3SJRA

Crystal structure of conserved unkown function protein cv_1783 from chromobacterium violaceum atcc 12472
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
126
structure length
126
Chain Sequence
b'ISLSQGAQAAALLFSAAMDQISRLAELDIEPVRLPESELTGDSHSQHLLLGMEILMELYRQQHPDWTAPAIRQAFAPLARAGLERGYQEACQVLRQLNVYTPAVAGQLQGLLLLTQRLFEERLQIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Chromobacterium violaceum
publication title Crystal structure of conserved unkown function protein CV_1783 from Chromobacterium violaceum ATCC 12472
rcsb
total genus 44
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18433 DUF5610 Domain of unknown function (DUF5610)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.90 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 3sjrA00
3SJRA
chains in the Genus database with same CATH superfamily
4NOKA 2O5JD 1HQMD 3K5LA 4GFQA 2PMZA 4KC6A 1TL8A 3GTGA 3DU5A 2NVYA 3H0GA 3GTQA 4KDDA 2E2IA 2A6ED 4EJ3A 1I3QA 4Q5GA 5JSNB 1R49A 4FYDA 1I6VD 4NOLA 2VUMA 1GE9A 2JA7A 3KYLA 4JLRC 3IAYA 4L8IA 1K4TA 4O26A 3K59A 1R5ZA 3FKIA 3GTPA 2F4QA 1TWFA 1R9TA 1V9MA 4F3EA 2NVXA 2YU9A 1I50A 1K83A 1TWAA 1K4SA 1DD5A 4FXDA 1IW7D 1RRJA 3P9AA 5CQGA 3WVOA 1SC7A 4D3YA 2E2HA 3K5NA 1EK8A 5MLC9 3CQZA 2R7ZA 1EJ9A 2R92A 3K5MA 1Q8IA 2A68D 4QCLA 1WQHA 5C9HA 4H3TA 5JSBB 1LPQA 3GTOA 4NOMA 4AYBA 3GTKA 1ISEA 1T8IA 1RR8C 1TGOA 4KB4A 4Q5VA 3M4AA 3GTJA 2B63A 2JA5A 4OYDB 2JA6A 4KAWX 1WQGA 1TWCA 4LMOA 1A36A 4IP8A 2Y0SA 2A69D 4FGUA 1YNND 4IP9A 3MAQA 1IS1A 1MIUA 1A31A 2B9SB 3SJRA 1NH3A 1A35A 3GTLA 4AN8A 3K5OA 3GTMA 4AHCA 2BE5D 2WB1A 1WQFA 4QIWA 1EH1A 1YNJD 3LHPS 3DU6A 1SFOA 1ZYRD 2R93A 1SEUA 1TWGA 2WAQA 3K58A 4C2MA 1Y1VA 2R4GA 1TWHA 1WCMA 3HKZA 2CW0D 4D3ZA 1Y1WA 4KB2A 3LF9A 3K57A 1SMYD 1Y698 2A6HD
chains in the Genus database with same CATH topology
4NOKA 2O5JD 1HQMD 3K5LA 4GFQA 2PMZA 4KC6A 1TL8A 3GTGA 3DU5A 2NVYA 3H0GA 3GTQA 4KDDA 2E2IA 2A6ED 4EJ3A 1I3QA 4Q5GA 5JSNB 1R49A 4FYDA 1I6VD 4NOLA 2VUMA 1GE9A 2JA7A 3KYLA 4JLRC 3IAYA 4L8IA 1K4TA 4O26A 3K59A 1R5ZA 3FKIA 3GTPA 2F4QA 1TWFA 1R9TA 1V9MA 4F3EA 2NVXA 2YU9A 1I50A 1K83A 1TWAA 1K4SA 1DD5A 4FXDA 1IW7D 1RRJA 3P9AA 5CQGA 3WVOA 1SC7A 4D3YA 2E2HA 3K5NA 1EK8A 5MLC9 3CQZA 2R7ZA 1EJ9A 2R92A 3K5MA 1Q8IA 2A68D 4QCLA 1WQHA 5C9HA 4H3TA 5JSBB 1LPQA 3GTOA 4NOMA 4AYBA 3GTKA 1ISEA 1T8IA 1RR8C 1TGOA 4KB4A 4Q5VA 3M4AA 3GTJA 2B63A 2JA5A 4OYDB 2JA6A 4KAWX 1WQGA 1TWCA 4LMOA 1A36A 4IP8A 2Y0SA 2A69D 4FGUA 1YNND 4IP9A 3MAQA 1IS1A 1MIUA 1A31A 2B9SB 3SJRA 1NH3A 1A35A 3GTLA 4AN8A 3K5OA 3GTMA 4AHCA 2BE5D 2WB1A 1WQFA 4QIWA 1EH1A 1YNJD 3LHPS 3DU6A 1SFOA 1ZYRD 2R93A 1SEUA 1TWGA 2WAQA 3K58A 4C2MA 1Y1VA 2R4GA 1TWHA 1WCMA 3HKZA 2CW0D 4D3ZA 1Y1WA 4KB2A 3LF9A 3K57A 1SMYD 1Y698 2A6HD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJR A; 
#chains in the Genus database with same CATH topology
 4NOK A;  2O5J D;  1HQM D;  3K5L A;  4GFQ A;  2PMZ A;  4KC6 A;  1TL8 A;  3GTG A;  3DU5 A;  2NVY A;  3H0G A;  3GTQ A;  4KDD A;  2E2I A;  2A6E D;  4EJ3 A;  1I3Q A;  4Q5G A;  5JSN B;  1R49 A;  4FYD A;  1I6V D;  4NOL A;  2VUM A;  1GE9 A;  2JA7 A;  3KYL A;  4JLR C;  3IAY A;  4L8I A;  1K4T A;  4O26 A;  3K59 A;  1R5Z A;  3FKI A;  3GTP A;  2F4Q A;  1TWF A;  1R9T A;  1V9M A;  4F3E A;  2NVX A;  2YU9 A;  1I50 A;  1K83 A;  1TWA A;  1K4S A;  1DD5 A;  4FXD A;  1IW7 D;  1RRJ A;  3P9A A;  5CQG A;  3WVO A;  1SC7 A;  4D3Y A;  2E2H A;  3K5N A;  1EK8 A;  5MLC 9;  3CQZ A;  2R7Z A;  1EJ9 A;  2R92 A;  3K5M A;  1Q8I A;  2A68 D;  4QCL A;  1WQH A;  5C9H A;  4H3T A;  5JSB B;  1LPQ A;  3GTO A;  4NOM A;  4AYB A;  3GTK A;  1ISE A;  1T8I A;  1RR8 C;  1TGO A;  4KB4 A;  4Q5V A;  3M4A A;  3GTJ A;  2B63 A;  2JA5 A;  4OYD B;  2JA6 A;  4KAW X;  1WQG A;  1TWC A;  4LMO A;  1A36 A;  4IP8 A;  2Y0S A;  2A69 D;  4FGU A;  1YNN D;  4IP9 A;  3MAQ A;  1IS1 A;  1MIU A;  1A31 A;  2B9S B;  3SJR A;  1NH3 A;  1A35 A;  3GTL A;  4AN8 A;  3K5O A;  3GTM A;  4AHC A;  2BE5 D;  2WB1 A;  1WQF A;  4QIW A;  1EH1 A;  1YNJ D;  3LHP S;  3DU6 A;  1SFO A;  1ZYR D;  2R93 A;  1SEU A;  1TWG A;  2WAQ A;  3K58 A;  4C2M A;  1Y1V A;  2R4G A;  1TWH A;  1WCM A;  3HKZ A;  2CW0 D;  4D3Z A;  1Y1W A;  4KB2 A;  3LF9 A;  3K57 A;  1SMY D;  1Y69 8;  2A6H D; 
#chains in the Genus database with same CATH homology
 4NOK A;  2O5J D;  1HQM D;  3K5L A;  4GFQ A;  2PMZ A;  4KC6 A;  1TL8 A;  3GTG A;  3DU5 A;  2NVY A;  3H0G A;  3GTQ A;  4KDD A;  2E2I A;  2A6E D;  4EJ3 A;  1I3Q A;  4Q5G A;  5JSN B;  1R49 A;  4FYD A;  1I6V D;  4NOL A;  2VUM A;  1GE9 A;  2JA7 A;  3KYL A;  4JLR C;  3IAY A;  4L8I A;  1K4T A;  4O26 A;  3K59 A;  1R5Z A;  3FKI A;  3GTP A;  2F4Q A;  1TWF A;  1R9T A;  1V9M A;  4F3E A;  2NVX A;  2YU9 A;  1I50 A;  1K83 A;  1TWA A;  1K4S A;  1DD5 A;  4FXD A;  1IW7 D;  1RRJ A;  3P9A A;  5CQG A;  3WVO A;  1SC7 A;  4D3Y A;  2E2H A;  3K5N A;  1EK8 A;  5MLC 9;  3CQZ A;  2R7Z A;  1EJ9 A;  2R92 A;  3K5M A;  1Q8I A;  2A68 D;  4QCL A;  1WQH A;  5C9H A;  4H3T A;  5JSB B;  1LPQ A;  3GTO A;  4NOM A;  4AYB A;  3GTK A;  1ISE A;  1T8I A;  1RR8 C;  1TGO A;  4KB4 A;  4Q5V A;  3M4A A;  3GTJ A;  2B63 A;  2JA5 A;  4OYD B;  2JA6 A;  4KAW X;  1WQG A;  1TWC A;  4LMO A;  1A36 A;  4IP8 A;  2Y0S A;  2A69 D;  4FGU A;  1YNN D;  4IP9 A;  3MAQ A;  1IS1 A;  1MIU A;  1A31 A;  2B9S B;  3SJR A;  1NH3 A;  1A35 A;  3GTL A;  4AN8 A;  3K5O A;  3GTM A;  4AHC A;  2BE5 D;  2WB1 A;  1WQF A;  4QIW A;  1EH1 A;  1YNJ D;  3LHP S;  3DU6 A;  1SFO A;  1ZYR D;  2R93 A;  1SEU A;  1TWG A;  2WAQ A;  3K58 A;  4C2M A;  1Y1V A;  2R4G A;  1TWH A;  1WCM A;  3HKZ A;  2CW0 D;  4D3Z A;  1Y1W A;  4KB2 A;  3LF9 A;  3K57 A;  1SMY D;  1Y69 8;  2A6H D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...