3SJRA

Crystal structure of conserved unkown function protein cv_1783 from chromobacterium violaceum atcc 12472
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
126
structure length
126
Chain Sequence
ISLSQGAQAAALLFSAAMDQISRLAELDIEPVRLPESELTGDSHSQHLLLGMEILMELYRQQHPDWTAPAIRQAFAPLARAGLERGYQEACQVLRQLNVYTPAVAGQLQGLLLLTQRLFEERLQIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved unkown function protein CV_1783 from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 44
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18433 DUF5610 Domain of unknown function (DUF5610)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.90 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 3sjrA00
3SJRA
chains in the Genus database with same CATH superfamily
4NOKA 2R92A 4JLRC 2NVXA 3K58A 2R4GA 1I6VD 4KB4A 1TWCA 4F3EA 5MLC9 1NH3A 3GTKA 3CQZA 4O26A 3FKIA 4NOMA 1K4SA 1TWGA 1I3QA 5JSBB 5CQGA 1MIUA 3K5NA 4AYBA 1R9TA 1YNJD 2PMZA 3P9AA 4AN8A 3GTQA 2O5JD 1TWFA 1YNND 1WQHA 4EJ3A 4IP9A 4D3ZA 3GTJA 4C2MA 3K57A 1TWAA 2VUMA 1HQMD 4NOLA 3GTGA 5C9HA 4KDDA 2JA6A 3LHPS 2B63A 3SJRA 3DU6A 3MAQA 3LF9A 4QCLA 1TGOA 3K59A 1Q8IA 1SEUA 2R93A 1TWHA 4AHCA 1Y1VA 2Y0SA 4Q5GA 3GTMA 1A36A 3K5LA 4KAWX 1I50A 1EH1A 1DD5A 2A6HD 1WCMA 4Q5VA 1K4TA 4FYDA 2B9SB 1SMYD 1SC7A 1TL8A 2CW0D 4IP8A 1LPQA 4QIWA 3IAYA 3GTPA 2R7ZA 3DU5A 3K5MA 1SFOA 4LMOA 2F4QA 1GE9A 4H3TA 4OYDB 4FGUA 2YU9A 4FXDA 3M4AA 1R5ZA 1K83A 1EJ9A 2JA7A 2A6ED 1IW7D 2A68D 3WVOA 4KC6A 1R49A 1RRJA 3KYLA 1A35A 1EK8A 2A69D 1V9MA 4KB2A 5JSNB 3HKZA 1WQGA 2E2HA 1Y1WA 3GTLA 4L8IA 1WQFA 3K5OA 1RR8C 2E2IA 2NVYA 4D3YA 1Y698 2WAQA 2JA5A 4GFQA 1T8IA 3GTOA 2BE5D 1IS1A 1ISEA 1A31A 2WB1A 1ZYRD 3H0GA
chains in the Genus database with same CATH topology
4NOKA 2R92A 4JLRC 2NVXA 3K58A 2R4GA 1I6VD 4KB4A 1TWCA 4F3EA 5MLC9 1NH3A 3GTKA 3CQZA 4O26A 3FKIA 4NOMA 1K4SA 1TWGA 1I3QA 5JSBB 5CQGA 1MIUA 3K5NA 4AYBA 1R9TA 1YNJD 2PMZA 3P9AA 4AN8A 3GTQA 2O5JD 1TWFA 1YNND 1WQHA 4EJ3A 4IP9A 4D3ZA 3GTJA 4C2MA 3K57A 1TWAA 2VUMA 1HQMD 4NOLA 3GTGA 5C9HA 4KDDA 2JA6A 3LHPS 2B63A 3SJRA 3DU6A 3MAQA 3LF9A 4QCLA 1TGOA 3K59A 1Q8IA 1SEUA 2R93A 1TWHA 4AHCA 1Y1VA 2Y0SA 4Q5GA 3GTMA 1A36A 3K5LA 4KAWX 1I50A 1EH1A 1DD5A 2A6HD 1WCMA 4Q5VA 1K4TA 4FYDA 2B9SB 1SMYD 1SC7A 1TL8A 2CW0D 4IP8A 1LPQA 4QIWA 3IAYA 3GTPA 2R7ZA 3DU5A 3K5MA 1SFOA 4LMOA 2F4QA 1GE9A 4H3TA 4OYDB 4FGUA 2YU9A 4FXDA 3M4AA 1R5ZA 1K83A 1EJ9A 2JA7A 2A6ED 1IW7D 2A68D 3WVOA 4KC6A 1R49A 1RRJA 3KYLA 1A35A 1EK8A 2A69D 1V9MA 4KB2A 5JSNB 3HKZA 1WQGA 2E2HA 1Y1WA 3GTLA 4L8IA 1WQFA 3K5OA 1RR8C 2E2IA 2NVYA 4D3YA 1Y698 2WAQA 2JA5A 4GFQA 1T8IA 3GTOA 2BE5D 1IS1A 1ISEA 1A31A 2WB1A 1ZYRD 3H0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJR A; 
#chains in the Genus database with same CATH topology
 4NOK A;  2R92 A;  4JLR C;  2NVX A;  3K58 A;  2R4G A;  1I6V D;  4KB4 A;  1TWC A;  4F3E A;  5MLC 9;  1NH3 A;  3GTK A;  3CQZ A;  4O26 A;  3FKI A;  4NOM A;  1K4S A;  1TWG A;  1I3Q A;  5JSB B;  5CQG A;  1MIU A;  3K5N A;  4AYB A;  1R9T A;  1YNJ D;  2PMZ A;  3P9A A;  4AN8 A;  3GTQ A;  2O5J D;  1TWF A;  1YNN D;  1WQH A;  4EJ3 A;  4IP9 A;  4D3Z A;  3GTJ A;  4C2M A;  3K57 A;  1TWA A;  2VUM A;  1HQM D;  4NOL A;  3GTG A;  5C9H A;  4KDD A;  2JA6 A;  3LHP S;  2B63 A;  3SJR A;  3DU6 A;  3MAQ A;  3LF9 A;  4QCL A;  1TGO A;  3K59 A;  1Q8I A;  1SEU A;  2R93 A;  1TWH A;  4AHC A;  1Y1V A;  2Y0S A;  4Q5G A;  3GTM A;  1A36 A;  3K5L A;  4KAW X;  1I50 A;  1EH1 A;  1DD5 A;  2A6H D;  1WCM A;  4Q5V A;  1K4T A;  4FYD A;  2B9S B;  1SMY D;  1SC7 A;  1TL8 A;  2CW0 D;  4IP8 A;  1LPQ A;  4QIW A;  3IAY A;  3GTP A;  2R7Z A;  3DU5 A;  3K5M A;  1SFO A;  4LMO A;  2F4Q A;  1GE9 A;  4H3T A;  4OYD B;  4FGU A;  2YU9 A;  4FXD A;  3M4A A;  1R5Z A;  1K83 A;  1EJ9 A;  2JA7 A;  2A6E D;  1IW7 D;  2A68 D;  3WVO A;  4KC6 A;  1R49 A;  1RRJ A;  3KYL A;  1A35 A;  1EK8 A;  2A69 D;  1V9M A;  4KB2 A;  5JSN B;  3HKZ A;  1WQG A;  2E2H A;  1Y1W A;  3GTL A;  4L8I A;  1WQF A;  3K5O A;  1RR8 C;  2E2I A;  2NVY A;  4D3Y A;  1Y69 8;  2WAQ A;  2JA5 A;  4GFQ A;  1T8I A;  3GTO A;  2BE5 D;  1IS1 A;  1ISE A;  1A31 A;  2WB1 A;  1ZYR D;  3H0G A; 
#chains in the Genus database with same CATH homology
 4NOK A;  2R92 A;  4JLR C;  2NVX A;  3K58 A;  2R4G A;  1I6V D;  4KB4 A;  1TWC A;  4F3E A;  5MLC 9;  1NH3 A;  3GTK A;  3CQZ A;  4O26 A;  3FKI A;  4NOM A;  1K4S A;  1TWG A;  1I3Q A;  5JSB B;  5CQG A;  1MIU A;  3K5N A;  4AYB A;  1R9T A;  1YNJ D;  2PMZ A;  3P9A A;  4AN8 A;  3GTQ A;  2O5J D;  1TWF A;  1YNN D;  1WQH A;  4EJ3 A;  4IP9 A;  4D3Z A;  3GTJ A;  4C2M A;  3K57 A;  1TWA A;  2VUM A;  1HQM D;  4NOL A;  3GTG A;  5C9H A;  4KDD A;  2JA6 A;  3LHP S;  2B63 A;  3SJR A;  3DU6 A;  3MAQ A;  3LF9 A;  4QCL A;  1TGO A;  3K59 A;  1Q8I A;  1SEU A;  2R93 A;  1TWH A;  4AHC A;  1Y1V A;  2Y0S A;  4Q5G A;  3GTM A;  1A36 A;  3K5L A;  4KAW X;  1I50 A;  1EH1 A;  1DD5 A;  2A6H D;  1WCM A;  4Q5V A;  1K4T A;  4FYD A;  2B9S B;  1SMY D;  1SC7 A;  1TL8 A;  2CW0 D;  4IP8 A;  1LPQ A;  4QIW A;  3IAY A;  3GTP A;  2R7Z A;  3DU5 A;  3K5M A;  1SFO A;  4LMO A;  2F4Q A;  1GE9 A;  4H3T A;  4OYD B;  4FGU A;  2YU9 A;  4FXD A;  3M4A A;  1R5Z A;  1K83 A;  1EJ9 A;  2JA7 A;  2A6E D;  1IW7 D;  2A68 D;  3WVO A;  4KC6 A;  1R49 A;  1RRJ A;  3KYL A;  1A35 A;  1EK8 A;  2A69 D;  1V9M A;  4KB2 A;  5JSN B;  3HKZ A;  1WQG A;  2E2H A;  1Y1W A;  3GTL A;  4L8I A;  1WQF A;  3K5O A;  1RR8 C;  2E2I A;  2NVY A;  4D3Y A;  1Y69 8;  2WAQ A;  2JA5 A;  4GFQ A;  1T8I A;  3GTO A;  2BE5 D;  1IS1 A;  1ISE A;  1A31 A;  2WB1 A;  1ZYR D;  3H0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...