3P9AA

An atomic view of the nonameric small terminase subunit of bacteriophage p22
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
139
Chain Sequence
MAAPKGNRFWEARSSHGRNPKFESPEALWAACCEYFEWVEANPLWEMKAFSYQGEVIQEPIAKMRAMTITGLTLFIDVTLETWRTYRLREDLSEVVTRAEQVIYDQKFSGAAADLLNANIIARDLGLKEQSQVEDVTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA-packaging protein gp3
publication title Small terminase couples viral DNA binding to genome-packaging ATPase activity.
pubmed doi rcsb
source organism Enterobacteria phage p22
total genus 40
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16677 GP3_package DNA-packaging protein gp3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.80 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 3p9aA00
3P9AA
chains in the Genus database with same CATH superfamily
4QCLA 2B9SB 1ISEA 5CQGA 4QIWA 1EH1A 1SFOA 4FGUA 2PMZA 4AYBA 1R9TA 1K4TA 3GTJA 2F4QA 4FXDA 2NVYA 1A35A 2WB1A 1WQHA 1TWHA 4OYDB 2A6ED 2WAQA 4LMOA 5MLC9 1SMYD 1WQFA 3P9AA 1Y1WA 1R5ZA 3K58A 2A6HD 3H0GA 1YNJD 1TWGA 1EK8A 4L8IA 4NOKA 3MAQA 2E2IA 2E2HA 4C2MA 1R49A 4NOMA 1K4SA 3DU6A 1TL8A 5C9HA 4D3ZA 2JA5A 1TWCA 3K57A 3HKZA 3GTGA 3CQZA 1DD5A 3GTPA 1GE9A 1NH3A 2R4GA 1WQGA 4AN8A 3IAYA 3K5NA 3GTOA 1WCMA 4KAWX 4KB4A 4IP8A 1Y1VA 1A31A 1EJ9A 1I3QA 1IW7D 2R92A 3K59A 2JA7A 4KB2A 3K5LA 3LF9A 2A68D 5JSBB 4AHCA 4FYDA 4Q5VA 3SJRA 4KC6A 4NOLA 3GTMA 3GTQA 4GFQA 3GTLA 1ZYRD 1IS1A 4IP9A 4Q5GA 1MIUA 3WVOA 3DU5A 1SC7A 3K5OA 1T8IA 3GTKA 2JA6A 3KYLA 1K83A 1I6VD 3M4AA 2Y0SA 1LPQA 4F3EA 1RR8C 4D3YA 1Q8IA 1YNND 2B63A 1V9MA 1RRJA 2VUMA 1TWAA 1A36A 5JSNB 2O5JD 2YU9A 1HQMD 2R93A 3LHPS 1TWFA 4H3TA 1Y698 2A69D 4JLRC 2NVXA 4KDDA 3K5MA 2R7ZA 2BE5D 2CW0D 4O26A 1TGOA 3FKIA 4EJ3A 1SEUA 1I50A
chains in the Genus database with same CATH topology
4QCLA 2B9SB 1ISEA 5CQGA 4QIWA 1EH1A 1SFOA 4FGUA 2PMZA 4AYBA 1R9TA 1K4TA 3GTJA 2F4QA 4FXDA 2NVYA 1A35A 2WB1A 1WQHA 1TWHA 4OYDB 2A6ED 2WAQA 4LMOA 5MLC9 1SMYD 1WQFA 3P9AA 1Y1WA 1R5ZA 3K58A 2A6HD 3H0GA 1YNJD 1TWGA 1EK8A 4L8IA 4NOKA 3MAQA 2E2IA 2E2HA 4C2MA 1R49A 4NOMA 1K4SA 3DU6A 1TL8A 5C9HA 4D3ZA 2JA5A 1TWCA 3K57A 3HKZA 3GTGA 3CQZA 1DD5A 3GTPA 1GE9A 1NH3A 2R4GA 1WQGA 4AN8A 3IAYA 3K5NA 3GTOA 1WCMA 4KAWX 4KB4A 4IP8A 1Y1VA 1A31A 1EJ9A 1I3QA 1IW7D 2R92A 3K59A 2JA7A 4KB2A 3K5LA 3LF9A 2A68D 5JSBB 4AHCA 4FYDA 4Q5VA 3SJRA 4KC6A 4NOLA 3GTMA 3GTQA 4GFQA 3GTLA 1ZYRD 1IS1A 4IP9A 4Q5GA 1MIUA 3WVOA 3DU5A 1SC7A 3K5OA 1T8IA 3GTKA 2JA6A 3KYLA 1K83A 1I6VD 3M4AA 2Y0SA 1LPQA 4F3EA 1RR8C 4D3YA 1Q8IA 1YNND 2B63A 1V9MA 1RRJA 2VUMA 1TWAA 1A36A 5JSNB 2O5JD 2YU9A 1HQMD 2R93A 3LHPS 1TWFA 4H3TA 1Y698 2A69D 4JLRC 2NVXA 4KDDA 3K5MA 2R7ZA 2BE5D 2CW0D 4O26A 1TGOA 3FKIA 4EJ3A 1SEUA 1I50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P9A A; 
#chains in the Genus database with same CATH topology
 4QCL A;  2B9S B;  1ISE A;  5CQG A;  4QIW A;  1EH1 A;  1SFO A;  4FGU A;  2PMZ A;  4AYB A;  1R9T A;  1K4T A;  3GTJ A;  2F4Q A;  4FXD A;  2NVY A;  1A35 A;  2WB1 A;  1WQH A;  1TWH A;  4OYD B;  2A6E D;  2WAQ A;  4LMO A;  5MLC 9;  1SMY D;  1WQF A;  3P9A A;  1Y1W A;  1R5Z A;  3K58 A;  2A6H D;  3H0G A;  1YNJ D;  1TWG A;  1EK8 A;  4L8I A;  4NOK A;  3MAQ A;  2E2I A;  2E2H A;  4C2M A;  1R49 A;  4NOM A;  1K4S A;  3DU6 A;  1TL8 A;  5C9H A;  4D3Z A;  2JA5 A;  1TWC A;  3K57 A;  3HKZ A;  3GTG A;  3CQZ A;  1DD5 A;  3GTP A;  1GE9 A;  1NH3 A;  2R4G A;  1WQG A;  4AN8 A;  3IAY A;  3K5N A;  3GTO A;  1WCM A;  4KAW X;  4KB4 A;  4IP8 A;  1Y1V A;  1A31 A;  1EJ9 A;  1I3Q A;  1IW7 D;  2R92 A;  3K59 A;  2JA7 A;  4KB2 A;  3K5L A;  3LF9 A;  2A68 D;  5JSB B;  4AHC A;  4FYD A;  4Q5V A;  3SJR A;  4KC6 A;  4NOL A;  3GTM A;  3GTQ A;  4GFQ A;  3GTL A;  1ZYR D;  1IS1 A;  4IP9 A;  4Q5G A;  1MIU A;  3WVO A;  3DU5 A;  1SC7 A;  3K5O A;  1T8I A;  3GTK A;  2JA6 A;  3KYL A;  1K83 A;  1I6V D;  3M4A A;  2Y0S A;  1LPQ A;  4F3E A;  1RR8 C;  4D3Y A;  1Q8I A;  1YNN D;  2B63 A;  1V9M A;  1RRJ A;  2VUM A;  1TWA A;  1A36 A;  5JSN B;  2O5J D;  2YU9 A;  1HQM D;  2R93 A;  3LHP S;  1TWF A;  4H3T A;  1Y69 8;  2A69 D;  4JLR C;  2NVX A;  4KDD A;  3K5M A;  2R7Z A;  2BE5 D;  2CW0 D;  4O26 A;  1TGO A;  3FKI A;  4EJ3 A;  1SEU A;  1I50 A; 
#chains in the Genus database with same CATH homology
 4QCL A;  2B9S B;  1ISE A;  5CQG A;  4QIW A;  1EH1 A;  1SFO A;  4FGU A;  2PMZ A;  4AYB A;  1R9T A;  1K4T A;  3GTJ A;  2F4Q A;  4FXD A;  2NVY A;  1A35 A;  2WB1 A;  1WQH A;  1TWH A;  4OYD B;  2A6E D;  2WAQ A;  4LMO A;  5MLC 9;  1SMY D;  1WQF A;  3P9A A;  1Y1W A;  1R5Z A;  3K58 A;  2A6H D;  3H0G A;  1YNJ D;  1TWG A;  1EK8 A;  4L8I A;  4NOK A;  3MAQ A;  2E2I A;  2E2H A;  4C2M A;  1R49 A;  4NOM A;  1K4S A;  3DU6 A;  1TL8 A;  5C9H A;  4D3Z A;  2JA5 A;  1TWC A;  3K57 A;  3HKZ A;  3GTG A;  3CQZ A;  1DD5 A;  3GTP A;  1GE9 A;  1NH3 A;  2R4G A;  1WQG A;  4AN8 A;  3IAY A;  3K5N A;  3GTO A;  1WCM A;  4KAW X;  4KB4 A;  4IP8 A;  1Y1V A;  1A31 A;  1EJ9 A;  1I3Q A;  1IW7 D;  2R92 A;  3K59 A;  2JA7 A;  4KB2 A;  3K5L A;  3LF9 A;  2A68 D;  5JSB B;  4AHC A;  4FYD A;  4Q5V A;  3SJR A;  4KC6 A;  4NOL A;  3GTM A;  3GTQ A;  4GFQ A;  3GTL A;  1ZYR D;  1IS1 A;  4IP9 A;  4Q5G A;  1MIU A;  3WVO A;  3DU5 A;  1SC7 A;  3K5O A;  1T8I A;  3GTK A;  2JA6 A;  3KYL A;  1K83 A;  1I6V D;  3M4A A;  2Y0S A;  1LPQ A;  4F3E A;  1RR8 C;  4D3Y A;  1Q8I A;  1YNN D;  2B63 A;  1V9M A;  1RRJ A;  2VUM A;  1TWA A;  1A36 A;  5JSN B;  2O5J D;  2YU9 A;  1HQM D;  2R93 A;  3LHP S;  1TWF A;  4H3T A;  1Y69 8;  2A69 D;  4JLR C;  2NVX A;  4KDD A;  3K5M A;  2R7Z A;  2BE5 D;  2CW0 D;  4O26 A;  1TGO A;  3FKI A;  4EJ3 A;  1SEU A;  1I50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...