4KB4A

Crystal structure of ribosome recycling factor mutant r31a from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
184
structure length
184
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGAANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 62
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kb4A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kb4A02
2RGRA 3NUHA 3LHPS 2ZFZA 1GE9A 4J3NA 1BGWA 4DDQA 5JVOA 2XCRB 3OPFA 1WQFA 4G0WA 4KDDA 3QX3A 2PHCB 1ISEA 3V4GA 5MLC9 3LAJA 3FOFA 4JLRC 2KWAA 3BUEA 1WQGA 4OYDB 1AB4A 1B4AA 1F9NA 2Y3PA 5JSNB 3FHZA 1IS1A 4FM9A 4KC6A 1EK8A 3VA7A 1XXBA 1XXCA 3LAPA 3FOEA 3OEPA 5JSBB 1BJTA 1XXAA 4KB2A 4GFQA 4KB4A 3CAGA 1EH1A 3LF9A 3L4JA 3ERED 3L4KA 2XCOA 4L8IA 2P5MA 2XCQA 3LPXA 3MMLB 1DD5A 4KAWX 1Y698 1WIHA 3OREA 5CJ9A 1ZVUA 4G0VA 4G0UA 1WQHA 1B4BA
chains in the Genus database with same CATH superfamily
1K83A 1USMA 4C3HK 2NVXC 1TWFA 1Y1WK 1K83C 4A3IC 5C3EK 1I6VD 2V6TA 1AB4A 1XZPB 1JVIA 2CFAA 2NVYC 4A3FC 5IP9C 5IOTA 2CFAB 2E2JK 2Y0SD 2O5JD 1SMYA 4Y52C 4G7ZA 3S1MC 1EH1A 4KN4A 3H3VD 1J98A 1Q8IA 4QJVB 5IYCK 4KMUA 1WSVA 5JFEA 4PAAA 3S16C 3AH5A 3I4NC 2PMZL 2NVXA 1TWHK 2NVTC 5C9HA 4JLRC 5EGEA 1LPQA 1YNJD 1IS1A 4YG2A 4F3EA 1HI9A 4NOMA 3KYLA 1R49A 1WCMC 5IP7C 3S1RK 4AH6A 3LF9A 1TWHC 1TWGC 2GSOA 4NOIA 3S17C 3GEHA 1WOOA 2ZUFA 2E2JC 3PO2K 2ZFZA 3GTLC 4QIWD 2YU9C 1I50A 3HKZD 5IYCC 3GTPC 2YU9A 4LK0A 4OIOA 1O27A 4C3IC 1RR8C 2R92K 2E2IA 4QJVA 3Q3QA 1Y1VA 4RMFA 3PO2C 3AQPA 4PABA 3S14C 4GTBA 4A3EC 2JA6C 3RZDC 1R5ZA 1I50K 5TMCA 3ERED 3WODA 2PA8D 4BY7C 1DD5A 5CJ9A 3TFHA 3GSIA 4C2MK 1ZBSA 1WOPA 3H3VL 5IYBK 1GE9A 2FQTA 2A6HA 5IOQA 2B63A 1SEUA 3AD8C 4Q5VA 4P5AA 3GTLA 1I3QK 2A68D 1TWGK 4A3LC 2A69D 1NH3A 1WQGA 1RRJA 1ZYRA 3GEEA 3HOWK 4A3BK 4A3CK 1TWAK 1Y1VC 3AD7C 4C3JC 4NOKA 4YFNA 3GTQC 4KATA 3L4JA 4A3LK 2CW0D 4Q5GA 2B9SB 3OREA 3S15C 1EI6A 4O26A 3HOZK 1O26A 1EFWA 4A3KK 3GTOK 4WJ4A 4A3BC 3NUHA 2O5IA 1BGWA 3GTJC 1C0AA 2VUMC 3GTQK 4A3MC 3LAJA 3FOFA 5MLC9 4FGUA 2D6FC 1X31C 3HOUK 4A3DK 5TJ3A 3FKIK 1WCMA 5C4JK 3S2DC 4A3JK 5E68A 4LOWA 3GTOC 3BP8C 2VUMA 4A3GK 2PPBA 4A3IK 3L4KA 3N3YA 1J6XA 5IYDK 2RH6A 2NVQK 3RZOC 1I6HK 2E2HK 2V6SA 2WB1L 4WILA 3GTKA 1XZPA 4G0WA 2ZUEA 3S14K 4KDDA 3GTJA 1PJ7A 4OIQA 4G7OA 3HOVC 3HOZC 3I4MK 4BY7K 2WAQL 1EK8A 3S2HC 4KB2A 3GTGK 5CQGA 5M3MK 4GTDA 1VJEA 4FZBA 5C4XK 2GAHC 3S1QC 1JQWA 3JSTA 2P5MA 2XCQA 5L46A 3HOVK 3FKIC 5C4JC 1T8IA 1K4SA 1XPPA 4KASA 3TFIA 1TWAC 3OPFA 4C3JK 1WQFA 1A35A 5C4XC 1EJ9A 1INNA 2PHCB 2JA7K 3GTPA 4BY1K 3VA7A 3S15K 3T00A 3GTQA 1R9TK 5TMFA 2A68A 2JA6A 3K5NA 4Q4ZA 4IP8A 4C3IK 1SMYD 3HOUC 2PA8L 2O5JA 1F93A 1DCOA 2Y0SA 4ZH4A 4BLAA 4LR2A 1L0WA 3M3YK 3K59A 3CQZA 1O2FB 4MEYA 4GTEA 2W7VA 1VGXA 1TWAA 1PJ6A 4A3GC 3BP3A 3HOYK 1USOA 3K7AC 1XZQB 1O2AA 3K5LA 4LQYA 1XXCA 5JSBB 3G4AA 3GTLK 4P5BA 2B63K 2VUMK 5IYBC 1WOSA 4QIWL 1F7UA 2JA5C 3HKZA 3ADAC 1A36A 1TWCK 5FJ8K 2JA5A 4C2MA 4A3FK 1ZQ1C 1TGOA 1WQHA 2BE5D 2RGRA 1Y1WA 3HOXK 3GTGC 1ZYRD 4A3EK 3S1RC 3T02A 4C45A 3S1QK 5EGHA 5IYDC 1IQ0A 2E2IK 2A6HD 5M5WK 1I6HC 4XLPA 1XXBA 3K57A 2GSUA 3OEPA 3SJRA 1YNJA 4AHCA 4LLGA 1XZQA 1WSRA 1A31A 4A3MK 3K5OA 3H0GA 1MIUA 3FKIA 2P8TA 1WIHA 1O25A 2E2IC 3IPJA 4OINA 1B4BA 4Y7NK 1SFOK 2F4QA 4DDQA 2JA5K 4H3TA 5C44K 3GTGA 2Y0SL 1R9TC 3GTKC 4KMAA 4O2DA 4BBRK 4QIWA 3CQZK 3HKZL 3HOXC 3GTJK 3GTMK 3S1NC 4KB4A 1O24A 4XLNA 2NVYA 2R92C 2JA8C 2R93A 4A3JC 3CQZC 1V5VA 4J3NA 1I3QA 1YCLA 2V6UA 2CW0A 4GT9A 4MEXA 5IOSA 4A93K 4BLBA 4IP9A 3BUEA 3TTGA 3PO3K 3FHZA 5D4DA 4ILDA 4KN7A 2E2HC 3FOEA 4AYBA 3P9AA 1XXAA 2PMZD 4KARA 2JH3A 3WVOA 1TL8A 2A69A 4GZYA 4A93C 4BBRC 4YFKA 1Y698 2R92A 3AD9C 2R7ZC 4BY1C 4A3CC 3TFJA 3S2DK 1IL2A 5JVOA 4KMDA 4BXXC 2WAQA 1BS2A 3RZDK 2WB1A 4NOLA 4GTAA 5FLMK 4FXDA 4G7HA 1KQ4A 2EBBA 4D3YA 4OIRA 1SFOA 3RZOK 3G4CA 3AQOA 1SFOC 4KM9A 4XSZA 1Y1WC 4BBSC 5C3EC 2JA7C 5C44C 3HOYC 2JA7A 3EQLA 3GTKK 4L8IA 1F7VA 1PJ5A 5M5XK 4G0VA 3I4MC 4LMOA 2XCRB 4QCLA 3S2HK 4WJ3M 3M4OK 4GTCA 3V4GA 2A6EA 4D3ZA 1TWCC 2Y3PA 2WAQD 4JK1A 1VH2A 2NVQC 5IORA 3M3YC 3IAYA 2R4GA 5HL8A 4BXXK 1I3QC 1IE0A 4GFQA 3CAGA 4X6AK 4AYBL 1TWCA 1R9TA 1HQMD 1G51A 2R93C 3LPXA 3MAQA 3H0GC 1BDFA 2NVYK 1ZVUA 1IW7A 4KM8A 5IP9K 3A8JA 5M3FK 1Y1VK 2E2HA 4AYBD 3LHPS 4GTLA 1O28A 1TWFK 4BKWA 4P9SA 3K5MA 3K58A 2GAGC 2JA8K 4OYDB 1SC7A 3DXJA 4AN8A 5JSNB 4FM9A 4KC6A 1J6VA 1BJTA 1O2BA 2NVXK 1YNNA 3N0BA 3M4OC 3S16K 3A8KA 2A6ED 1TWGA 1I6VA 1RU0A 4M1XA 1UV7A 4EJ3A 2R7ZA 3MMLB 4KAWX 1VRQC 4G0UA 1YNND 3DU6A 3SZZA 3GTOA 1DCPA 1VLOA 4YFXA 4X6AC 3S1MK 2JA6K 3SZYA 1IBAA 1TWHA 1B4AA 1F9NA 4KMHA 2R7ZK 1EQRA 4C2MC 3LAPA 3DU5A 2FQOA 4XCHA 3S17K 4A3KC 3GDZA 1IW7D 3GTMA 5CHPA 4C3HC 2WB1D 4FYDA 3HXAA 2NVTK 1K83K 2YU9K 1HQMA 4GTFA 3A8IA 4LJZA 5M5YK 3HOWC 3PO3C 1K4TA 3M4AA 2KWAA 1WCMK 5IP7K 2B63C 3GTMC 3S1NK 4BBSK 4MQ9A 1V9MA 3GEIA 3QX3A 1ISEA 4Y52K 1I50C 1J6WA 2R93K 2PMZA 3H0GK 3S0XA 4XSXA 2BE5A 4Y7NC 4OIPA 4Q5SA 1TWFC 2GSNA 1YX2A 3GTPK 3N0CA 3I4NK 2XCOA 3K7AK 4LK1A 4A3DC 1DCHA 3GIRA 1WORA 5FLMC 1JOEA 1ZXOA 3T01A 1O29A
chains in the Genus database with same CATH topology
2RGRA 4LMOA 1K83A 1Y1WA 4QCLA 3NUHA 2XCRB 1BGWA 1ZYRD 1TWFA 1I6VD 3LAJA 4GTCA 5MLC9 3V4GA 3FOFA 4FGUA 4D3ZA 5EGHA 1AB4A 2Y3PA 2CFAA 5TJ3A 2A6HD 5IORA 5IOTA 1XXBA 1WCMA 3K57A 2GSUA 2CFAB 3IAYA 3OEPA 3SJRA 2R4GA 4AHCA 2O5JD 2VUMA 4GFQA 3CAGA 1EH1A 1A31A 3K5OA 1Q8IA 1TWCA 1R9TA 1HQMD 3H0GA 3N3YA 3L4KA 1MIUA 3FKIA 3LPXA 3MAQA 1WIHA 5JFEA 1ZVUA 2RH6A 1O25A 4KM8A 1B4BA 2E2HA 3LHPS 2F4QA 1O28A 4GTLA 4DDQA 4BKWA 3AH5A 3GTKA 4G0WA 4H3TA 4KDDA 3GTJA 3K5MA 3GTGA 2NVXA 3K58A 5C9HA 4JLRC 4KMAA 4OYDB 1SC7A 5EGEA 1LPQA 4AN8A 5JSNB 1YNJD 1IS1A 4FM9A 4QIWA 4KC6A 1EK8A 4F3EA 1BJTA 1O2BA 4NOMA 3KYLA 4KB2A 1R49A 5CQGA 3N0BA 4GTDA 4FZBA 4KB4A 2A6ED 1TWGA 3LF9A 1O24A 4M1XA 2NVYA 2P5MA 4EJ3A 2R7ZA 2XCQA 3MMLB 2GSOA 4KAWX 2R93A 1T8IA 4G0UA 1YNND 3DU6A 1K4SA 4KASA 3GTOA 2ZFZA 1I3QA 4J3NA 3OPFA 4GT9A 1WQFA 1A35A 1EJ9A 1I50A 2PHCB 1TWHA 5IOSA 2YU9A 4BLBA 4IP9A 3BUEA 1B4AA 1O27A 3GTPA 1F9NA 1RR8C 4KMHA 4C3IC 4C2MC 2E2IA 3FHZA 3Q3QA 3VA7A 3LAPA 1Y1VA 4ILDA 3DU5A 3FOEA 4AYBA 3P9AA 3GTQA 1XXAA 1IW7D 3GTMA 3AQPA 4KARA 5CHPA 2JH3A 3WVOA 1TL8A 4GTBA 4FYDA 4C3HC 1R5ZA 3ERED 2JA6A 4GTFA 3K5NA 1DD5A 4IP8A 1Y698 1SMYD 5CJ9A 2R92A 1ZBSA 1K4TA 2Y0SA 3M4AA 2KWAA 4BLAA 4LR2A 3K59A 3CQZA 5JVOA 1GE9A 5IOQA 2B63A 4KMDA 1SEUA 4Q5VA 4GTEA 4P5AA 1TWAA 3GTLA 2WAQA 2A68D 1V9MA 3QX3A 1ISEA 2A69D 1NH3A 2WB1A 1WQGA 4NOLA 4GTAA 1RRJA 4FXDA 1KQ4A 1O2AA 3K5LA 2PMZA 4LQYA 4D3YA 1XXCA 3S0XA 1SFOA 5JSBB 3G4AA 4P5BA 3G4CA 3AQOA 4C3JC 4NOKA 4KM9A 4KATA 2GSNA 3N0CA 3L4JA 3HKZA 1A36A 2JA7A 2XCOA 2JA5A 4L8IA 2CW0D 4Q5GA 4C2MA 4G0VA 2B9SB 3OREA 1TGOA 4O26A 1O26A 1WQHA 1ZXOA 2BE5D 1O29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RGR A;  3NUH A;  3LHP S;  2ZFZ A;  1GE9 A;  4J3N A;  1BGW A;  4DDQ A;  5JVO A;  2XCR B;  3OPF A;  1WQF A;  4G0W A;  4KDD A;  3QX3 A;  2PHC B;  1ISE A;  3V4G A;  5MLC 9;  3LAJ A;  3FOF A;  4JLR C;  2KWA A;  3BUE A;  1WQG A;  4OYD B;  1AB4 A;  1B4A A;  1F9N A;  2Y3P A;  5JSN B;  3FHZ A;  1IS1 A;  4FM9 A;  4KC6 A;  1EK8 A;  3VA7 A;  1XXB A;  1XXC A;  3LAP A;  3FOE A;  3OEP A;  5JSB B;  1BJT A;  1XXA A;  4KB2 A;  4GFQ A;  4KB4 A;  3CAG A;  1EH1 A;  3LF9 A;  3L4J A;  3ERE D;  3L4K A;  2XCO A;  4L8I A;  2P5M A;  2XCQ A;  3LPX A;  3MML B;  1DD5 A;  4KAW X;  1Y69 8;  1WIH A;  3ORE A;  5CJ9 A;  1ZVU A;  4G0V A;  4G0U A;  1WQH A;  1B4B A; 
#chains in the Genus database with same CATH topology
 1K83 A;  1USM A;  4C3H K;  2NVX C;  1TWF A;  1Y1W K;  1K83 C;  4A3I C;  5C3E K;  1I6V D;  2V6T A;  1AB4 A;  1XZP B;  1JVI A;  2CFA A;  2NVY C;  4A3F C;  5IP9 C;  5IOT A;  2CFA B;  2E2J K;  2Y0S D;  2O5J D;  1SMY A;  4Y52 C;  4G7Z A;  3S1M C;  1EH1 A;  4KN4 A;  3H3V D;  1J98 A;  1Q8I A;  4QJV B;  5IYC K;  4KMU A;  1WSV A;  5JFE A;  4PAA A;  3S16 C;  3AH5 A;  3I4N C;  2PMZ L;  2NVX A;  1TWH K;  2NVT C;  5C9H A;  4JLR C;  5EGE A;  1LPQ A;  1YNJ D;  1IS1 A;  4YG2 A;  4F3E A;  1HI9 A;  4NOM A;  3KYL A;  1R49 A;  1WCM C;  5IP7 C;  3S1R K;  4AH6 A;  3LF9 A;  1TWH C;  1TWG C;  2GSO A;  4NOI A;  3S17 C;  3GEH A;  1WOO A;  2ZUF A;  2E2J C;  3PO2 K;  2ZFZ A;  3GTL C;  4QIW D;  2YU9 C;  1I50 A;  3HKZ D;  5IYC C;  3GTP C;  2YU9 A;  4LK0 A;  4OIO A;  1O27 A;  4C3I C;  1RR8 C;  2R92 K;  2E2I A;  4QJV A;  3Q3Q A;  1Y1V A;  4RMF A;  3PO2 C;  3AQP A;  4PAB A;  3S14 C;  4GTB A;  4A3E C;  2JA6 C;  3RZD C;  1R5Z A;  1I50 K;  5TMC A;  3ERE D;  3WOD A;  2PA8 D;  4BY7 C;  1DD5 A;  5CJ9 A;  3TFH A;  3GSI A;  4C2M K;  1ZBS A;  1WOP A;  3H3V L;  5IYB K;  1GE9 A;  2FQT A;  2A6H A;  5IOQ A;  2B63 A;  1SEU A;  3AD8 C;  4Q5V A;  4P5A A;  3GTL A;  1I3Q K;  2A68 D;  1TWG K;  4A3L C;  2A69 D;  1NH3 A;  1WQG A;  1RRJ A;  1ZYR A;  3GEE A;  3HOW K;  4A3B K;  4A3C K;  1TWA K;  1Y1V C;  3AD7 C;  4C3J C;  4NOK A;  4YFN A;  3GTQ C;  4KAT A;  3L4J A;  4A3L K;  2CW0 D;  4Q5G A;  2B9S B;  3ORE A;  3S15 C;  1EI6 A;  4O26 A;  3HOZ K;  1O26 A;  1EFW A;  4A3K K;  3GTO K;  4WJ4 A;  4A3B C;  3NUH A;  2O5I A;  1BGW A;  3GTJ C;  1C0A A;  2VUM C;  3GTQ K;  4A3M C;  3LAJ A;  3FOF A;  5MLC 9;  4FGU A;  2D6F C;  1X31 C;  3HOU K;  4A3D K;  5TJ3 A;  3FKI K;  1WCM A;  5C4J K;  3S2D C;  4A3J K;  5E68 A;  4LOW A;  3GTO C;  3BP8 C;  2VUM A;  4A3G K;  2PPB A;  4A3I K;  3L4K A;  3N3Y A;  1J6X A;  5IYD K;  2RH6 A;  2NVQ K;  3RZO C;  1I6H K;  2E2H K;  2V6S A;  2WB1 L;  4WIL A;  3GTK A;  1XZP A;  4G0W A;  2ZUE A;  3S14 K;  4KDD A;  3GTJ A;  1PJ7 A;  4OIQ A;  4G7O A;  3HOV C;  3HOZ C;  3I4M K;  4BY7 K;  2WAQ L;  1EK8 A;  3S2H C;  4KB2 A;  3GTG K;  5CQG A;  5M3M K;  4GTD A;  1VJE A;  4FZB A;  5C4X K;  2GAH C;  3S1Q C;  1JQW A;  3JST A;  2P5M A;  2XCQ A;  5L46 A;  3HOV K;  3FKI C;  5C4J C;  1T8I A;  1K4S A;  1XPP A;  4KAS A;  3TFI A;  1TWA C;  3OPF A;  4C3J K;  1WQF A;  1A35 A;  5C4X C;  1EJ9 A;  1INN A;  2PHC B;  2JA7 K;  3GTP A;  4BY1 K;  3VA7 A;  3S15 K;  3T00 A;  3GTQ A;  1R9T K;  5TMF A;  2A68 A;  2JA6 A;  3K5N A;  4Q4Z A;  4IP8 A;  4C3I K;  1SMY D;  3HOU C;  2PA8 L;  2O5J A;  1F93 A;  1DCO A;  2Y0S A;  4ZH4 A;  4BLA A;  4LR2 A;  1L0W A;  3M3Y K;  3K59 A;  3CQZ A;  1O2F B;  4MEY A;  4GTE A;  2W7V A;  1VGX A;  1TWA A;  1PJ6 A;  4A3G C;  3BP3 A;  3HOY K;  1USO A;  3K7A C;  1XZQ B;  1O2A A;  3K5L A;  4LQY A;  1XXC A;  5JSB B;  3G4A A;  3GTL K;  4P5B A;  2B63 K;  2VUM K;  5IYB C;  1WOS A;  4QIW L;  1F7U A;  2JA5 C;  3HKZ A;  3ADA C;  1A36 A;  1TWC K;  5FJ8 K;  2JA5 A;  4C2M A;  4A3F K;  1ZQ1 C;  1TGO A;  1WQH A;  2BE5 D;  2RGR A;  1Y1W A;  3HOX K;  3GTG C;  1ZYR D;  4A3E K;  3S1R C;  3T02 A;  4C45 A;  3S1Q K;  5EGH A;  5IYD C;  1IQ0 A;  2E2I K;  2A6H D;  5M5W K;  1I6H C;  4XLP A;  1XXB A;  3K57 A;  2GSU A;  3OEP A;  3SJR A;  1YNJ A;  4AHC A;  4LLG A;  1XZQ A;  1WSR A;  1A31 A;  4A3M K;  3K5O A;  3H0G A;  1MIU A;  3FKI A;  2P8T A;  1WIH A;  1O25 A;  2E2I C;  3IPJ A;  4OIN A;  1B4B A;  4Y7N K;  1SFO K;  2F4Q A;  4DDQ A;  2JA5 K;  4H3T A;  5C44 K;  3GTG A;  2Y0S L;  1R9T C;  3GTK C;  4KMA A;  4O2D A;  4BBR K;  4QIW A;  3CQZ K;  3HKZ L;  3HOX C;  3GTJ K;  3GTM K;  3S1N C;  4KB4 A;  1O24 A;  4XLN A;  2NVY A;  2R92 C;  2JA8 C;  2R93 A;  4A3J C;  3CQZ C;  1V5V A;  4J3N A;  1I3Q A;  1YCL A;  2V6U A;  2CW0 A;  4GT9 A;  4MEX A;  5IOS A;  4A93 K;  4BLB A;  4IP9 A;  3BUE A;  3TTG A;  3PO3 K;  3FHZ A;  5D4D A;  4ILD A;  4KN7 A;  2E2H C;  3FOE A;  4AYB A;  3P9A A;  1XXA A;  2PMZ D;  4KAR A;  2JH3 A;  3WVO A;  1TL8 A;  2A69 A;  4GZY A;  4A93 C;  4BBR C;  4YFK A;  1Y69 8;  2R92 A;  3AD9 C;  2R7Z C;  4BY1 C;  4A3C C;  3TFJ A;  3S2D K;  1IL2 A;  5JVO A;  4KMD A;  4BXX C;  2WAQ A;  1BS2 A;  3RZD K;  2WB1 A;  4NOL A;  4GTA A;  5FLM K;  4FXD A;  4G7H A;  1KQ4 A;  2EBB A;  4D3Y A;  4OIR A;  1SFO A;  3RZO K;  3G4C A;  3AQO A;  1SFO C;  4KM9 A;  4XSZ A;  1Y1W C;  4BBS C;  5C3E C;  2JA7 C;  5C44 C;  3HOY C;  2JA7 A;  3EQL A;  3GTK K;  4L8I A;  1F7V A;  1PJ5 A;  5M5X K;  4G0V A;  3I4M C;  4LMO A;  2XCR B;  4QCL A;  3S2H K;  4WJ3 M;  3M4O K;  4GTC A;  3V4G A;  2A6E A;  4D3Z A;  1TWC C;  2Y3P A;  2WAQ D;  4JK1 A;  1VH2 A;  2NVQ C;  5IOR A;  3M3Y C;  3IAY A;  2R4G A;  5HL8 A;  4BXX K;  1I3Q C;  1IE0 A;  4GFQ A;  3CAG A;  4X6A K;  4AYB L;  1TWC A;  1R9T A;  1HQM D;  1G51 A;  2R93 C;  3LPX A;  3MAQ A;  3H0G C;  1BDF A;  2NVY K;  1ZVU A;  1IW7 A;  4KM8 A;  5IP9 K;  3A8J A;  5M3F K;  1Y1V K;  2E2H A;  4AYB D;  3LHP S;  4GTL A;  1O28 A;  1TWF K;  4BKW A;  4P9S A;  3K5M A;  3K58 A;  2GAG C;  2JA8 K;  4OYD B;  1SC7 A;  3DXJ A;  4AN8 A;  5JSN B;  4FM9 A;  4KC6 A;  1J6V A;  1BJT A;  1O2B A;  2NVX K;  1YNN A;  3N0B A;  3M4O C;  3S16 K;  3A8K A;  2A6E D;  1TWG A;  1I6V A;  1RU0 A;  4M1X A;  1UV7 A;  4EJ3 A;  2R7Z A;  3MML B;  4KAW X;  1VRQ C;  4G0U A;  1YNN D;  3DU6 A;  3SZZ A;  3GTO A;  1DCP A;  1VLO A;  4YFX A;  4X6A C;  3S1M K;  2JA6 K;  3SZY A;  1IBA A;  1TWH A;  1B4A A;  1F9N A;  4KMH A;  2R7Z K;  1EQR A;  4C2M C;  3LAP A;  3DU5 A;  2FQO A;  4XCH A;  3S17 K;  4A3K C;  3GDZ A;  1IW7 D;  3GTM A;  5CHP A;  4C3H C;  2WB1 D;  4FYD A;  3HXA A;  2NVT K;  1K83 K;  2YU9 K;  1HQM A;  4GTF A;  3A8I A;  4LJZ A;  5M5Y K;  3HOW C;  3PO3 C;  1K4T A;  3M4A A;  2KWA A;  1WCM K;  5IP7 K;  2B63 C;  3GTM C;  3S1N K;  4BBS K;  4MQ9 A;  1V9M A;  3GEI A;  3QX3 A;  1ISE A;  4Y52 K;  1I50 C;  1J6W A;  2R93 K;  2PMZ A;  3H0G K;  3S0X A;  4XSX A;  2BE5 A;  4Y7N C;  4OIP A;  4Q5S A;  1TWF C;  2GSN A;  1YX2 A;  3GTP K;  3N0C A;  3I4N K;  2XCO A;  3K7A K;  4LK1 A;  4A3D C;  1DCH A;  3GIR A;  1WOR A;  5FLM C;  1JOE A;  1ZXO A;  3T01 A;  1O29 A; 
#chains in the Genus database with same CATH homology
 2RGR A;  4LMO A;  1K83 A;  1Y1W A;  4QCL A;  3NUH A;  2XCR B;  1BGW A;  1ZYR D;  1TWF A;  1I6V D;  3LAJ A;  4GTC A;  5MLC 9;  3V4G A;  3FOF A;  4FGU A;  4D3Z A;  5EGH A;  1AB4 A;  2Y3P A;  2CFA A;  5TJ3 A;  2A6H D;  5IOR A;  5IOT A;  1XXB A;  1WCM A;  3K57 A;  2GSU A;  2CFA B;  3IAY A;  3OEP A;  3SJR A;  2R4G A;  4AHC A;  2O5J D;  2VUM A;  4GFQ A;  3CAG A;  1EH1 A;  1A31 A;  3K5O A;  1Q8I A;  1TWC A;  1R9T A;  1HQM D;  3H0G A;  3N3Y A;  3L4K A;  1MIU A;  3FKI A;  3LPX A;  3MAQ A;  1WIH A;  5JFE A;  1ZVU A;  2RH6 A;  1O25 A;  4KM8 A;  1B4B A;  2E2H A;  3LHP S;  2F4Q A;  1O28 A;  4GTL A;  4DDQ A;  4BKW A;  3AH5 A;  3GTK A;  4G0W A;  4H3T A;  4KDD A;  3GTJ A;  3K5M A;  3GTG A;  2NVX A;  3K58 A;  5C9H A;  4JLR C;  4KMA A;  4OYD B;  1SC7 A;  5EGE A;  1LPQ A;  4AN8 A;  5JSN B;  1YNJ D;  1IS1 A;  4FM9 A;  4QIW A;  4KC6 A;  1EK8 A;  4F3E A;  1BJT A;  1O2B A;  4NOM A;  3KYL A;  4KB2 A;  1R49 A;  5CQG A;  3N0B A;  4GTD A;  4FZB A;  4KB4 A;  2A6E D;  1TWG A;  3LF9 A;  1O24 A;  4M1X A;  2NVY A;  2P5M A;  4EJ3 A;  2R7Z A;  2XCQ A;  3MML B;  2GSO A;  4KAW X;  2R93 A;  1T8I A;  4G0U A;  1YNN D;  3DU6 A;  1K4S A;  4KAS A;  3GTO A;  2ZFZ A;  1I3Q A;  4J3N A;  3OPF A;  4GT9 A;  1WQF A;  1A35 A;  1EJ9 A;  1I50 A;  2PHC B;  1TWH A;  5IOS A;  2YU9 A;  4BLB A;  4IP9 A;  3BUE A;  1B4A A;  1O27 A;  3GTP A;  1F9N A;  1RR8 C;  4KMH A;  4C3I C;  4C2M C;  2E2I A;  3FHZ A;  3Q3Q A;  3VA7 A;  3LAP A;  1Y1V A;  4ILD A;  3DU5 A;  3FOE A;  4AYB A;  3P9A A;  3GTQ A;  1XXA A;  1IW7 D;  3GTM A;  3AQP A;  4KAR A;  5CHP A;  2JH3 A;  3WVO A;  1TL8 A;  4GTB A;  4FYD A;  4C3H C;  1R5Z A;  3ERE D;  2JA6 A;  4GTF A;  3K5N A;  1DD5 A;  4IP8 A;  1Y69 8;  1SMY D;  5CJ9 A;  2R92 A;  1ZBS A;  1K4T A;  2Y0S A;  3M4A A;  2KWA A;  4BLA A;  4LR2 A;  3K59 A;  3CQZ A;  5JVO A;  1GE9 A;  5IOQ A;  2B63 A;  4KMD A;  1SEU A;  4Q5V A;  4GTE A;  4P5A A;  1TWA A;  3GTL A;  2WAQ A;  2A68 D;  1V9M A;  3QX3 A;  1ISE A;  2A69 D;  1NH3 A;  2WB1 A;  1WQG A;  4NOL A;  4GTA A;  1RRJ A;  4FXD A;  1KQ4 A;  1O2A A;  3K5L A;  2PMZ A;  4LQY A;  4D3Y A;  1XXC A;  3S0X A;  1SFO A;  5JSB B;  3G4A A;  4P5B A;  3G4C A;  3AQO A;  4C3J C;  4NOK A;  4KM9 A;  4KAT A;  2GSN A;  3N0C A;  3L4J A;  3HKZ A;  1A36 A;  2JA7 A;  2XCO A;  2JA5 A;  4L8I A;  2CW0 D;  4Q5G A;  4C2M A;  4G0V A;  2B9S B;  3ORE A;  1TGO A;  4O26 A;  1O26 A;  1WQH A;  1ZXO A;  2BE5 D;  1O29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...