4JLRC

Crystal structure of a designed respiratory syncytial virus immunogen in complex with motavizumab
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
100
Chain Sequence
KDAERRFDKFVEAAKNKFDKFKAALDIKEERRKDMKKLARKEAEQARRAVRNRLSELLSKINDMPITNDQKKLMSNDVLKFAAEAEKKIEALAADAEDKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proof of principle for epitope-focused vaccine design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Motavizumab Fab heavy chain
total genus 29
structure length 100
sequence length 103
chains with identical sequence S
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4jlrC00
4KDDA 1GE9A 5JSNB 3LHPS 4KB2A 3LF9A 1Y698 1IS1A 4JLRC 4L8IA 1ISEA 1DD5A 1EH1A 4KB4A 1WQGA 1WQHA 4KC6A 4GFQA 4OYDB 1WQFA 1EK8A 5JSBB 5MLC9 4KAWX
chains in the Genus database with same CATH superfamily
1YNJD 4KDDA 2A68D 1I3QA 1R9TA 1GE9A 1YNND 4FXDA 4O26A 1TWGA 3LF9A 3GTLA 2NVYA 2A6HD 1TWHA 3GTMA 4QCLA 2JA5A 1IS1A 5CQGA 4FYDA 1K83A 2R93A 4KB4A 3K5LA 4KC6A 4OYDB 2E2HA 3K57A 3P9AA 2BE5D 5MLC9 2JA7A 1T8IA 1A35A 3K58A 1A36A 2R92A 4IP9A 1RR8C 1SMYD 1TGOA 2WB1A 1NH3A 5JSNB 4C2MA 1MIUA 4AHCA 4H3TA 4D3ZA 1WCMA 1TWCA 2R7ZA 1I6VD 4AN8A 1R49A 4Q5GA 3HKZA 1DD5A 3SJRA 4EJ3A 1EH1A 1SC7A 4QIWA 1Q8IA 1WQHA 1TWFA 1WQFA 1EK8A 3DU5A 4LMOA 5JSBB 5C9HA 2R4GA 1Y1WA 4D3YA 2F4QA 2CW0D 2A6ED 1IW7D 1K4TA 4NOLA 3LHPS 1HQMD 1V9MA 3KYLA 3GTKA 4NOMA 4KB2A 1LPQA 3K59A 2A69D 1Y698 1A31A 1TL8A 4JLRC 3GTGA 1ISEA 1ZYRD 1R5ZA 2E2IA 3GTPA 2VUMA 1Y1VA 2B9SB 4GFQA 1EJ9A 3MAQA 2JA6A 3WVOA 4NOKA 4FGUA 3K5MA 2YU9A 3M4AA 3K5OA 3CQZA 4Q5VA 3DU6A 4IP8A 3H0GA 3GTJA 3GTQA 3GTOA 2NVXA 2Y0SA 4L8IA 1TWAA 2O5JD 2B63A 3FKIA 3K5NA 1WQGA 1SFOA 2PMZA 4AYBA 1K4SA 4F3EA 1RRJA 2WAQA 3IAYA 1SEUA 4KAWX 1I50A
chains in the Genus database with same CATH topology
1YNJD 4KDDA 2A68D 1I3QA 1R9TA 1GE9A 1YNND 4FXDA 4O26A 1TWGA 3LF9A 3GTLA 2NVYA 2A6HD 1TWHA 3GTMA 4QCLA 2JA5A 1IS1A 5CQGA 4FYDA 1K83A 2R93A 4KB4A 3K5LA 4KC6A 4OYDB 2E2HA 3K57A 3P9AA 2BE5D 5MLC9 2JA7A 1T8IA 1A35A 3K58A 1A36A 2R92A 4IP9A 1RR8C 1SMYD 1TGOA 2WB1A 1NH3A 5JSNB 4C2MA 1MIUA 4AHCA 4H3TA 4D3ZA 1WCMA 1TWCA 2R7ZA 1I6VD 4AN8A 1R49A 4Q5GA 3HKZA 1DD5A 3SJRA 4EJ3A 1EH1A 1SC7A 4QIWA 1Q8IA 1WQHA 1TWFA 1WQFA 1EK8A 3DU5A 4LMOA 5JSBB 5C9HA 2R4GA 1Y1WA 4D3YA 2F4QA 2CW0D 2A6ED 1IW7D 1K4TA 4NOLA 3LHPS 1HQMD 1V9MA 3KYLA 3GTKA 4NOMA 4KB2A 1LPQA 3K59A 2A69D 1Y698 1A31A 1TL8A 4JLRC 3GTGA 1ISEA 1ZYRD 1R5ZA 2E2IA 3GTPA 2VUMA 1Y1VA 2B9SB 4GFQA 1EJ9A 3MAQA 2JA6A 3WVOA 4NOKA 4FGUA 3K5MA 2YU9A 3M4AA 3K5OA 3CQZA 4Q5VA 3DU6A 4IP8A 3H0GA 3GTJA 3GTQA 3GTOA 2NVXA 2Y0SA 4L8IA 1TWAA 2O5JD 2B63A 3FKIA 3K5NA 1WQGA 1SFOA 2PMZA 4AYBA 1K4SA 4F3EA 1RRJA 2WAQA 3IAYA 1SEUA 4KAWX 1I50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDD A;  1GE9 A;  5JSN B;  3LHP S;  4KB2 A;  3LF9 A;  1Y69 8;  1IS1 A;  4JLR C;  4L8I A;  1ISE A;  1DD5 A;  1EH1 A;  4KB4 A;  1WQG A;  1WQH A;  4KC6 A;  4GFQ A;  4OYD B;  1WQF A;  1EK8 A;  5JSB B;  5MLC 9;  4KAW X; 
#chains in the Genus database with same CATH topology
 1YNJ D;  4KDD A;  2A68 D;  1I3Q A;  1R9T A;  1GE9 A;  1YNN D;  4FXD A;  4O26 A;  1TWG A;  3LF9 A;  3GTL A;  2NVY A;  2A6H D;  1TWH A;  3GTM A;  4QCL A;  2JA5 A;  1IS1 A;  5CQG A;  4FYD A;  1K83 A;  2R93 A;  4KB4 A;  3K5L A;  4KC6 A;  4OYD B;  2E2H A;  3K57 A;  3P9A A;  2BE5 D;  5MLC 9;  2JA7 A;  1T8I A;  1A35 A;  3K58 A;  1A36 A;  2R92 A;  4IP9 A;  1RR8 C;  1SMY D;  1TGO A;  2WB1 A;  1NH3 A;  5JSN B;  4C2M A;  1MIU A;  4AHC A;  4H3T A;  4D3Z A;  1WCM A;  1TWC A;  2R7Z A;  1I6V D;  4AN8 A;  1R49 A;  4Q5G A;  3HKZ A;  1DD5 A;  3SJR A;  4EJ3 A;  1EH1 A;  1SC7 A;  4QIW A;  1Q8I A;  1WQH A;  1TWF A;  1WQF A;  1EK8 A;  3DU5 A;  4LMO A;  5JSB B;  5C9H A;  2R4G A;  1Y1W A;  4D3Y A;  2F4Q A;  2CW0 D;  2A6E D;  1IW7 D;  1K4T A;  4NOL A;  3LHP S;  1HQM D;  1V9M A;  3KYL A;  3GTK A;  4NOM A;  4KB2 A;  1LPQ A;  3K59 A;  2A69 D;  1Y69 8;  1A31 A;  1TL8 A;  4JLR C;  3GTG A;  1ISE A;  1ZYR D;  1R5Z A;  2E2I A;  3GTP A;  2VUM A;  1Y1V A;  2B9S B;  4GFQ A;  1EJ9 A;  3MAQ A;  2JA6 A;  3WVO A;  4NOK A;  4FGU A;  3K5M A;  2YU9 A;  3M4A A;  3K5O A;  3CQZ A;  4Q5V A;  3DU6 A;  4IP8 A;  3H0G A;  3GTJ A;  3GTQ A;  3GTO A;  2NVX A;  2Y0S A;  4L8I A;  1TWA A;  2O5J D;  2B63 A;  3FKI A;  3K5N A;  1WQG A;  1SFO A;  2PMZ A;  4AYB A;  1K4S A;  4F3E A;  1RRJ A;  2WAQ A;  3IAY A;  1SEU A;  4KAW X;  1I50 A; 
#chains in the Genus database with same CATH homology
 1YNJ D;  4KDD A;  2A68 D;  1I3Q A;  1R9T A;  1GE9 A;  1YNN D;  4FXD A;  4O26 A;  1TWG A;  3LF9 A;  3GTL A;  2NVY A;  2A6H D;  1TWH A;  3GTM A;  4QCL A;  2JA5 A;  1IS1 A;  5CQG A;  4FYD A;  1K83 A;  2R93 A;  4KB4 A;  3K5L A;  4KC6 A;  4OYD B;  2E2H A;  3K57 A;  3P9A A;  2BE5 D;  5MLC 9;  2JA7 A;  1T8I A;  1A35 A;  3K58 A;  1A36 A;  2R92 A;  4IP9 A;  1RR8 C;  1SMY D;  1TGO A;  2WB1 A;  1NH3 A;  5JSN B;  4C2M A;  1MIU A;  4AHC A;  4H3T A;  4D3Z A;  1WCM A;  1TWC A;  2R7Z A;  1I6V D;  4AN8 A;  1R49 A;  4Q5G A;  3HKZ A;  1DD5 A;  3SJR A;  4EJ3 A;  1EH1 A;  1SC7 A;  4QIW A;  1Q8I A;  1WQH A;  1TWF A;  1WQF A;  1EK8 A;  3DU5 A;  4LMO A;  5JSB B;  5C9H A;  2R4G A;  1Y1W A;  4D3Y A;  2F4Q A;  2CW0 D;  2A6E D;  1IW7 D;  1K4T A;  4NOL A;  3LHP S;  1HQM D;  1V9M A;  3KYL A;  3GTK A;  4NOM A;  4KB2 A;  1LPQ A;  3K59 A;  2A69 D;  1Y69 8;  1A31 A;  1TL8 A;  4JLR C;  3GTG A;  1ISE A;  1ZYR D;  1R5Z A;  2E2I A;  3GTP A;  2VUM A;  1Y1V A;  2B9S B;  4GFQ A;  1EJ9 A;  3MAQ A;  2JA6 A;  3WVO A;  4NOK A;  4FGU A;  3K5M A;  2YU9 A;  3M4A A;  3K5O A;  3CQZ A;  4Q5V A;  3DU6 A;  4IP8 A;  3H0G A;  3GTJ A;  3GTQ A;  3GTO A;  2NVX A;  2Y0S A;  4L8I A;  1TWA A;  2O5J D;  2B63 A;  3FKI A;  3K5N A;  1WQG A;  1SFO A;  2PMZ A;  4AYB A;  1K4S A;  4F3E A;  1RRJ A;  2WAQ A;  3IAY A;  1SEU A;  4KAW X;  1I50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...