3SJRA

Crystal structure of conserved unkown function protein cv_1783 from chromobacterium violaceum atcc 12472
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
126
structure length
126
Chain Sequence
ISLSQGAQAAALLFSAAMDQISRLAELDIEPVRLPESELTGDSHSQHLLLGMEILMELYRQQHPDWTAPAIRQAFAPLARAGLERGYQEACQVLRQLNVYTPAVAGQLQGLLLLTQRLFEERLQIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of conserved unkown function protein CV_1783 from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
total genus 44
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18433 DUF5610 Domain of unknown function (DUF5610)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.90 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 3sjrA00
3SJRA
chains in the Genus database with same CATH superfamily
4NOMA 4AYBA 3K5MA 4FXDA 1R49A 3DU5A 1WCMA 2R92A 3IAYA 4H3TA 2R7ZA 2B9SB 3GTPA 1V9MA 1K83A 4JLRC 3DU6A 1TWAA 1A35A 5C9HA 1R5ZA 1ZYRD 1I50A 1NH3A 3GTMA 4KC6A 1IW7D 3KYLA 1MIUA 3H0GA 4NOKA 1SFOA 2E2HA 2WB1A 2JA6A 1TL8A 4KB2A 2R4GA 5MLC9 2CW0D 3K59A 4Q5VA 2PMZA 4QIWA 4OYDB 1ISEA 1RR8C 3K57A 1EK8A 1TWGA 3K5OA 1I6VD 1T8IA 5JSBB 1K4TA 3K5LA 1HQMD 1LPQA 2O5JD 4KDDA 1Y1WA 2A68D 2A6ED 2E2IA 1WQGA 1IS1A 1TWHA 1K4SA 1A31A 2BE5D 4GFQA 1DD5A 3LF9A 3MAQA 1Y698 3SJRA 1SMYD 1EH1A 4Q5GA 1YNJD 1YNND 2NVXA 2B63A 1WQHA 3M4AA 4KAWX 2YU9A 1TGOA 4AN8A 1A36A 4FYDA 4IP8A 1GE9A 2A69D 5CQGA 4O26A 4L8IA 3LHPS 3HKZA 1SC7A 1Y1VA 1RRJA 2A6HD 3GTOA 4QCLA 1TWCA 2R93A 4IP9A 3FKIA 2Y0SA 3CQZA 2NVYA 1Q8IA 2JA7A 4KB4A 4LMOA 3WVOA 1SEUA 4EJ3A 4FGUA 1TWFA 2JA5A 4C2MA 3K5NA 2F4QA 3GTLA 4AHCA 4D3YA 4D3ZA 3GTGA 3GTJA 4NOLA 3K58A 3GTKA 2VUMA 2WAQA 3P9AA 1WQFA 1R9TA 5JSNB 1I3QA 1EJ9A 3GTQA 4F3EA
chains in the Genus database with same CATH topology
4NOMA 4AYBA 3K5MA 4FXDA 1R49A 3DU5A 1WCMA 2R92A 3IAYA 4H3TA 2R7ZA 2B9SB 3GTPA 1V9MA 1K83A 4JLRC 3DU6A 1TWAA 1A35A 5C9HA 1R5ZA 1ZYRD 1I50A 1NH3A 3GTMA 4KC6A 1IW7D 3KYLA 1MIUA 3H0GA 4NOKA 1SFOA 2E2HA 2WB1A 2JA6A 1TL8A 4KB2A 2R4GA 5MLC9 2CW0D 3K59A 4Q5VA 2PMZA 4QIWA 4OYDB 1ISEA 1RR8C 3K57A 1EK8A 1TWGA 3K5OA 1I6VD 1T8IA 5JSBB 1K4TA 3K5LA 1HQMD 1LPQA 2O5JD 4KDDA 1Y1WA 2A68D 2A6ED 2E2IA 1WQGA 1IS1A 1TWHA 1K4SA 1A31A 2BE5D 4GFQA 1DD5A 3LF9A 3MAQA 1Y698 3SJRA 1SMYD 1EH1A 4Q5GA 1YNJD 1YNND 2NVXA 2B63A 1WQHA 3M4AA 4KAWX 2YU9A 1TGOA 4AN8A 1A36A 4FYDA 4IP8A 1GE9A 2A69D 5CQGA 4O26A 4L8IA 3LHPS 3HKZA 1SC7A 1Y1VA 1RRJA 2A6HD 3GTOA 4QCLA 1TWCA 2R93A 4IP9A 3FKIA 2Y0SA 3CQZA 2NVYA 1Q8IA 2JA7A 4KB4A 4LMOA 3WVOA 1SEUA 4EJ3A 4FGUA 1TWFA 2JA5A 4C2MA 3K5NA 2F4QA 3GTLA 4AHCA 4D3YA 4D3ZA 3GTGA 3GTJA 4NOLA 3K58A 3GTKA 2VUMA 2WAQA 3P9AA 1WQFA 1R9TA 5JSNB 1I3QA 1EJ9A 3GTQA 4F3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJR A; 
#chains in the Genus database with same CATH topology
 4NOM A;  4AYB A;  3K5M A;  4FXD A;  1R49 A;  3DU5 A;  1WCM A;  2R92 A;  3IAY A;  4H3T A;  2R7Z A;  2B9S B;  3GTP A;  1V9M A;  1K83 A;  4JLR C;  3DU6 A;  1TWA A;  1A35 A;  5C9H A;  1R5Z A;  1ZYR D;  1I50 A;  1NH3 A;  3GTM A;  4KC6 A;  1IW7 D;  3KYL A;  1MIU A;  3H0G A;  4NOK A;  1SFO A;  2E2H A;  2WB1 A;  2JA6 A;  1TL8 A;  4KB2 A;  2R4G A;  5MLC 9;  2CW0 D;  3K59 A;  4Q5V A;  2PMZ A;  4QIW A;  4OYD B;  1ISE A;  1RR8 C;  3K57 A;  1EK8 A;  1TWG A;  3K5O A;  1I6V D;  1T8I A;  5JSB B;  1K4T A;  3K5L A;  1HQM D;  1LPQ A;  2O5J D;  4KDD A;  1Y1W A;  2A68 D;  2A6E D;  2E2I A;  1WQG A;  1IS1 A;  1TWH A;  1K4S A;  1A31 A;  2BE5 D;  4GFQ A;  1DD5 A;  3LF9 A;  3MAQ A;  1Y69 8;  3SJR A;  1SMY D;  1EH1 A;  4Q5G A;  1YNJ D;  1YNN D;  2NVX A;  2B63 A;  1WQH A;  3M4A A;  4KAW X;  2YU9 A;  1TGO A;  4AN8 A;  1A36 A;  4FYD A;  4IP8 A;  1GE9 A;  2A69 D;  5CQG A;  4O26 A;  4L8I A;  3LHP S;  3HKZ A;  1SC7 A;  1Y1V A;  1RRJ A;  2A6H D;  3GTO A;  4QCL A;  1TWC A;  2R93 A;  4IP9 A;  3FKI A;  2Y0S A;  3CQZ A;  2NVY A;  1Q8I A;  2JA7 A;  4KB4 A;  4LMO A;  3WVO A;  1SEU A;  4EJ3 A;  4FGU A;  1TWF A;  2JA5 A;  4C2M A;  3K5N A;  2F4Q A;  3GTL A;  4AHC A;  4D3Y A;  4D3Z A;  3GTG A;  3GTJ A;  4NOL A;  3K58 A;  3GTK A;  2VUM A;  2WAQ A;  3P9A A;  1WQF A;  1R9T A;  5JSN B;  1I3Q A;  1EJ9 A;  3GTQ A;  4F3E A; 
#chains in the Genus database with same CATH homology
 4NOM A;  4AYB A;  3K5M A;  4FXD A;  1R49 A;  3DU5 A;  1WCM A;  2R92 A;  3IAY A;  4H3T A;  2R7Z A;  2B9S B;  3GTP A;  1V9M A;  1K83 A;  4JLR C;  3DU6 A;  1TWA A;  1A35 A;  5C9H A;  1R5Z A;  1ZYR D;  1I50 A;  1NH3 A;  3GTM A;  4KC6 A;  1IW7 D;  3KYL A;  1MIU A;  3H0G A;  4NOK A;  1SFO A;  2E2H A;  2WB1 A;  2JA6 A;  1TL8 A;  4KB2 A;  2R4G A;  5MLC 9;  2CW0 D;  3K59 A;  4Q5V A;  2PMZ A;  4QIW A;  4OYD B;  1ISE A;  1RR8 C;  3K57 A;  1EK8 A;  1TWG A;  3K5O A;  1I6V D;  1T8I A;  5JSB B;  1K4T A;  3K5L A;  1HQM D;  1LPQ A;  2O5J D;  4KDD A;  1Y1W A;  2A68 D;  2A6E D;  2E2I A;  1WQG A;  1IS1 A;  1TWH A;  1K4S A;  1A31 A;  2BE5 D;  4GFQ A;  1DD5 A;  3LF9 A;  3MAQ A;  1Y69 8;  3SJR A;  1SMY D;  1EH1 A;  4Q5G A;  1YNJ D;  1YNN D;  2NVX A;  2B63 A;  1WQH A;  3M4A A;  4KAW X;  2YU9 A;  1TGO A;  4AN8 A;  1A36 A;  4FYD A;  4IP8 A;  1GE9 A;  2A69 D;  5CQG A;  4O26 A;  4L8I A;  3LHP S;  3HKZ A;  1SC7 A;  1Y1V A;  1RRJ A;  2A6H D;  3GTO A;  4QCL A;  1TWC A;  2R93 A;  4IP9 A;  3FKI A;  2Y0S A;  3CQZ A;  2NVY A;  1Q8I A;  2JA7 A;  4KB4 A;  4LMO A;  3WVO A;  1SEU A;  4EJ3 A;  4FGU A;  1TWF A;  2JA5 A;  4C2M A;  3K5N A;  2F4Q A;  3GTL A;  4AHC A;  4D3Y A;  4D3Z A;  3GTG A;  3GTJ A;  4NOL A;  3K58 A;  3GTK A;  2VUM A;  2WAQ A;  3P9A A;  1WQF A;  1R9T A;  5JSN B;  1I3Q A;  1EJ9 A;  3GTQ A;  4F3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...