3SJRA

Crystal structure of conserved unkown function protein cv_1783 from chromobacterium violaceum atcc 12472
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
126
structure length
126
Chain Sequence
ISLSQGAQAAALLFSAAMDQISRLAELDIEPVRLPESELTGDSHSQHLLLGMEILMELYRQQHPDWTAPAIRQAFAPLARAGLERGYQEACQVLRQLNVYTPAVAGQLQGLLLLTQRLFEERLQIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of conserved unkown function protein CV_1783 from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
total genus 44
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18433 DUF5610 Domain of unknown function (DUF5610)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.90 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 3sjrA00
3SJRA
chains in the Genus database with same CATH superfamily
4Q5GA 1TGOA 2R92A 4KC6A 4KDDA 1SMYD 4D3ZA 1Y1WA 2A69D 1TWAA 4NOMA 1WQGA 1R5ZA 3GTGA 4FGUA 1TWCA 1TWFA 2CW0D 3DU5A 4KB2A 4AYBA 3SJRA 1I3QA 1ZYRD 1EJ9A 1WQHA 3P9AA 1R9TA 2F4QA 1K4TA 1Q8IA 3GTQA 1GE9A 1TWHA 1RRJA 2WAQA 2JA6A 4F3EA 4FXDA 4O26A 1A31A 1TWGA 3GTLA 3K57A 1WQFA 4IP8A 5CQGA 2A68D 1EK8A 4H3TA 1I50A 1EH1A 2B9SB 1HQMD 4L8IA 4EJ3A 3GTMA 1NH3A 3K5OA 2A6HD 1IW7D 4C2MA 3K5NA 4QCLA 1SFOA 2BE5D 1T8IA 4GFQA 1RR8C 2Y0SA 2JA7A 3GTJA 4FYDA 1I6VD 2YU9A 2O5JD 2PMZA 3HKZA 1LPQA 2E2HA 3IAYA 1R49A 1WCMA 5JSNB 3H0GA 4JLRC 4AHCA 4KAWX 2E2IA 3M4AA 1MIUA 1A35A 4KB4A 4IP9A 3K59A 1Y698 2VUMA 4Q5VA 1DD5A 3GTPA 1V9MA 3GTKA 2R7ZA 1YNJD 1SEUA 4OYDB 2R4GA 4D3YA 2NVYA 4NOLA 4NOKA 2B63A 1IS1A 3MAQA 3DU6A 3CQZA 2JA5A 2A6ED 1SC7A 1TL8A 3LHPS 4AN8A 3K5LA 1Y1VA 5C9HA 5JSBB 1K83A 1A36A 3WVOA 3KYLA 1K4SA 3FKIA 3GTOA 2R93A 5MLC9 1YNND 3K5MA 2WB1A 3K58A 1ISEA 4LMOA 3LF9A 4QIWA 2NVXA
chains in the Genus database with same CATH topology
4Q5GA 1TGOA 2R92A 4KC6A 4KDDA 1SMYD 4D3ZA 1Y1WA 2A69D 1TWAA 4NOMA 1WQGA 1R5ZA 3GTGA 4FGUA 1TWCA 1TWFA 2CW0D 3DU5A 4KB2A 4AYBA 3SJRA 1I3QA 1ZYRD 1EJ9A 1WQHA 3P9AA 1R9TA 2F4QA 1K4TA 1Q8IA 3GTQA 1GE9A 1TWHA 1RRJA 2WAQA 2JA6A 4F3EA 4FXDA 4O26A 1A31A 1TWGA 3GTLA 3K57A 1WQFA 4IP8A 5CQGA 2A68D 1EK8A 4H3TA 1I50A 1EH1A 2B9SB 1HQMD 4L8IA 4EJ3A 3GTMA 1NH3A 3K5OA 2A6HD 1IW7D 4C2MA 3K5NA 4QCLA 1SFOA 2BE5D 1T8IA 4GFQA 1RR8C 2Y0SA 2JA7A 3GTJA 4FYDA 1I6VD 2YU9A 2O5JD 2PMZA 3HKZA 1LPQA 2E2HA 3IAYA 1R49A 1WCMA 5JSNB 3H0GA 4JLRC 4AHCA 4KAWX 2E2IA 3M4AA 1MIUA 1A35A 4KB4A 4IP9A 3K59A 1Y698 2VUMA 4Q5VA 1DD5A 3GTPA 1V9MA 3GTKA 2R7ZA 1YNJD 1SEUA 4OYDB 2R4GA 4D3YA 2NVYA 4NOLA 4NOKA 2B63A 1IS1A 3MAQA 3DU6A 3CQZA 2JA5A 2A6ED 1SC7A 1TL8A 3LHPS 4AN8A 3K5LA 1Y1VA 5C9HA 5JSBB 1K83A 1A36A 3WVOA 3KYLA 1K4SA 3FKIA 3GTOA 2R93A 5MLC9 1YNND 3K5MA 2WB1A 3K58A 1ISEA 4LMOA 3LF9A 4QIWA 2NVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJR A; 
#chains in the Genus database with same CATH topology
 4Q5G A;  1TGO A;  2R92 A;  4KC6 A;  4KDD A;  1SMY D;  4D3Z A;  1Y1W A;  2A69 D;  1TWA A;  4NOM A;  1WQG A;  1R5Z A;  3GTG A;  4FGU A;  1TWC A;  1TWF A;  2CW0 D;  3DU5 A;  4KB2 A;  4AYB A;  3SJR A;  1I3Q A;  1ZYR D;  1EJ9 A;  1WQH A;  3P9A A;  1R9T A;  2F4Q A;  1K4T A;  1Q8I A;  3GTQ A;  1GE9 A;  1TWH A;  1RRJ A;  2WAQ A;  2JA6 A;  4F3E A;  4FXD A;  4O26 A;  1A31 A;  1TWG A;  3GTL A;  3K57 A;  1WQF A;  4IP8 A;  5CQG A;  2A68 D;  1EK8 A;  4H3T A;  1I50 A;  1EH1 A;  2B9S B;  1HQM D;  4L8I A;  4EJ3 A;  3GTM A;  1NH3 A;  3K5O A;  2A6H D;  1IW7 D;  4C2M A;  3K5N A;  4QCL A;  1SFO A;  2BE5 D;  1T8I A;  4GFQ A;  1RR8 C;  2Y0S A;  2JA7 A;  3GTJ A;  4FYD A;  1I6V D;  2YU9 A;  2O5J D;  2PMZ A;  3HKZ A;  1LPQ A;  2E2H A;  3IAY A;  1R49 A;  1WCM A;  5JSN B;  3H0G A;  4JLR C;  4AHC A;  4KAW X;  2E2I A;  3M4A A;  1MIU A;  1A35 A;  4KB4 A;  4IP9 A;  3K59 A;  1Y69 8;  2VUM A;  4Q5V A;  1DD5 A;  3GTP A;  1V9M A;  3GTK A;  2R7Z A;  1YNJ D;  1SEU A;  4OYD B;  2R4G A;  4D3Y A;  2NVY A;  4NOL A;  4NOK A;  2B63 A;  1IS1 A;  3MAQ A;  3DU6 A;  3CQZ A;  2JA5 A;  2A6E D;  1SC7 A;  1TL8 A;  3LHP S;  4AN8 A;  3K5L A;  1Y1V A;  5C9H A;  5JSB B;  1K83 A;  1A36 A;  3WVO A;  3KYL A;  1K4S A;  3FKI A;  3GTO A;  2R93 A;  5MLC 9;  1YNN D;  3K5M A;  2WB1 A;  3K58 A;  1ISE A;  4LMO A;  3LF9 A;  4QIW A;  2NVX A; 
#chains in the Genus database with same CATH homology
 4Q5G A;  1TGO A;  2R92 A;  4KC6 A;  4KDD A;  1SMY D;  4D3Z A;  1Y1W A;  2A69 D;  1TWA A;  4NOM A;  1WQG A;  1R5Z A;  3GTG A;  4FGU A;  1TWC A;  1TWF A;  2CW0 D;  3DU5 A;  4KB2 A;  4AYB A;  3SJR A;  1I3Q A;  1ZYR D;  1EJ9 A;  1WQH A;  3P9A A;  1R9T A;  2F4Q A;  1K4T A;  1Q8I A;  3GTQ A;  1GE9 A;  1TWH A;  1RRJ A;  2WAQ A;  2JA6 A;  4F3E A;  4FXD A;  4O26 A;  1A31 A;  1TWG A;  3GTL A;  3K57 A;  1WQF A;  4IP8 A;  5CQG A;  2A68 D;  1EK8 A;  4H3T A;  1I50 A;  1EH1 A;  2B9S B;  1HQM D;  4L8I A;  4EJ3 A;  3GTM A;  1NH3 A;  3K5O A;  2A6H D;  1IW7 D;  4C2M A;  3K5N A;  4QCL A;  1SFO A;  2BE5 D;  1T8I A;  4GFQ A;  1RR8 C;  2Y0S A;  2JA7 A;  3GTJ A;  4FYD A;  1I6V D;  2YU9 A;  2O5J D;  2PMZ A;  3HKZ A;  1LPQ A;  2E2H A;  3IAY A;  1R49 A;  1WCM A;  5JSN B;  3H0G A;  4JLR C;  4AHC A;  4KAW X;  2E2I A;  3M4A A;  1MIU A;  1A35 A;  4KB4 A;  4IP9 A;  3K59 A;  1Y69 8;  2VUM A;  4Q5V A;  1DD5 A;  3GTP A;  1V9M A;  3GTK A;  2R7Z A;  1YNJ D;  1SEU A;  4OYD B;  2R4G A;  4D3Y A;  2NVY A;  4NOL A;  4NOK A;  2B63 A;  1IS1 A;  3MAQ A;  3DU6 A;  3CQZ A;  2JA5 A;  2A6E D;  1SC7 A;  1TL8 A;  3LHP S;  4AN8 A;  3K5L A;  1Y1V A;  5C9H A;  5JSB B;  1K83 A;  1A36 A;  3WVO A;  3KYL A;  1K4S A;  3FKI A;  3GTO A;  2R93 A;  5MLC 9;  1YNN D;  3K5M A;  2WB1 A;  3K58 A;  1ISE A;  4LMO A;  3LF9 A;  4QIW A;  2NVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...