4JLRC

Crystal structure of a designed respiratory syncytial virus immunogen in complex with motavizumab
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
100
Chain Sequence
KDAERRFDKFVEAAKNKFDKFKAALDIKEERRKDMKKLARKEAEQARRAVRNRLSELLSKINDMPITNDQKKLMSNDVLKFAAEAEKKIEALAADAEDKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Motavizumab Fab heavy chain
publication title Proof of principle for epitope-focused vaccine design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 100
sequence length 103
chains with identical sequence S
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4jlrC00
5MLC9 4KC6A 1GE9A 1DD5A 3LF9A 1EH1A 5JSBB 1WQFA 4KDDA 1WQGA 4OYDB 4JLRC 5JSNB 1EK8A 3LHPS 1WQHA 4KB4A 1Y698 4GFQA 1IS1A 4KAWX 4KB2A 1ISEA 4L8IA
chains in the Genus database with same CATH superfamily
3GTJA 4KC6A 2JA5A 3DU6A 3K59A 1HQMD 4D3ZA 1TWAA 1MIUA 4IP8A 2E2IA 4D3YA 1LPQA 2A69D 1A35A 4AN8A 1TWCA 4NOKA 3H0GA 2B9SB 2R4GA 3K5LA 1Y698 2A6ED 1YNJD 1IS1A 4KB2A 1V9MA 1TGOA 3K5OA 1ISEA 1K83A 4EJ3A 3MAQA 4L8IA 2O5JD 1GE9A 2R93A 4C2MA 1R5ZA 1SMYD 3GTQA 5JSBB 3K5MA 1TWFA 3CQZA 4KDDA 1SC7A 4FYDA 1A36A 1SFOA 3SJRA 2VUMA 1K4TA 5CQGA 5JSNB 1EK8A 3LHPS 4F3EA 1K4SA 2WB1A 1RR8C 2R92A 1I3QA 1YNND 4QCLA 1T8IA 3K5NA 3IAYA 3HKZA 4H3TA 1EH1A 2YU9A 4NOLA 2Y0SA 1WQFA 2JA7A 4OYDB 4Q5GA 1TWHA 3GTGA 2JA6A 3WVOA 1TL8A 4O26A 4AYBA 1WCMA 2BE5D 1Y1WA 1NH3A 2NVYA 4GFQA 4FXDA 1R49A 4FGUA 3FKIA 3GTMA 4IP9A 3K57A 1RRJA 2CW0D 5MLC9 3K58A 1DD5A 3LF9A 2PMZA 2B63A 2NVXA 3GTPA 4QIWA 1A31A 2A6HD 2WAQA 3P9AA 2A68D 1WQGA 4Q5VA 2F4QA 1Y1VA 3DU5A 4AHCA 3GTKA 4JLRC 4LMOA 1ZYRD 1WQHA 2R7ZA 3M4AA 4NOMA 1TWGA 2E2HA 4KB4A 5C9HA 1Q8IA 3GTLA 1IW7D 1I6VD 4KAWX 1I50A 3KYLA 1EJ9A 3GTOA 1R9TA 1SEUA
chains in the Genus database with same CATH topology
3GTJA 4KC6A 2JA5A 3DU6A 3K59A 1HQMD 4D3ZA 1TWAA 1MIUA 4IP8A 2E2IA 4D3YA 1LPQA 2A69D 1A35A 4AN8A 1TWCA 4NOKA 3H0GA 2B9SB 2R4GA 3K5LA 1Y698 2A6ED 1YNJD 1IS1A 4KB2A 1V9MA 1TGOA 3K5OA 1ISEA 1K83A 4EJ3A 3MAQA 4L8IA 2O5JD 1GE9A 2R93A 4C2MA 1R5ZA 1SMYD 3GTQA 5JSBB 3K5MA 1TWFA 3CQZA 4KDDA 1SC7A 4FYDA 1A36A 1SFOA 3SJRA 2VUMA 1K4TA 5CQGA 5JSNB 1EK8A 3LHPS 4F3EA 1K4SA 2WB1A 1RR8C 2R92A 1I3QA 1YNND 4QCLA 1T8IA 3K5NA 3IAYA 3HKZA 4H3TA 1EH1A 2YU9A 4NOLA 2Y0SA 1WQFA 2JA7A 4OYDB 4Q5GA 1TWHA 3GTGA 2JA6A 3WVOA 1TL8A 4O26A 4AYBA 1WCMA 2BE5D 1Y1WA 1NH3A 2NVYA 4GFQA 4FXDA 1R49A 4FGUA 3FKIA 3GTMA 4IP9A 3K57A 1RRJA 2CW0D 5MLC9 3K58A 1DD5A 3LF9A 2PMZA 2B63A 2NVXA 3GTPA 4QIWA 1A31A 2A6HD 2WAQA 3P9AA 2A68D 1WQGA 4Q5VA 2F4QA 1Y1VA 3DU5A 4AHCA 3GTKA 4JLRC 4LMOA 1ZYRD 1WQHA 2R7ZA 3M4AA 4NOMA 1TWGA 2E2HA 4KB4A 5C9HA 1Q8IA 3GTLA 1IW7D 1I6VD 4KAWX 1I50A 3KYLA 1EJ9A 3GTOA 1R9TA 1SEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MLC 9;  4KC6 A;  1GE9 A;  1DD5 A;  3LF9 A;  1EH1 A;  5JSB B;  1WQF A;  4KDD A;  1WQG A;  4OYD B;  4JLR C;  5JSN B;  1EK8 A;  3LHP S;  1WQH A;  4KB4 A;  1Y69 8;  4GFQ A;  1IS1 A;  4KAW X;  4KB2 A;  1ISE A;  4L8I A; 
#chains in the Genus database with same CATH topology
 3GTJ A;  4KC6 A;  2JA5 A;  3DU6 A;  3K59 A;  1HQM D;  4D3Z A;  1TWA A;  1MIU A;  4IP8 A;  2E2I A;  4D3Y A;  1LPQ A;  2A69 D;  1A35 A;  4AN8 A;  1TWC A;  4NOK A;  3H0G A;  2B9S B;  2R4G A;  3K5L A;  1Y69 8;  2A6E D;  1YNJ D;  1IS1 A;  4KB2 A;  1V9M A;  1TGO A;  3K5O A;  1ISE A;  1K83 A;  4EJ3 A;  3MAQ A;  4L8I A;  2O5J D;  1GE9 A;  2R93 A;  4C2M A;  1R5Z A;  1SMY D;  3GTQ A;  5JSB B;  3K5M A;  1TWF A;  3CQZ A;  4KDD A;  1SC7 A;  4FYD A;  1A36 A;  1SFO A;  3SJR A;  2VUM A;  1K4T A;  5CQG A;  5JSN B;  1EK8 A;  3LHP S;  4F3E A;  1K4S A;  2WB1 A;  1RR8 C;  2R92 A;  1I3Q A;  1YNN D;  4QCL A;  1T8I A;  3K5N A;  3IAY A;  3HKZ A;  4H3T A;  1EH1 A;  2YU9 A;  4NOL A;  2Y0S A;  1WQF A;  2JA7 A;  4OYD B;  4Q5G A;  1TWH A;  3GTG A;  2JA6 A;  3WVO A;  1TL8 A;  4O26 A;  4AYB A;  1WCM A;  2BE5 D;  1Y1W A;  1NH3 A;  2NVY A;  4GFQ A;  4FXD A;  1R49 A;  4FGU A;  3FKI A;  3GTM A;  4IP9 A;  3K57 A;  1RRJ A;  2CW0 D;  5MLC 9;  3K58 A;  1DD5 A;  3LF9 A;  2PMZ A;  2B63 A;  2NVX A;  3GTP A;  4QIW A;  1A31 A;  2A6H D;  2WAQ A;  3P9A A;  2A68 D;  1WQG A;  4Q5V A;  2F4Q A;  1Y1V A;  3DU5 A;  4AHC A;  3GTK A;  4JLR C;  4LMO A;  1ZYR D;  1WQH A;  2R7Z A;  3M4A A;  4NOM A;  1TWG A;  2E2H A;  4KB4 A;  5C9H A;  1Q8I A;  3GTL A;  1IW7 D;  1I6V D;  4KAW X;  1I50 A;  3KYL A;  1EJ9 A;  3GTO A;  1R9T A;  1SEU A; 
#chains in the Genus database with same CATH homology
 3GTJ A;  4KC6 A;  2JA5 A;  3DU6 A;  3K59 A;  1HQM D;  4D3Z A;  1TWA A;  1MIU A;  4IP8 A;  2E2I A;  4D3Y A;  1LPQ A;  2A69 D;  1A35 A;  4AN8 A;  1TWC A;  4NOK A;  3H0G A;  2B9S B;  2R4G A;  3K5L A;  1Y69 8;  2A6E D;  1YNJ D;  1IS1 A;  4KB2 A;  1V9M A;  1TGO A;  3K5O A;  1ISE A;  1K83 A;  4EJ3 A;  3MAQ A;  4L8I A;  2O5J D;  1GE9 A;  2R93 A;  4C2M A;  1R5Z A;  1SMY D;  3GTQ A;  5JSB B;  3K5M A;  1TWF A;  3CQZ A;  4KDD A;  1SC7 A;  4FYD A;  1A36 A;  1SFO A;  3SJR A;  2VUM A;  1K4T A;  5CQG A;  5JSN B;  1EK8 A;  3LHP S;  4F3E A;  1K4S A;  2WB1 A;  1RR8 C;  2R92 A;  1I3Q A;  1YNN D;  4QCL A;  1T8I A;  3K5N A;  3IAY A;  3HKZ A;  4H3T A;  1EH1 A;  2YU9 A;  4NOL A;  2Y0S A;  1WQF A;  2JA7 A;  4OYD B;  4Q5G A;  1TWH A;  3GTG A;  2JA6 A;  3WVO A;  1TL8 A;  4O26 A;  4AYB A;  1WCM A;  2BE5 D;  1Y1W A;  1NH3 A;  2NVY A;  4GFQ A;  4FXD A;  1R49 A;  4FGU A;  3FKI A;  3GTM A;  4IP9 A;  3K57 A;  1RRJ A;  2CW0 D;  5MLC 9;  3K58 A;  1DD5 A;  3LF9 A;  2PMZ A;  2B63 A;  2NVX A;  3GTP A;  4QIW A;  1A31 A;  2A6H D;  2WAQ A;  3P9A A;  2A68 D;  1WQG A;  4Q5V A;  2F4Q A;  1Y1V A;  3DU5 A;  4AHC A;  3GTK A;  4JLR C;  4LMO A;  1ZYR D;  1WQH A;  2R7Z A;  3M4A A;  4NOM A;  1TWG A;  2E2H A;  4KB4 A;  5C9H A;  1Q8I A;  3GTL A;  1IW7 D;  1I6V D;  4KAW X;  1I50 A;  3KYL A;  1EJ9 A;  3GTO A;  1R9T A;  1SEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...