3P9AA

An atomic view of the nonameric small terminase subunit of bacteriophage p22
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
139
Chain Sequence
b'MAAPKGNRFWEARSSHGRNPKFESPEALWAACCEYFEWVEANPLWEMKAFSYQGEVIQEPIAKMRAMTITGLTLFIDVTLETWRTYRLREDLSEVVTRAEQVIYDQKFSGAAADLLNANIIARDLGLKEQSQVEDVTPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-packaging protein gp3
publication title Small terminase couples viral DNA binding to genome-packaging ATPase activity.
pubmed doi rcsb
source organism Enterobacteria phage p22
molecule tags Dna binding protein
total genus 40
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16677 GP3_package DNA-packaging protein gp3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.80 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 3p9aA00
3P9AA
chains in the Genus database with same CATH superfamily
1TGOA 4EJ3A 4JLRC 1WQHA 2NVXA 1RR8C 3GTLA 1K4SA 4Q5VA 1A31A 3SJRA 1SFOA 2PMZA 4C2MA 3DU5A 3GTGA 4AHCA 3K5MA 1SMYD 3K58A 1K4TA 1Y1WA 3H0GA 4L8IA 1A36A 3GTKA 4FYDA 1GE9A 4D3ZA 2YU9A 1EH1A 3GTQA 3FKIA 3WVOA 1HQMD 4GFQA 1SEUA 2R4GA 1WQGA 1R49A 4IP9A 3GTJA 2E2HA 4FGUA 4OYDB 1SC7A 4KB4A 1LPQA 1I50A 1I3QA 2Y0SA 4D3YA 3K5NA 1RRJA 2CW0D 2BE5D 1YNJD 4KC6A 1T8IA 4FXDA 1MIUA 1R9TA 1TWCA 3GTMA 4KB2A 3K5LA 2R7ZA 1K83A 4QCLA 4NOMA 1DD5A 1I6VD 4KAWX 3K59A 3HKZA 3MAQA 3P9AA 3GTPA 1Y1VA 1TWAA 1V9MA 3K5OA 2WB1A 5JSBB 2B9SB 1YNND 3M4AA 2O5JD 1TWHA 2JA5A 5CQGA 4NOLA 2F4QA 3GTOA 2JA6A 1Y698 1WQFA 1EJ9A 4H3TA 4AN8A 1EK8A 3KYLA 4Q5GA 2JA7A 2A68D 4O26A 2NVYA 4QIWA 1NH3A 1WCMA 3LF9A 3IAYA 4F3EA 5JSNB 4AYBA 1TWFA 3DU6A 3CQZA 2R93A 1ISEA 1TWGA 2A69D 4IP8A 2A6ED 1TL8A 1R5ZA 5C9HA 3LHPS 2R92A 2E2IA 1Q8IA 4KDDA 1IW7D 2A6HD 4LMOA 1ZYRD 5MLC9 3K57A 2B63A 1IS1A 2WAQA 1A35A 2VUMA 4NOKA
chains in the Genus database with same CATH topology
1TGOA 4EJ3A 4JLRC 1WQHA 2NVXA 1RR8C 3GTLA 1K4SA 4Q5VA 1A31A 3SJRA 1SFOA 2PMZA 4C2MA 3DU5A 3GTGA 4AHCA 3K5MA 1SMYD 3K58A 1K4TA 1Y1WA 3H0GA 4L8IA 1A36A 3GTKA 4FYDA 1GE9A 4D3ZA 2YU9A 1EH1A 3GTQA 3FKIA 3WVOA 1HQMD 4GFQA 1SEUA 2R4GA 1WQGA 1R49A 4IP9A 3GTJA 2E2HA 4FGUA 4OYDB 1SC7A 4KB4A 1LPQA 1I50A 1I3QA 2Y0SA 4D3YA 3K5NA 1RRJA 2CW0D 2BE5D 1YNJD 4KC6A 1T8IA 4FXDA 1MIUA 1R9TA 1TWCA 3GTMA 4KB2A 3K5LA 2R7ZA 1K83A 4QCLA 4NOMA 1DD5A 1I6VD 4KAWX 3K59A 3HKZA 3MAQA 3P9AA 3GTPA 1Y1VA 1TWAA 1V9MA 3K5OA 2WB1A 5JSBB 2B9SB 1YNND 3M4AA 2O5JD 1TWHA 2JA5A 5CQGA 4NOLA 2F4QA 3GTOA 2JA6A 1Y698 1WQFA 1EJ9A 4H3TA 4AN8A 1EK8A 3KYLA 4Q5GA 2JA7A 2A68D 4O26A 2NVYA 4QIWA 1NH3A 1WCMA 3LF9A 3IAYA 4F3EA 5JSNB 4AYBA 1TWFA 3DU6A 3CQZA 2R93A 1ISEA 1TWGA 2A69D 4IP8A 2A6ED 1TL8A 1R5ZA 5C9HA 3LHPS 2R92A 2E2IA 1Q8IA 4KDDA 1IW7D 2A6HD 4LMOA 1ZYRD 5MLC9 3K57A 2B63A 1IS1A 2WAQA 1A35A 2VUMA 4NOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P9A A; 
#chains in the Genus database with same CATH topology
 1TGO A;  4EJ3 A;  4JLR C;  1WQH A;  2NVX A;  1RR8 C;  3GTL A;  1K4S A;  4Q5V A;  1A31 A;  3SJR A;  1SFO A;  2PMZ A;  4C2M A;  3DU5 A;  3GTG A;  4AHC A;  3K5M A;  1SMY D;  3K58 A;  1K4T A;  1Y1W A;  3H0G A;  4L8I A;  1A36 A;  3GTK A;  4FYD A;  1GE9 A;  4D3Z A;  2YU9 A;  1EH1 A;  3GTQ A;  3FKI A;  3WVO A;  1HQM D;  4GFQ A;  1SEU A;  2R4G A;  1WQG A;  1R49 A;  4IP9 A;  3GTJ A;  2E2H A;  4FGU A;  4OYD B;  1SC7 A;  4KB4 A;  1LPQ A;  1I50 A;  1I3Q A;  2Y0S A;  4D3Y A;  3K5N A;  1RRJ A;  2CW0 D;  2BE5 D;  1YNJ D;  4KC6 A;  1T8I A;  4FXD A;  1MIU A;  1R9T A;  1TWC A;  3GTM A;  4KB2 A;  3K5L A;  2R7Z A;  1K83 A;  4QCL A;  4NOM A;  1DD5 A;  1I6V D;  4KAW X;  3K59 A;  3HKZ A;  3MAQ A;  3P9A A;  3GTP A;  1Y1V A;  1TWA A;  1V9M A;  3K5O A;  2WB1 A;  5JSB B;  2B9S B;  1YNN D;  3M4A A;  2O5J D;  1TWH A;  2JA5 A;  5CQG A;  4NOL A;  2F4Q A;  3GTO A;  2JA6 A;  1Y69 8;  1WQF A;  1EJ9 A;  4H3T A;  4AN8 A;  1EK8 A;  3KYL A;  4Q5G A;  2JA7 A;  2A68 D;  4O26 A;  2NVY A;  4QIW A;  1NH3 A;  1WCM A;  3LF9 A;  3IAY A;  4F3E A;  5JSN B;  4AYB A;  1TWF A;  3DU6 A;  3CQZ A;  2R93 A;  1ISE A;  1TWG A;  2A69 D;  4IP8 A;  2A6E D;  1TL8 A;  1R5Z A;  5C9H A;  3LHP S;  2R92 A;  2E2I A;  1Q8I A;  4KDD A;  1IW7 D;  2A6H D;  4LMO A;  1ZYR D;  5MLC 9;  3K57 A;  2B63 A;  1IS1 A;  2WAQ A;  1A35 A;  2VUM A;  4NOK A; 
#chains in the Genus database with same CATH homology
 1TGO A;  4EJ3 A;  4JLR C;  1WQH A;  2NVX A;  1RR8 C;  3GTL A;  1K4S A;  4Q5V A;  1A31 A;  3SJR A;  1SFO A;  2PMZ A;  4C2M A;  3DU5 A;  3GTG A;  4AHC A;  3K5M A;  1SMY D;  3K58 A;  1K4T A;  1Y1W A;  3H0G A;  4L8I A;  1A36 A;  3GTK A;  4FYD A;  1GE9 A;  4D3Z A;  2YU9 A;  1EH1 A;  3GTQ A;  3FKI A;  3WVO A;  1HQM D;  4GFQ A;  1SEU A;  2R4G A;  1WQG A;  1R49 A;  4IP9 A;  3GTJ A;  2E2H A;  4FGU A;  4OYD B;  1SC7 A;  4KB4 A;  1LPQ A;  1I50 A;  1I3Q A;  2Y0S A;  4D3Y A;  3K5N A;  1RRJ A;  2CW0 D;  2BE5 D;  1YNJ D;  4KC6 A;  1T8I A;  4FXD A;  1MIU A;  1R9T A;  1TWC A;  3GTM A;  4KB2 A;  3K5L A;  2R7Z A;  1K83 A;  4QCL A;  4NOM A;  1DD5 A;  1I6V D;  4KAW X;  3K59 A;  3HKZ A;  3MAQ A;  3P9A A;  3GTP A;  1Y1V A;  1TWA A;  1V9M A;  3K5O A;  2WB1 A;  5JSB B;  2B9S B;  1YNN D;  3M4A A;  2O5J D;  1TWH A;  2JA5 A;  5CQG A;  4NOL A;  2F4Q A;  3GTO A;  2JA6 A;  1Y69 8;  1WQF A;  1EJ9 A;  4H3T A;  4AN8 A;  1EK8 A;  3KYL A;  4Q5G A;  2JA7 A;  2A68 D;  4O26 A;  2NVY A;  4QIW A;  1NH3 A;  1WCM A;  3LF9 A;  3IAY A;  4F3E A;  5JSN B;  4AYB A;  1TWF A;  3DU6 A;  3CQZ A;  2R93 A;  1ISE A;  1TWG A;  2A69 D;  4IP8 A;  2A6E D;  1TL8 A;  1R5Z A;  5C9H A;  3LHP S;  2R92 A;  2E2I A;  1Q8I A;  4KDD A;  1IW7 D;  2A6H D;  4LMO A;  1ZYR D;  5MLC 9;  3K57 A;  2B63 A;  1IS1 A;  2WAQ A;  1A35 A;  2VUM A;  4NOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...