4JLRC

Crystal structure of a designed respiratory syncytial virus immunogen in complex with motavizumab
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
100
Chain Sequence
b'KDAERRFDKFVEAAKNKFDKFKAALDIKEERRKDMKKLARKEAEQARRAVRNRLSELLSKINDMPITNDQKKLMSNDVLKFAAEAEKKIEALAADAEDKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Motavizumab Fab heavy chain
publication title Proof of principle for epitope-focused vaccine design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 100
sequence length 103
chains with identical sequence S
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4jlrC00
5MLC9 4L8IA 3LF9A 1GE9A 1EK8A 5JSNB 1WQHA 1ISEA 4KC6A 4OYDB 1EH1A 4KDDA 3LHPS 4GFQA 4KB2A 4JLRC 1IS1A 1WQFA 1WQGA 5JSBB 4KAWX 1DD5A 1Y698 4KB4A
chains in the Genus database with same CATH superfamily
4Q5GA 3CQZA 3LF9A 1SC7A 1GE9A 2B63A 1A36A 4LMOA 3GTKA 1TWAA 3DU5A 2R93A 1EH1A 4KDDA 4KB2A 1MIUA 1IS1A 2F4QA 4NOLA 2R7ZA 2E2IA 1TGOA 1Q8IA 4NOKA 1WQGA 4AYBA 1RR8C 1YNND 1SFOA 1I6VD 1TWCA 4NOMA 4AN8A 1Y698 3K5LA 3GTMA 2JA5A 1TWGA 2R4GA 4FXDA 2A69D 1RRJA 4H3TA 1SEUA 3GTPA 2A68D 1YNJD 3IAYA 1WQHA 1ISEA 3H0GA 3K5OA 5C9HA 3LHPS 4JLRC 2NVXA 1LPQA 3GTOA 1A35A 2CW0D 4KAWX 2NVYA 4C2MA 2JA7A 2WB1A 4D3YA 2E2HA 4F3EA 3SJRA 1I3QA 2R92A 1T8IA 1Y1WA 2Y0SA 1K4TA 1ZYRD 4L8IA 2PMZA 2VUMA 1TWHA 1SMYD 5JSNB 2BE5D 4KC6A 4O26A 4GFQA 3GTLA 4FYDA 1R49A 3P9AA 2O5JD 1I50A 2A6ED 1HQMD 1R9TA 1DD5A 3K58A 4IP9A 3DU6A 1Y1VA 1TWFA 2B9SB 1NH3A 3GTJA 1A31A 4IP8A 3KYLA 5MLC9 1IW7D 1EK8A 1K83A 2WAQA 3FKIA 4EJ3A 3K5MA 2JA6A 3WVOA 4OYDB 4AHCA 1EJ9A 3GTGA 5CQGA 3GTQA 4QCLA 1WQFA 3K5NA 1R5ZA 4D3ZA 1K4SA 5JSBB 4FGUA 3M4AA 2A6HD 1WCMA 1TL8A 2YU9A 3MAQA 1V9MA 4QIWA 3K59A 3K57A 4Q5VA 4KB4A 3HKZA
chains in the Genus database with same CATH topology
4Q5GA 3CQZA 3LF9A 1SC7A 1GE9A 2B63A 1A36A 4LMOA 3GTKA 1TWAA 3DU5A 2R93A 1EH1A 4KDDA 4KB2A 1MIUA 1IS1A 2F4QA 4NOLA 2R7ZA 2E2IA 1TGOA 1Q8IA 4NOKA 1WQGA 4AYBA 1RR8C 1YNND 1SFOA 1I6VD 1TWCA 4NOMA 4AN8A 1Y698 3K5LA 3GTMA 2JA5A 1TWGA 2R4GA 4FXDA 2A69D 1RRJA 4H3TA 1SEUA 3GTPA 2A68D 1YNJD 3IAYA 1WQHA 1ISEA 3H0GA 3K5OA 5C9HA 3LHPS 4JLRC 2NVXA 1LPQA 3GTOA 1A35A 2CW0D 4KAWX 2NVYA 4C2MA 2JA7A 2WB1A 4D3YA 2E2HA 4F3EA 3SJRA 1I3QA 2R92A 1T8IA 1Y1WA 2Y0SA 1K4TA 1ZYRD 4L8IA 2PMZA 2VUMA 1TWHA 1SMYD 5JSNB 2BE5D 4KC6A 4O26A 4GFQA 3GTLA 4FYDA 1R49A 3P9AA 2O5JD 1I50A 2A6ED 1HQMD 1R9TA 1DD5A 3K58A 4IP9A 3DU6A 1Y1VA 1TWFA 2B9SB 1NH3A 3GTJA 1A31A 4IP8A 3KYLA 5MLC9 1IW7D 1EK8A 1K83A 2WAQA 3FKIA 4EJ3A 3K5MA 2JA6A 3WVOA 4OYDB 4AHCA 1EJ9A 3GTGA 5CQGA 3GTQA 4QCLA 1WQFA 3K5NA 1R5ZA 4D3ZA 1K4SA 5JSBB 4FGUA 3M4AA 2A6HD 1WCMA 1TL8A 2YU9A 3MAQA 1V9MA 4QIWA 3K59A 3K57A 4Q5VA 4KB4A 3HKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MLC 9;  4L8I A;  3LF9 A;  1GE9 A;  1EK8 A;  5JSN B;  1WQH A;  1ISE A;  4KC6 A;  4OYD B;  1EH1 A;  4KDD A;  3LHP S;  4GFQ A;  4KB2 A;  4JLR C;  1IS1 A;  1WQF A;  1WQG A;  5JSB B;  4KAW X;  1DD5 A;  1Y69 8;  4KB4 A; 
#chains in the Genus database with same CATH topology
 4Q5G A;  3CQZ A;  3LF9 A;  1SC7 A;  1GE9 A;  2B63 A;  1A36 A;  4LMO A;  3GTK A;  1TWA A;  3DU5 A;  2R93 A;  1EH1 A;  4KDD A;  4KB2 A;  1MIU A;  1IS1 A;  2F4Q A;  4NOL A;  2R7Z A;  2E2I A;  1TGO A;  1Q8I A;  4NOK A;  1WQG A;  4AYB A;  1RR8 C;  1YNN D;  1SFO A;  1I6V D;  1TWC A;  4NOM A;  4AN8 A;  1Y69 8;  3K5L A;  3GTM A;  2JA5 A;  1TWG A;  2R4G A;  4FXD A;  2A69 D;  1RRJ A;  4H3T A;  1SEU A;  3GTP A;  2A68 D;  1YNJ D;  3IAY A;  1WQH A;  1ISE A;  3H0G A;  3K5O A;  5C9H A;  3LHP S;  4JLR C;  2NVX A;  1LPQ A;  3GTO A;  1A35 A;  2CW0 D;  4KAW X;  2NVY A;  4C2M A;  2JA7 A;  2WB1 A;  4D3Y A;  2E2H A;  4F3E A;  3SJR A;  1I3Q A;  2R92 A;  1T8I A;  1Y1W A;  2Y0S A;  1K4T A;  1ZYR D;  4L8I A;  2PMZ A;  2VUM A;  1TWH A;  1SMY D;  5JSN B;  2BE5 D;  4KC6 A;  4O26 A;  4GFQ A;  3GTL A;  4FYD A;  1R49 A;  3P9A A;  2O5J D;  1I50 A;  2A6E D;  1HQM D;  1R9T A;  1DD5 A;  3K58 A;  4IP9 A;  3DU6 A;  1Y1V A;  1TWF A;  2B9S B;  1NH3 A;  3GTJ A;  1A31 A;  4IP8 A;  3KYL A;  5MLC 9;  1IW7 D;  1EK8 A;  1K83 A;  2WAQ A;  3FKI A;  4EJ3 A;  3K5M A;  2JA6 A;  3WVO A;  4OYD B;  4AHC A;  1EJ9 A;  3GTG A;  5CQG A;  3GTQ A;  4QCL A;  1WQF A;  3K5N A;  1R5Z A;  4D3Z A;  1K4S A;  5JSB B;  4FGU A;  3M4A A;  2A6H D;  1WCM A;  1TL8 A;  2YU9 A;  3MAQ A;  1V9M A;  4QIW A;  3K59 A;  3K57 A;  4Q5V A;  4KB4 A;  3HKZ A; 
#chains in the Genus database with same CATH homology
 4Q5G A;  3CQZ A;  3LF9 A;  1SC7 A;  1GE9 A;  2B63 A;  1A36 A;  4LMO A;  3GTK A;  1TWA A;  3DU5 A;  2R93 A;  1EH1 A;  4KDD A;  4KB2 A;  1MIU A;  1IS1 A;  2F4Q A;  4NOL A;  2R7Z A;  2E2I A;  1TGO A;  1Q8I A;  4NOK A;  1WQG A;  4AYB A;  1RR8 C;  1YNN D;  1SFO A;  1I6V D;  1TWC A;  4NOM A;  4AN8 A;  1Y69 8;  3K5L A;  3GTM A;  2JA5 A;  1TWG A;  2R4G A;  4FXD A;  2A69 D;  1RRJ A;  4H3T A;  1SEU A;  3GTP A;  2A68 D;  1YNJ D;  3IAY A;  1WQH A;  1ISE A;  3H0G A;  3K5O A;  5C9H A;  3LHP S;  4JLR C;  2NVX A;  1LPQ A;  3GTO A;  1A35 A;  2CW0 D;  4KAW X;  2NVY A;  4C2M A;  2JA7 A;  2WB1 A;  4D3Y A;  2E2H A;  4F3E A;  3SJR A;  1I3Q A;  2R92 A;  1T8I A;  1Y1W A;  2Y0S A;  1K4T A;  1ZYR D;  4L8I A;  2PMZ A;  2VUM A;  1TWH A;  1SMY D;  5JSN B;  2BE5 D;  4KC6 A;  4O26 A;  4GFQ A;  3GTL A;  4FYD A;  1R49 A;  3P9A A;  2O5J D;  1I50 A;  2A6E D;  1HQM D;  1R9T A;  1DD5 A;  3K58 A;  4IP9 A;  3DU6 A;  1Y1V A;  1TWF A;  2B9S B;  1NH3 A;  3GTJ A;  1A31 A;  4IP8 A;  3KYL A;  5MLC 9;  1IW7 D;  1EK8 A;  1K83 A;  2WAQ A;  3FKI A;  4EJ3 A;  3K5M A;  2JA6 A;  3WVO A;  4OYD B;  4AHC A;  1EJ9 A;  3GTG A;  5CQG A;  3GTQ A;  4QCL A;  1WQF A;  3K5N A;  1R5Z A;  4D3Z A;  1K4S A;  5JSB B;  4FGU A;  3M4A A;  2A6H D;  1WCM A;  1TL8 A;  2YU9 A;  3MAQ A;  1V9M A;  4QIW A;  3K59 A;  3K57 A;  4Q5V A;  4KB4 A;  3HKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...