A 4KC6A 1Q8IA 3GTLA 4AHCA 2A68D 4L8IA 4EJ3A 1TWHA 3GTQA 1MIUA 4OYDB 1I3QA 3DU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH1 A;  4KB2 A;  1EK8 A;  5MLC 9;  1WQH A;  1ISE A;  3LF9 A;  5JSN B;  1GE9 A;  3LHP S;  4KAW X;  4GFQ A;  4KDD A;  4KC6 A;  5JSB B;  1WQG A;  1WQF A;  1Y69 8;  4JLR C;  4L8I A;  4KB4 A;  4OYD B;  1DD5 A;  1IS1 A; 
#chains in the Genus database with same CATH topology
 1K83 A;  2CW0 D;  1T8I A;  1R9T A;  2A6E D;  2R93 A;  2B63 A;  1EK8 A;  1ZYR D;  2NVX A;  3K5L A;  3FKI A;  2WB1 A;  1TWC A;  1RRJ A;  2R92 A;  4KDD A;  1SEU A;  4C2M A;  1Y1W A;  2JA7 A;  1V9M A;  1WQG A;  1WQF A;  3GTP A;  4JLR C;  2JA5 A;  5CQG A;  2F4Q A;  1SFO A;  3GTO A;  1EJ9 A;  1DD5 A;  3M4A A;  3GTM A;  3DU5 A;  2VUM A;  4KB2 A;  1R5Z A;  1SC7 A;  1TWG A;  3GTK A;  3MAQ A;  4AN8 A;  1A36 A;  3K59 A;  2JA6 A;  1SMY D;  1I50 A;  2YU9 A;  2B9S B;  4KAW X;  1Y1V A;  1LPQ A;  1R49 A;  4GFQ A;  3KYL A;  3SJR A;  3GTJ A;  2R4G A;  1TL8 A;  2PMZ A;  4FYD A;  2E2H A;  2E2I A;  4LMO A;  4F3E A;  2A6H D;  4QCL A;  1I6V D;  4QIW A;  4D3Y A;  3CQZ A;  1HQM D;  1EH1 A;  2A69 D;  4Q5V A;  3WVO A;  4IP8 A;  1RR8 C;  3H0G A;  5MLC 9;  4NOK A;  5C9H A;  2O5J D;  3LF9 A;  3P9A A;  4D3Z A;  4H3T A;  5JSN B;  4NOM A;  1GE9 A;  3LHP S;  1K4T A;  1TWA A;  2WAQ A;  1TWF A;  2NVY A;  3K5O A;  2BE5 D;  3K57 A;  4Q5G A;  1K4S A;  3GTG A;  5JSB B;  2Y0S A;  1A31 A;  1Y69 8;  4KB4 A;  1IS1 A;  4NOL A;  4IP9 A;  3HKZ A;  4FGU A;  4O26 A;  1WCM A;  1YNJ D;  1WQH A;  1ISE A;  2R7Z A;  1IW7 D;  1NH3 A;  3K5M A;  3IAY A;  3K5N A;  4FXD A;  1TGO A;  3K58 A;  1YNN D;  4AYB A;  1A35 A;  4KC6 A;  1Q8I A;  3GTL A;  4AHC A;  2A68 D;  4L8I A;  4EJ3 A;  1TWH A;  3GTQ A;  1MIU A;  4OYD B;  1I3Q A;  3DU6 A; 
#chains in the Genus database with same CATH homology
 1K83 A;  2CW0 D;  1T8I A;  1R9T A;  2A6E D;  2R93 A;  2B63 A;  1EK8 A;  1ZYR D;  2NVX A;  3K5L A;  3FKI A;  2WB1 A;  1TWC A;  1RRJ A;  2R92 A;  4KDD A;  1SEU A;  4C2M A;  1Y1W A;  2JA7 A;  1V9M A;  1WQG A;  1WQF A;  3GTP A;  4JLR C;  2JA5 A;  5CQG A;  2F4Q A;  1SFO A;  3GTO A;  1EJ9 A;  1DD5 A;  3M4A A;  3GTM A;  3DU5 A;  2VUM A;  4KB2 A;  1R5Z A;  1SC7 A;  1TWG A;  3GTK A;  3MAQ A;  4AN8 A;  1A36 A;  3K59 A;  2JA6 A;  1SMY D;  1I50 A;  2YU9 A;  2B9S B;  4KAW X;  1Y1V A;  1LPQ A;  1R49 A;  4GFQ A;  3KYL A;  3SJR A;  3GTJ A;  2R4G A;  1TL8 A;  2PMZ A;  4FYD A;  2E2H A;  2E2I A;  4LMO A;  4F3E A;  2A6H D;  4QCL A;  1I6V D;  4QIW A;  4D3Y A;  3CQZ A;  1HQM D;  1EH1 A;  2A69 D;  4Q5V A;  3WVO A;  4IP8 A;  1RR8 C;  3H0G A;  5MLC 9;  4NOK A;  5C9H A;  2O5J D;  3LF9 A;  3P9A A;  4D3Z A;  4H3T A;  5JSN B;  4NOM A;  1GE9 A;  3LHP S;  1K4T A;  1TWA A;  2WAQ A;  1TWF A;  2NVY A;  3K5O A;  2BE5 D;  3K57 A;  4Q5G A;  1K4S A;  3GTG A;  5JSB B;  2Y0S A;  1A31 A;  1Y69 8;  4KB4 A;  1IS1 A;  4NOL A;  4IP9 A;  3HKZ A;  4FGU A;  4O26 A;  1WCM A;  1YNJ D;  1WQH A;  1ISE A;  2R7Z A;  1IW7 D;  1NH3 A;  3K5M A;  3IAY A;  3K5N A;  4FXD A;  1TGO A;  3K58 A;  1YNN D;  4AYB A;  1A35 A;  4KC6 A;  1Q8I A;  3GTL A;  4AHC A;  2A68 D;  4L8I A;  4EJ3 A;  1TWH A;  3GTQ A;  1MIU A;  4OYD B;  1I3Q A;  3DU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...