4KB4A

Crystal structure of ribosome recycling factor mutant r31a from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
184
structure length
184
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGAANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
total genus 62
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kb4A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kb4A02
3LPXA 3CAGA 4KDDA 1EK8A 1F9NA 3LHPS 2ZFZA 2XCQA 2XCOA 3OPFA 4J3NA 1ISEA 3ERED 3BUEA 2P5MA 1WQHA 1WQFA 4OYDB 2KWAA 2Y3PA 1ZVUA 5CJ9A 4KB4A 1GE9A 3V4GA 3LF9A 1IS1A 1B4AA 1EH1A 3NUHA 4G0WA 4L8IA 1BGWA 1XXCA 1Y698 4G0UA 2XCRB 3OEPA 3FOFA 4KAWX 1B4BA 5JVOA 3LAJA 1XXAA 3VA7A 5JSNB 1BJTA 4G0VA 4JLRC 4GFQA 1AB4A 2RGRA 2PHCB 3QX3A 3FHZA 1WIHA 1XXBA 1WQGA 3MMLB 4KB2A 3L4JA 3FOEA 4FM9A 4DDQA 4KC6A 5JSBB 3L4KA 5MLC9 1DD5A 3LAPA 3OREA
chains in the Genus database with same CATH superfamily
1F93A 1A31A 2V6TA 4A3MK 2E2JC 1KQ4A 3I4MC 4BXXK 1F7UA 4A3CK 3SZYA 1TWHK 2A68D 1O2BA 2BE5A 2YU9C 4OIOA 4C2MK 2WB1A 5M5XK 1TWHA 4Y52K 5C4XC 1AB4A 1EQRA 1TWFC 4C2MA 1T8IA 3L4JA 4ZH4A 4LR2A 3L4KA 1USMA 1I50K 3T02A 3S2HK 4EJ3A 3AQPA 2NVXC 1R9TA 1I50A 2ZFZA 1A35A 3SZZA 1ZXOA 1NH3A 4A3GC 1PJ7A 2Y3PA 5C44C 1GE9A 1V9MA 2R92K 1B4AA 1VRQC 2R92A 1G51A 1YX2A 2CFAA 4A3KC 3HOVK 2CW0A 5FLMC 3GTQK 1WOSA 3GTMC 4GFQA 4WILA 4M1XA 5EGEA 2JA8K 3GTQA 3AD9C 1XXBA 3AD7C 1V5VA 3A8JA 3M4OK 2GAHC 3S1MC 1EK8A 2PMZA 3IPJA 2XCOA 5L46A 3GTPC 1SEUA 3ADAC 4XSZA 1I6HC 4XSXA 1HQMD 4KB4A 2JA6C 5C4JC 4A93C 5CQGA 4AYBA 3S16K 4QJVB 4BBSC 3PO2C 5JVOA 4MEXA 1BJTA 1A36A 1TL8A 2PMZL 1MIUA 2WAQA 4G7ZA 3GTGC 2R93C 1XZPB 5IOTA 3S15C 3GTKK 1YNJA 4KB2A 4G7OA 1J6WA 1WSRA 3GTKA 4A3BC 4C3HC 4AYBL 2PPBA 4KN7A 1BDFA 3MAQA 1TGOA 1VGXA 3I4NC 1JQWA 4AH6A 1DCHA 1TWAK 2Y0SA 5C3EC 4Q5SA 2WAQL 4LK1A 4A3DK 4NOKA 3DU6A 3K5OA 4C3IC 1YCLA 5CHPA 4IP8A 3FOFA 1B4BA 4A3LC 3HOXC 4JLRC 3GTOC 1EJ9A 2PHCB 4LLGA 1PJ6A 2A6EA 2W7VA 4A3FC 1WIHA 1WORA 5JSBB 1WCMC 2E2JK 1ZYRA 2E2HK 4QIWD 3I4MK 4KDDA 3HOZC 1SMYD 2E2HA 4J3NA 4D3ZA 4P5AA 1F7VA 2YU9K 4A3JC 2R4GA 2NVYC 5C4XK 2YU9A 1TWFK 3TFIA 3WVOA 4G0WA 1TWFA 4L8IA 1C0AA 5IYCC 3CQZC 1O27A 4GTDA 1LPQA 2E2IK 3T00A 2NVXK 4MEYA 2E2IA 4WJ4A 3HKZA 1YNND 3RZDK 2JA5K 4A3GK 4FM9A 3K5LA 1J6VA 2JA5A 3S2DC 3AQOA 2VUMA 4A3EC 3IAYA 4D3YA 4OIPA 2A6HA 1O24A 3K57A 3BUEA 3BP8C 4A3KK 1WQHA 3H3VD 4YG2A 3GTMK 5C9HA 3HKZL 1EH1A 3GTMA 2NVTC 4G0UA 1WOOA 2GSOA 3K7AC 1EFWA 5IYBC 3GTPK 1I6HK 1IW7A 2JA6K 2R7ZC 1INNA 4A93K 2ZUFA 2JA6A 4H3TA 3Q3QA 4LOWA 3S17K 2F4QA 4Q4ZA 1IL2A 5IORA 4PAAA 3GTGK 2R93K 4P9SA 4YFKA 3GTGA 2R93A 3PO3C 1K83C 4C3HK 1XXAA 4P5BA 1I3QC 3HOUC 1JOEA 3EQLA 3I4NK 5C3EK 3M4AA 3GEHA 5MLC9 2O5JA 1XZQA 3OREA 4BY7C 2V6UA 2XCQA 1JVIA 4C3IK 4C3JC 3K58A 4A3LK 2PA8L 5IP9C 5M5YK 4NOIA 1IS1A 1I6VA 3GTOK 2BE5D 4A3FK 2GSNA 4AHCA 3GTOA 2WB1D 1R49A 4BBRC 1O29A 3RZOC 3OEPA 1WCMK 5IOQA 4BXXC 4KMUA 3HOZK 1WCMA 1K4TA 1RU0A 4Y7NC 4BY1C 2NVYK 3CAGA 1F9NA 5TMFA 2NVYA 3LHPS 3TFHA 2NVQC 1J6XA 5IYCK 3CQZK 3K59A 1WQFA 1R9TC 5CJ9A 3CQZA 5IYDK 4LQYA 1TWAA 4IP9A 3S14K 2CW0D 4OIRA 1USOA 4Q5GA 2XCRB 4Q5VA 1IBAA 3S2DK 3GSIA 3LAJA 5JSNB 4F3EA 2V6SA 4QIWL 2FQTA 1WQGA 2A69A 3AH5A 1IQ0A 2PMZD 2JA8C 2NVTK 3M3YC 1IE0A 4YFXA 3K7AK 4GTLA 4AYBD 3S0XA 4X6AC 3G4CA 2JH3A 5TJ3A 5IYBK 4O26A 4QJVA 4O2DA 4A3IC 2WAQD 4KMAA 4KMDA 2R7ZK 4OIQA 2A68A 2FQOA 2ZUEA 3S1NC 2R7ZA 1YNJD 1XZPA 3QX3A 3MMLB 5FJ8K 4BKWA 3GTJC 2NVXA 1X31C 5C44K 3GEEA 4KASA 1DD5A 4C45A 4G7HA 1ZQ1C 1EI6A 2Y0SD 5D4DA 3BP3A 3PO3K 1K83K 2JA7C 1XPPA 5FLMK 5TMCA 3A8IA 1PJ5A 5JFEA 1XXCA 2CFAB 4ILDA 1K4SA 2A6ED 4KARA 4G0VA 4A3DC 1TWGC 4BY7K 2B9SB 1L0WA 3HXAA 3S1MK 1ZYRD 5IP7C 4C3JK 1O28A 1DCOA 3GIRA 5IP9K 3GTPA 3LAPA 5C4JK 3DXJA 4BBRK 3RZOK 4MQ9A 3GTLC 1O25A 4BBSK 4GZYA 1SFOC 2E2HC 3PO2K 3S1QC 1HQMA 3NUHA 3S15K 3HOWC 4Y7NK 4GTFA 4BY1K 1TWCC 3HKZD 4A3BK 1UV7A 4RMFA 5EGHA 2NVQK 2P8TA 1Y1WC 4LK0A 4KM8A 3S1RC 1R9TK 2A6HD 2E2IC 3H0GC 4GTCA 1Y1VC 3HOYC 3RZDC 4PABA 3OPFA 3FKIC 2WB1L 4BLAA 2JA5C 2VUMC 5IOSA 2B63C 4OINA 3V4GA 3LF9A 3HOXK 3T01A 1BGWA 3G4AA 5M3FK 4KAWX 4A3MC 5E68A 4KMHA 3M3YK 4FGUA 1IW7D 3FHZA 4A3CC 1TWHC 1VJEA 4LJZA 4X6AK 4C2MC 4A3JK 4Y52C 3SJRA 1O26A 4NOLA 3AD8C 4QIWA 1ISEA 4A3IK 4YFNA 2GSUA 2GAGC 2P5MA 1SMYA 4XLPA 1DCPA 4FYDA 1I50C 1O2FB 3A8KA 3S17C 3S1NK 3S2HC 4BLBA 1Y698 3GTJK 2PA8D 3GTJA 4GTBA 3WODA 4A3EK 3JSTA 2R92C 4GT9A 3KYLA 2O5JD 4NOMA 4KM9A 3FOEA 2JA7K 4KC6A 1YNNA 3HOVC 3N3YA 5M3MK 2JA7A 4AN8A 3GTQC 3K5NA 4GTEA 1HI9A 3ERED 1I6VD 4OYDB 4XCHA 4QCLA 1TWGK 3M4OC 1TWGA 5IP7K 4JK1A 3TFJA 1WOPA 5HL8A 1Q8IA 4KATA 3N0BA 2Y0SL 1WSVA 1J98A 1O2AA 3GTLK 2D6FC 1RRJA 3S16C 1SC7A 4WJ3M 1SFOK 3S1QK 3GTLA 4GTAA 3N0CA 3H3VL 4FZBA 3LPXA 1SFOA 3DU5A 3P9AA 3HOWK 2EBBA 3TTGA 4FXDA 2RH6A 3GTKC 1VH2A 2KWAA 1TWCK 1ZVUA 1BS2A 3GEIA 2O5IA 1I3QK 1R5ZA 1TWCA 3HOUK 1K83A 1Y1WK 1I3QA 3S1RK 1TWAC 1Y1WA 4LMOA 5IYDC 3H0GK 4XLNA 3VA7A 3S14C 1RR8C 1Y1VK 3HOYK 3H0GA 2RGRA 3FKIK 2A69D 4KN4A 2VUMK 1Y1VA 1VLOA 2B63K 3FKIA 4DDQA 1ZBSA 3GDZA 2B63A 5M5WK 3K5MA 1XZQB
chains in the Genus database with same CATH topology
4GTCA 4KDDA 2NVYA 3LHPS 1SMYD 2E2HA 4J3NA 4D3ZA 3OPFA 4P5AA 1A31A 4BLAA 5IOSA 3K59A 1WQFA 2R4GA 5CJ9A 3CQZA 2YU9A 4LQYA 3LF9A 1TWAA 4IP9A 1KQ4A 3V4GA 3WVOA 4G0WA 1TWFA 4L8IA 2CW0D 1BGWA 2A68D 4Q5GA 1O2BA 4Q5VA 3G4AA 2XCRB 1O27A 4KAWX 2WB1A 1LPQA 1TWHA 4GTDA 3LAJA 5JSNB 4F3EA 1AB4A 4C2MA 1T8IA 4KMHA 2E2IA 4FGUA 3HKZA 1IW7D 1YNND 3FHZA 1WQGA 3L4JA 4FM9A 3K5LA 3AH5A 2JA5A 4LR2A 4C2MC 3AQOA 2VUMA 3L4KA 3IAYA 4EJ3A 3SJRA 4D3YA 1O26A 3AQPA 1R9TA 1I50A 4NOLA 1O24A 2ZFZA 1A35A 3K57A 4QIWA 1ISEA 1ZXOA 1NH3A 3BUEA 2GSUA 2P5MA 1WQHA 2Y3PA 4GTLA 1GE9A 3S0XA 1V9MA 3G4CA 4FYDA 5C9HA 1B4AA 2JH3A 1EH1A 3GTMA 5TJ3A 4BLBA 2R92A 4O26A 1Y698 4G0UA 2CFAA 2GSOA 4KMAA 4KMDA 3GTJA 4GTBA 4GFQA 2R7ZA 1YNJD 4GT9A 4M1XA 5EGEA 3KYLA 3GTQA 3QX3A 1XXBA 2O5JD 3MMLB 4BKWA 2NVXA 4NOMA 4KM9A 3FOEA 4KC6A 3N3YA 4KASA 1DD5A 2JA7A 4AN8A 3K5NA 1EK8A 4H3TA 2JA6A 2PMZA 3Q3QA 2F4QA 2XCOA 4GTEA 3ERED 5IORA 1SEUA 1I6VD 4OYDB 1HQMD 4KB4A 4QCLA 5CQGA 4AYBA 3GTGA 2R93A 5JFEA 1TWGA 1XXCA 2CFAB 4ILDA 1K4SA 5JVOA 1XXAA 4P5BA 2A6ED 1A36A 1TL8A 1BJTA 1MIUA 1Q8IA 2WAQA 4KARA 4KATA 2B9SB 3N0BA 4G0VA 5IOTA 1O2AA 1ZYRD 1RRJA 4KB2A 3M4AA 1SC7A 1O28A 3GTKA 3GTLA 4GTAA 3N0CA 4C3HC 5MLC9 3GTPA 4FZBA 3LAPA 3OREA 3LPXA 1SFOA 3MAQA 1TGOA 3DU5A 3P9AA 2XCQA 4FXDA 2RH6A 2Y0SA 1O25A 2KWAA 1ZVUA 4C3JC 3K58A 1IS1A 1R5ZA 1TWCA 2BE5D 1K83A 4NOKA 3DU6A 3NUHA 1I3QA 2GSNA 3K5OA 4AHCA 3GTOA 1R49A 4GTFA 1O29A 4C3IC 5CHPA 4IP8A 1Y1WA 3OEPA 3FOFA 1B4BA 4LMOA 3VA7A 1RR8C 5IOQA 4JLRC 5EGHA 1WCMA 3H0GA 1EJ9A 2PHCB 2RGRA 2A69D 1K4TA 1Y1VA 1WIHA 4KM8A 3FKIA 4DDQA 1ZBSA 5JSBB 2B63A 2A6HD 3K5MA 3CAGA 1F9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPX A;  3CAG A;  4KDD A;  1EK8 A;  1F9N A;  3LHP S;  2ZFZ A;  2XCQ A;  2XCO A;  3OPF A;  4J3N A;  1ISE A;  3ERE D;  3BUE A;  2P5M A;  1WQH A;  1WQF A;  4OYD B;  2KWA A;  2Y3P A;  1ZVU A;  5CJ9 A;  4KB4 A;  1GE9 A;  3V4G A;  3LF9 A;  1IS1 A;  1B4A A;  1EH1 A;  3NUH A;  4G0W A;  4L8I A;  1BGW A;  1XXC A;  1Y69 8;  4G0U A;  2XCR B;  3OEP A;  3FOF A;  4KAW X;  1B4B A;  5JVO A;  3LAJ A;  1XXA A;  3VA7 A;  5JSN B;  1BJT A;  4G0V A;  4JLR C;  4GFQ A;  1AB4 A;  2RGR A;  2PHC B;  3QX3 A;  3FHZ A;  1WIH A;  1XXB A;  1WQG A;  3MML B;  4KB2 A;  3L4J A;  3FOE A;  4FM9 A;  4DDQ A;  4KC6 A;  5JSB B;  3L4K A;  5MLC 9;  1DD5 A;  3LAP A;  3ORE A; 
#chains in the Genus database with same CATH topology
 1F93 A;  1A31 A;  2V6T A;  4A3M K;  2E2J C;  1KQ4 A;  3I4M C;  4BXX K;  1F7U A;  4A3C K;  3SZY A;  1TWH K;  2A68 D;  1O2B A;  2BE5 A;  2YU9 C;  4OIO A;  4C2M K;  2WB1 A;  5M5X K;  1TWH A;  4Y52 K;  5C4X C;  1AB4 A;  1EQR A;  1TWF C;  4C2M A;  1T8I A;  3L4J A;  4ZH4 A;  4LR2 A;  3L4K A;  1USM A;  1I50 K;  3T02 A;  3S2H K;  4EJ3 A;  3AQP A;  2NVX C;  1R9T A;  1I50 A;  2ZFZ A;  1A35 A;  3SZZ A;  1ZXO A;  1NH3 A;  4A3G C;  1PJ7 A;  2Y3P A;  5C44 C;  1GE9 A;  1V9M A;  2R92 K;  1B4A A;  1VRQ C;  2R92 A;  1G51 A;  1YX2 A;  2CFA A;  4A3K C;  3HOV K;  2CW0 A;  5FLM C;  3GTQ K;  1WOS A;  3GTM C;  4GFQ A;  4WIL A;  4M1X A;  5EGE A;  2JA8 K;  3GTQ A;  3AD9 C;  1XXB A;  3AD7 C;  1V5V A;  3A8J A;  3M4O K;  2GAH C;  3S1M C;  1EK8 A;  2PMZ A;  3IPJ A;  2XCO A;  5L46 A;  3GTP C;  1SEU A;  3ADA C;  4XSZ A;  1I6H C;  4XSX A;  1HQM D;  4KB4 A;  2JA6 C;  5C4J C;  4A93 C;  5CQG A;  4AYB A;  3S16 K;  4QJV B;  4BBS C;  3PO2 C;  5JVO A;  4MEX A;  1BJT A;  1A36 A;  1TL8 A;  2PMZ L;  1MIU A;  2WAQ A;  4G7Z A;  3GTG C;  2R93 C;  1XZP B;  5IOT A;  3S15 C;  3GTK K;  1YNJ A;  4KB2 A;  4G7O A;  1J6W A;  1WSR A;  3GTK A;  4A3B C;  4C3H C;  4AYB L;  2PPB A;  4KN7 A;  1BDF A;  3MAQ A;  1TGO A;  1VGX A;  3I4N C;  1JQW A;  4AH6 A;  1DCH A;  1TWA K;  2Y0S A;  5C3E C;  4Q5S A;  2WAQ L;  4LK1 A;  4A3D K;  4NOK A;  3DU6 A;  3K5O A;  4C3I C;  1YCL A;  5CHP A;  4IP8 A;  3FOF A;  1B4B A;  4A3L C;  3HOX C;  4JLR C;  3GTO C;  1EJ9 A;  2PHC B;  4LLG A;  1PJ6 A;  2A6E A;  2W7V A;  4A3F C;  1WIH A;  1WOR A;  5JSB B;  1WCM C;  2E2J K;  1ZYR A;  2E2H K;  4QIW D;  3I4M K;  4KDD A;  3HOZ C;  1SMY D;  2E2H A;  4J3N A;  4D3Z A;  4P5A A;  1F7V A;  2YU9 K;  4A3J C;  2R4G A;  2NVY C;  5C4X K;  2YU9 A;  1TWF K;  3TFI A;  3WVO A;  4G0W A;  1TWF A;  4L8I A;  1C0A A;  5IYC C;  3CQZ C;  1O27 A;  4GTD A;  1LPQ A;  2E2I K;  3T00 A;  2NVX K;  4MEY A;  2E2I A;  4WJ4 A;  3HKZ A;  1YNN D;  3RZD K;  2JA5 K;  4A3G K;  4FM9 A;  3K5L A;  1J6V A;  2JA5 A;  3S2D C;  3AQO A;  2VUM A;  4A3E C;  3IAY A;  4D3Y A;  4OIP A;  2A6H A;  1O24 A;  3K57 A;  3BUE A;  3BP8 C;  4A3K K;  1WQH A;  3H3V D;  4YG2 A;  3GTM K;  5C9H A;  3HKZ L;  1EH1 A;  3GTM A;  2NVT C;  4G0U A;  1WOO A;  2GSO A;  3K7A C;  1EFW A;  5IYB C;  3GTP K;  1I6H K;  1IW7 A;  2JA6 K;  2R7Z C;  1INN A;  4A93 K;  2ZUF A;  2JA6 A;  4H3T A;  3Q3Q A;  4LOW A;  3S17 K;  2F4Q A;  4Q4Z A;  1IL2 A;  5IOR A;  4PAA A;  3GTG K;  2R93 K;  4P9S A;  4YFK A;  3GTG A;  2R93 A;  3PO3 C;  1K83 C;  4C3H K;  1XXA A;  4P5B A;  1I3Q C;  3HOU C;  1JOE A;  3EQL A;  3I4N K;  5C3E K;  3M4A A;  3GEH A;  5MLC 9;  2O5J A;  1XZQ A;  3ORE A;  4BY7 C;  2V6U A;  2XCQ A;  1JVI A;  4C3I K;  4C3J C;  3K58 A;  4A3L K;  2PA8 L;  5IP9 C;  5M5Y K;  4NOI A;  1IS1 A;  1I6V A;  3GTO K;  2BE5 D;  4A3F K;  2GSN A;  4AHC A;  3GTO A;  2WB1 D;  1R49 A;  4BBR C;  1O29 A;  3RZO C;  3OEP A;  1WCM K;  5IOQ A;  4BXX C;  4KMU A;  3HOZ K;  1WCM A;  1K4T A;  1RU0 A;  4Y7N C;  4BY1 C;  2NVY K;  3CAG A;  1F9N A;  5TMF A;  2NVY A;  3LHP S;  3TFH A;  2NVQ C;  1J6X A;  5IYC K;  3CQZ K;  3K59 A;  1WQF A;  1R9T C;  5CJ9 A;  3CQZ A;  5IYD K;  4LQY A;  1TWA A;  4IP9 A;  3S14 K;  2CW0 D;  4OIR A;  1USO A;  4Q5G A;  2XCR B;  4Q5V A;  1IBA A;  3S2D K;  3GSI A;  3LAJ A;  5JSN B;  4F3E A;  2V6S A;  4QIW L;  2FQT A;  1WQG A;  2A69 A;  3AH5 A;  1IQ0 A;  2PMZ D;  2JA8 C;  2NVT K;  3M3Y C;  1IE0 A;  4YFX A;  3K7A K;  4GTL A;  4AYB D;  3S0X A;  4X6A C;  3G4C A;  2JH3 A;  5TJ3 A;  5IYB K;  4O26 A;  4QJV A;  4O2D A;  4A3I C;  2WAQ D;  4KMA A;  4KMD A;  2R7Z K;  4OIQ A;  2A68 A;  2FQO A;  2ZUE A;  3S1N C;  2R7Z A;  1YNJ D;  1XZP A;  3QX3 A;  3MML B;  5FJ8 K;  4BKW A;  3GTJ C;  2NVX A;  1X31 C;  5C44 K;  3GEE A;  4KAS A;  1DD5 A;  4C45 A;  4G7H A;  1ZQ1 C;  1EI6 A;  2Y0S D;  5D4D A;  3BP3 A;  3PO3 K;  1K83 K;  2JA7 C;  1XPP A;  5FLM K;  5TMC A;  3A8I A;  1PJ5 A;  5JFE A;  1XXC A;  2CFA B;  4ILD A;  1K4S A;  2A6E D;  4KAR A;  4G0V A;  4A3D C;  1TWG C;  4BY7 K;  2B9S B;  1L0W A;  3HXA A;  3S1M K;  1ZYR D;  5IP7 C;  4C3J K;  1O28 A;  1DCO A;  3GIR A;  5IP9 K;  3GTP A;  3LAP A;  5C4J K;  3DXJ A;  4BBR K;  3RZO K;  4MQ9 A;  3GTL C;  1O25 A;  4BBS K;  4GZY A;  1SFO C;  2E2H C;  3PO2 K;  3S1Q C;  1HQM A;  3NUH A;  3S15 K;  3HOW C;  4Y7N K;  4GTF A;  4BY1 K;  1TWC C;  3HKZ D;  4A3B K;  1UV7 A;  4RMF A;  5EGH A;  2NVQ K;  2P8T A;  1Y1W C;  4LK0 A;  4KM8 A;  3S1R C;  1R9T K;  2A6H D;  2E2I C;  3H0G C;  4GTC A;  1Y1V C;  3HOY C;  3RZD C;  4PAB A;  3OPF A;  3FKI C;  2WB1 L;  4BLA A;  2JA5 C;  2VUM C;  5IOS A;  2B63 C;  4OIN A;  3V4G A;  3LF9 A;  3HOX K;  3T01 A;  1BGW A;  3G4A A;  5M3F K;  4KAW X;  4A3M C;  5E68 A;  4KMH A;  3M3Y K;  4FGU A;  1IW7 D;  3FHZ A;  4A3C C;  1TWH C;  1VJE A;  4LJZ A;  4X6A K;  4C2M C;  4A3J K;  4Y52 C;  3SJR A;  1O26 A;  4NOL A;  3AD8 C;  4QIW A;  1ISE A;  4A3I K;  4YFN A;  2GSU A;  2GAG C;  2P5M A;  1SMY A;  4XLP A;  1DCP A;  4FYD A;  1I50 C;  1O2F B;  3A8K A;  3S17 C;  3S1N K;  3S2H C;  4BLB A;  1Y69 8;  3GTJ K;  2PA8 D;  3GTJ A;  4GTB A;  3WOD A;  4A3E K;  3JST A;  2R92 C;  4GT9 A;  3KYL A;  2O5J D;  4NOM A;  4KM9 A;  3FOE A;  2JA7 K;  4KC6 A;  1YNN A;  3HOV C;  3N3Y A;  5M3M K;  2JA7 A;  4AN8 A;  3GTQ C;  3K5N A;  4GTE A;  1HI9 A;  3ERE D;  1I6V D;  4OYD B;  4XCH A;  4QCL A;  1TWG K;  3M4O C;  1TWG A;  5IP7 K;  4JK1 A;  3TFJ A;  1WOP A;  5HL8 A;  1Q8I A;  4KAT A;  3N0B A;  2Y0S L;  1WSV A;  1J98 A;  1O2A A;  3GTL K;  2D6F C;  1RRJ A;  3S16 C;  1SC7 A;  4WJ3 M;  1SFO K;  3S1Q K;  3GTL A;  4GTA A;  3N0C A;  3H3V L;  4FZB A;  3LPX A;  1SFO A;  3DU5 A;  3P9A A;  3HOW K;  2EBB A;  3TTG A;  4FXD A;  2RH6 A;  3GTK C;  1VH2 A;  2KWA A;  1TWC K;  1ZVU A;  1BS2 A;  3GEI A;  2O5I A;  1I3Q K;  1R5Z A;  1TWC A;  3HOU K;  1K83 A;  1Y1W K;  1I3Q A;  3S1R K;  1TWA C;  1Y1W A;  4LMO A;  5IYD C;  3H0G K;  4XLN A;  3VA7 A;  3S14 C;  1RR8 C;  1Y1V K;  3HOY K;  3H0G A;  2RGR A;  3FKI K;  2A69 D;  4KN4 A;  2VUM K;  1Y1V A;  1VLO A;  2B63 K;  3FKI A;  4DDQ A;  1ZBS A;  3GDZ A;  2B63 A;  5M5W K;  3K5M A;  1XZQ B; 
#chains in the Genus database with same CATH homology
 4GTC A;  4KDD A;  2NVY A;  3LHP S;  1SMY D;  2E2H A;  4J3N A;  4D3Z A;  3OPF A;  4P5A A;  1A31 A;  4BLA A;  5IOS A;  3K59 A;  1WQF A;  2R4G A;  5CJ9 A;  3CQZ A;  2YU9 A;  4LQY A;  3LF9 A;  1TWA A;  4IP9 A;  1KQ4 A;  3V4G A;  3WVO A;  4G0W A;  1TWF A;  4L8I A;  2CW0 D;  1BGW A;  2A68 D;  4Q5G A;  1O2B A;  4Q5V A;  3G4A A;  2XCR B;  1O27 A;  4KAW X;  2WB1 A;  1LPQ A;  1TWH A;  4GTD A;  3LAJ A;  5JSN B;  4F3E A;  1AB4 A;  4C2M A;  1T8I A;  4KMH A;  2E2I A;  4FGU A;  3HKZ A;  1IW7 D;  1YNN D;  3FHZ A;  1WQG A;  3L4J A;  4FM9 A;  3K5L A;  3AH5 A;  2JA5 A;  4LR2 A;  4C2M C;  3AQO A;  2VUM A;  3L4K A;  3IAY A;  4EJ3 A;  3SJR A;  4D3Y A;  1O26 A;  3AQP A;  1R9T A;  1I50 A;  4NOL A;  1O24 A;  2ZFZ A;  1A35 A;  3K57 A;  4QIW A;  1ISE A;  1ZXO A;  1NH3 A;  3BUE A;  2GSU A;  2P5M A;  1WQH A;  2Y3P A;  4GTL A;  1GE9 A;  3S0X A;  1V9M A;  3G4C A;  4FYD A;  5C9H A;  1B4A A;  2JH3 A;  1EH1 A;  3GTM A;  5TJ3 A;  4BLB A;  2R92 A;  4O26 A;  1Y69 8;  4G0U A;  2CFA A;  2GSO A;  4KMA A;  4KMD A;  3GTJ A;  4GTB A;  4GFQ A;  2R7Z A;  1YNJ D;  4GT9 A;  4M1X A;  5EGE A;  3KYL A;  3GTQ A;  3QX3 A;  1XXB A;  2O5J D;  3MML B;  4BKW A;  2NVX A;  4NOM A;  4KM9 A;  3FOE A;  4KC6 A;  3N3Y A;  4KAS A;  1DD5 A;  2JA7 A;  4AN8 A;  3K5N A;  1EK8 A;  4H3T A;  2JA6 A;  2PMZ A;  3Q3Q A;  2F4Q A;  2XCO A;  4GTE A;  3ERE D;  5IOR A;  1SEU A;  1I6V D;  4OYD B;  1HQM D;  4KB4 A;  4QCL A;  5CQG A;  4AYB A;  3GTG A;  2R93 A;  5JFE A;  1TWG A;  1XXC A;  2CFA B;  4ILD A;  1K4S A;  5JVO A;  1XXA A;  4P5B A;  2A6E D;  1A36 A;  1TL8 A;  1BJT A;  1MIU A;  1Q8I A;  2WAQ A;  4KAR A;  4KAT A;  2B9S B;  3N0B A;  4G0V A;  5IOT A;  1O2A A;  1ZYR D;  1RRJ A;  4KB2 A;  3M4A A;  1SC7 A;  1O28 A;  3GTK A;  3GTL A;  4GTA A;  3N0C A;  4C3H C;  5MLC 9;  3GTP A;  4FZB A;  3LAP A;  3ORE A;  3LPX A;  1SFO A;  3MAQ A;  1TGO A;  3DU5 A;  3P9A A;  2XCQ A;  4FXD A;  2RH6 A;  2Y0S A;  1O25 A;  2KWA A;  1ZVU A;  4C3J C;  3K58 A;  1IS1 A;  1R5Z A;  1TWC A;  2BE5 D;  1K83 A;  4NOK A;  3DU6 A;  3NUH A;  1I3Q A;  2GSN A;  3K5O A;  4AHC A;  3GTO A;  1R49 A;  4GTF A;  1O29 A;  4C3I C;  5CHP A;  4IP8 A;  1Y1W A;  3OEP A;  3FOF A;  1B4B A;  4LMO A;  3VA7 A;  1RR8 C;  5IOQ A;  4JLR C;  5EGH A;  1WCM A;  3H0G A;  1EJ9 A;  2PHC B;  2RGR A;  2A69 D;  1K4T A;  1Y1V A;  1WIH A;  4KM8 A;  3FKI A;  4DDQ A;  1ZBS A;  5JSB B;  2B63 A;  2A6H D;  3K5M A;  3CAG A;  1F9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...