4KB4A

Crystal structure of ribosome recycling factor mutant r31a from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
184
structure length
184
Chain Sequence
b'IDEALFDAEEKMEKAVAVARDDLSTIRTGAANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 62
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kb4A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kb4A02
1F9NA 3OREA 4KDDA 4KB2A 1Y698 3ERED 2Y3PA 1B4BA 4KB4A 3VA7A 1WQGA 1ZVUA 4G0WA 5JVOA 4DDQA 1ISEA 3V4GA 1GE9A 4G0UA 3LAJA 2XCQA 1B4AA 5MLC9 4JLRC 3L4JA 2PHCB 4J3NA 3BUEA 3OPFA 3LAPA 2P5MA 2KWAA 3LPXA 1XXBA 1EK8A 3NUHA 1BGWA 4KC6A 1XXAA 2XCRB 3FOEA 3L4KA 4FM9A 4G0VA 1WQHA 5CJ9A 4OYDB 3FOFA 1WQFA 4GFQA 1DD5A 3LF9A 1IS1A 1EH1A 5JSBB 1AB4A 1XXCA 3CAGA 3OEPA 4L8IA 3LHPS 4KAWX 2XCOA 2RGRA 3QX3A 5JSNB 3FHZA 2ZFZA 1BJTA 1WIHA 3MMLB
chains in the Genus database with same CATH superfamily
2O5IA 2NVYC 5C4JC 2V6SA 3S0XA 3S2DC 2JA5A 1USOA 3IAYA 3GTKK 4GTEA 4A3GK 3LPXA 4KC6A 1XXAA 2A6EA 4BLBA 1K83K 4OYDB 2R4GA 3CAGA 3H0GA 3S17K 4A3KC 1Y1WA 3HOYK 3LHPS 3QX3A 1TGOA 4IP9A 4O2DA 4BKWA 4KATA 3HOUC 3HOWK 3I4NK 2R7ZK 3M3YC 1PJ5A 3N3YA 1IW7A 2WAQD 5IORA 3S1QK 2A68A 3S1NK 2PMZA 3L4JA 3GTLK 3K5MA 1RRJA 3GTGC 5M5XK 2R92K 3S16K 4LJZA 4A93C 4LMOA 2JA8C 4NOLA 4QJVB 4KASA 1VLOA 4GFQA 1XZQB 2E2JK 4L8IA 4IP8A 2JA7A 1ZYRD 3JSTA 3S1RC 5FLMK 2V6TA 3PO2K 4LLGA 2JA6K 3K58A 3FKIA 1JOEA 1G51A 1R9TC 3S14K 3GTJA 5C9HA 3ERED 1R5ZA 1XPPA 3WVOA 1IL2A 3VA7A 3N0CA 4A3DC 3GEIA 3GDZA 3T01A 1X31C 4P5BA 4JLRC 4P5AA 5L46A 3GTPA 2A69D 4J3NA 3SZZA 2O5JA 5TMCA 4C2MC 4H3TA 1DD5A 5JSBB 2PA8D 3AD7C 3TTGA 5IYCK 3HKZD 4LK1A 4Y52C 2Y0SL 3MMLB 1L0WA 1IE0A 2D6FC 3N0BA 3OREA 3K59A 2B63K 1Y698 1IBAA 4AHCA 1Y1VC 4A3MK 5C44C 3RZOK 3GTKA 3S2HK 2PHCB 4P9SA 3AQPA 3LAPA 1K83A 2EBBA 4BY1K 2R93K 1DCOA 3MAQA 4C3JK 2NVQC 1TWFK 3WODA 1EH1A 1TWAK 4KMUA 3ADAC 3HOVK 2YU9K 4KAWX 2V6UA 4C3HC 4BBSK 2E2HC 2R7ZA 3HOZC 4QIWL 4FGUA 3S15C 2JA7K 4F3EA 3GTOA 3I4MC 3H0GC 3RZDK 1Y1WC 4A3LC 1I6VA 1VH2A 4GZYA 1MIUA 4AYBD 1I50K 2WAQL 5IYBC 3GSIA 3Q3QA 4XSXA 3FOEA 4A3FK 1TWGK 3CQZK 4NOMA 3LF9A 5JFEA 1AB4A 5IP7K 3G4AA 3P9AA 1EI6A 4BBRC 1TWHK 2GSUA 1ZBSA 1R49A 1WCMC 2WB1L 5C4JK 2JA6A 5IYDC 2CW0A 3DXJA 2NVXA 4ILDA 4D3ZA 2CW0D 4A3IC 3V4GA 1YX2A 1SMYA 4C3IK 3FKIC 1XZPB 3DU6A 4QCLA 3GTJC 1HI9A 4A3EC 4GTCA 3GTMA 3HOXK 3GTQA 2VUMK 4BXXK 4QJVA 2PA8L 3AD8C 2FQOA 4KMHA 2A6ED 1XZQA 3HKZL 4XSZA 4MEXA 1I6HC 2B63A 4OIRA 1KQ4A 4KDDA 4KB2A 3GTGK 5FJ8K 4NOIA 5M3MK 3GTOK 1ISEA 4G0UA 3LAJA 2R93A 5C3EC 4KN7A 1K4TA 5EGEA 1IW7D 1TWFA 2GAGC 1EK8A 2A68D 3EQLA 1TWAA 1VJEA 1TWCC 2PMZD 1DCHA 2YU9A 4G7ZA 3GTKC 1R9TK 3BP8C 1C0AA 4Q5GA 1K83C 4KM8A 3S17C 3HOYC 1WSRA 3AD9C 1I50A 4MQ9A 2NVXK 2FQTA 1O24A 1YNJA 1ZVUA 4DDQA 1J6XA 3HOWC 4GTBA 2R7ZC 3I4NC 2W7VA 5TMFA 4A3BK 1TWGA 4FYDA 2WB1A 3CQZA 4XLNA 4Q4ZA 3PO3K 3S1MK 3S1QC 4EJ3A 4A3JK 1I3QC 2B9SB 1WQHA 1TWHA 1IQ0A 4ZH4A 1WQFA 2O5JD 5M5YK 3GTLC 3H3VD 2R92C 5CHPA 3GTMK 2NVTK 2RGRA 1Y1VK 4WJ3M 3GTQK 1BJTA 5C44K 1WIHA 1VRQC 4Q5SA 1HQMA 5C4XC 2E2JC 1SFOK 4D3YA 1WORA 2Y3PA 3BP3A 5FLMC 3K5LA 4LK0A 4Y7NC 5HL8A 3PO2C 1JVIA 2NVQK 2E2IC 1T8IA 3K7AK 5M5WK 3M4AA 4WJ4A 1SC7A 1O2BA 2VUMA 1WOOA 3L4KA 2E2HK 4G0VA 3HOZK 3A8IA 3FOFA 1VGXA 1JQWA 3AH5A 3OEPA 3TFJA 3I4MK 2JA5C 2XCOA 5JSNB 2PPBA 1YNNA 4GT9A 4OIQA 3GTGA 5IYCC 2A6HA 1YNND 3SJRA 5EGHA 4A3CK 2GAHC 3AQOA 4BY7K 4OIOA 5MLC9 3T00A 1I6VD 4KARA 1WOPA 4A3MC 4O26A 5IP9K 1XZPA 2CFAA 1R9TA 2PMZL 3HXAA 5CJ9A 4X6AC 4GTFA 1TL8A 1ZXOA 4AN8A 2NVYK 3GIRA 4BY1C 3FHZA 1F7VA 4C3JC 3S2DK 2YU9C 3M4OC 1YCLA 3IPJA 4OINA 4BBSC 4GTDA 3SZYA 2JA7C 1INNA 1EFWA 4C45A 4KMDA 4A3KK 3K5NA 1I6HK 2CFAB 1I50C 1BGWA 1SMYD 2Y0SA 1A35A 1Y1VA 5IOQA 3HOUK 4A3FC 4XLPA 3M3YK 1WSVA 4GTLA 3GTPC 3CQZC 1SFOA 1PJ6A 5IP7C 1TWHC 3K5OA 1J6VA 5C3EK 4JK1A 1TWCK 1V9MA 4A93K 2JA8K 1SEUA 1O2AA 3DU5A 3BUEA 1K4SA 2E2HA 3A8JA 4KM9A 2P5MA 3S1RK 4C3IC 4QIWA 4A3GC 1NH3A 4QIWD 3HOXC 5IOTA 4A3DK 2P8TA 2VUMC 4BXXC 3A8KA 2WAQA 4GTAA 5E68A 3G4CA 1I3QK 1GE9A 4C2MK 4AYBL 1WCMA 1DCPA 1EQRA 1RR8C 1YNJD 3GTOC 1O29A 1ZYRA 2NVYA 3S1NC 4Y52K 5C4XK 1O26A 1J6WA 4YFNA 1XXCA 4AH6A 2WB1D 4YFXA 3S16C 5CQGA 4Y7NK 4M1XA 4KN4A 2E2IK 1F9NA 4FXDA 4RMFA 4KB4A 1HQMD 1WQGA 2A69A 1ZQ1C 4YFKA 5JVOA 4XCHA 2ZUFA 2JA6C 1O2FB 2XCQA 1B4AA 5D4DA 5M3FK 3K57A 3S14C 3T02A 1Q8IA 2NVXC 2JA5K 4G7OA 2KWAA 3HKZA 2XCRB 1V5VA 4C3HK 2GSNA 3TFHA 3TFIA 1IS1A 4A3BC 3S15K 1J98A 3PO3C 3S1MC 3H0GK 4A3JC 1PJ7A 1Y1WK 4A3LK 1BS2A 2RH6A 4KMAA 1O25A 5IYBK 3GTMC 4OIPA 2NVTC 1B4BA 1A31A 1TWCA 3GTQC 1F93A 4YG2A 4G0WA 1A36A 1WOSA 1SFOC 2A6HD 4MEYA 4X6AK 2B63C 3OPFA 1F7UA 1EJ9A 3NUHA 4BBRK 1XXBA 1WCMK 3RZOC 4LOWA 4FM9A 4Q5VA 5IYDK 1RU0A 2GSOA 3K7AC 3S2HC 5IOSA 4PABA 3M4OK 1UV7A 2R93C 4LR2A 2ZFZA 4A3IK 1TWFC 4AYBA 1TWAC 1USMA 2BE5A 3HOVC 1I3QA 3FKIK 1LPQA 4C2MA 4WILA 3GTLA 3GTJK 2BE5D 2R92A 4A3EK 1O28A 4A3CC 1BDFA 1O27A 3RZDC 4FZBA 4BY7C 3KYLA 4PAAA 3GTPK 2ZUEA 4NOKA 3GEHA 5TJ3A 4G7HA 2F4QA 3H3VL 2JH3A 5IP9C 3GEEA 2E2IA 2Y0SD 4BLAA 1TWGC 4LQYA
chains in the Genus database with same CATH topology
2WAQA 4GTAA 4F3EA 3GTOA 4D3YA 2Y3PA 3G4CA 3K5LA 1MIUA 3S0XA 1GE9A 2JA5A 1WCMA 1T8IA 3IAYA 3Q3QA 3M4AA 4GTEA 1RR8C 1SC7A 1YNJD 3FOEA 1O2BA 2VUMA 3LPXA 4KC6A 1XXAA 1O29A 4BLBA 3L4KA 4G0VA 2NVYA 4OYDB 4NOMA 1O26A 2R4GA 3FOFA 3LF9A 5JFEA 1XXCA 3H0GA 3CAGA 1AB4A 1Y1WA 3AH5A 3G4AA 3OEPA 3P9AA 3LHPS 2GSUA 1ZBSA 1R49A 2XCOA 5JSNB 5CQGA 1TGOA 4IP9A 3QX3A 2JA6A 4BKWA 4M1XA 4GT9A 4KATA 3GTGA 2NVXA 4FXDA 1F9NA 4ILDA 1YNND 3SJRA 5EGHA 4D3ZA 2CW0D 4KB4A 1HQMD 1WQGA 3AQOA 3N3YA 5JVOA 5IORA 3V4GA 2PMZA 2XCQA 1B4AA 5MLC9 3L4JA 1I6VD 3K57A 3K5MA 1RRJA 1Q8IA 4KARA 3DU6A 4O26A 4QCLA 2KWAA 4GTCA 3HKZA 4LMOA 2XCRB 4NOLA 3GTMA 2CFAA 1R9TA 2GSNA 4KASA 5CJ9A 3GTQA 1IS1A 4GFQA 4GTFA 1TL8A 1ZXOA 4AN8A 4KMHA 4L8IA 4IP8A 2A6ED 2JA7A 1ZYRD 3FHZA 4C3JC 2B63A 2RH6A 4KMAA 1O25A 3K58A 3FKIA 4KDDA 4KB2A 1KQ4A 3GTJA 5C9HA 3ERED 1R5ZA 1A31A 1TWCA 3WVOA 1B4BA 3VA7A 3N0CA 4GTDA 4G0WA 1A36A 1ISEA 2A6HD 4G0UA 3LAJA 4P5BA 4JLRC 4P5AA 2R93A 3GTPA 2A69D 4J3NA 4KMDA 1K4TA 5EGEA 3OPFA 1IW7D 3K5NA 1EJ9A 1TWFA 3NUHA 1XXBA 1EK8A 2A68D 1TWAA 1BGWA 2CFAB 1SMYD 4C2MC 4FM9A 2Y0SA 4Q5VA 1A35A 2GSOA 2YU9A 5IOSA 4H3TA 1DD5A 1Y1VA 5JSBB 5IOQA 4Q5GA 4GTLA 4LR2A 2ZFZA 1SFOA 4KM8A 3MMLB 3N0BA 4AYBA 3OREA 3K59A 3K5OA 1Y698 4AHCA 1I3QA 1I50A 1LPQA 4C2MA 3GTLA 1O24A 2BE5D 1ZVUA 3GTKA 1V9MA 2R92A 4DDQA 1SEUA 1O28A 4GTBA 1O2AA 2PHCB 3DU5A 3BUEA 1K4SA 1TWGA 1O27A 4FYDA 2E2HA 2WB1A 3CQZA 1K83A 2P5MA 3AQPA 4FZBA 4KM9A 3KYLA 3LAPA 4EJ3A 2B9SB 4NOKA 5TJ3A 1WQHA 3MAQA 1TWHA 4C3IC 4QIWA 1WQFA 1EH1A 2O5JD 5CHPA 2F4QA 2JH3A 1NH3A 4KAWX 2RGRA 4C3HC 2E2IA 1BJTA 4BLAA 5IOTA 1WIHA 2R7ZA 4LQYA 4FGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9N A;  3ORE A;  4KDD A;  4KB2 A;  1Y69 8;  3ERE D;  2Y3P A;  1B4B A;  4KB4 A;  3VA7 A;  1WQG A;  1ZVU A;  4G0W A;  5JVO A;  4DDQ A;  1ISE A;  3V4G A;  1GE9 A;  4G0U A;  3LAJ A;  2XCQ A;  1B4A A;  5MLC 9;  4JLR C;  3L4J A;  2PHC B;  4J3N A;  3BUE A;  3OPF A;  3LAP A;  2P5M A;  2KWA A;  3LPX A;  1XXB A;  1EK8 A;  3NUH A;  1BGW A;  4KC6 A;  1XXA A;  2XCR B;  3FOE A;  3L4K A;  4FM9 A;  4G0V A;  1WQH A;  5CJ9 A;  4OYD B;  3FOF A;  1WQF A;  4GFQ A;  1DD5 A;  3LF9 A;  1IS1 A;  1EH1 A;  5JSB B;  1AB4 A;  1XXC A;  3CAG A;  3OEP A;  4L8I A;  3LHP S;  4KAW X;  2XCO A;  2RGR A;  3QX3 A;  5JSN B;  3FHZ A;  2ZFZ A;  1BJT A;  1WIH A;  3MML B; 
#chains in the Genus database with same CATH topology
 2O5I A;  2NVY C;  5C4J C;  2V6S A;  3S0X A;  3S2D C;  2JA5 A;  1USO A;  3IAY A;  3GTK K;  4GTE A;  4A3G K;  3LPX A;  4KC6 A;  1XXA A;  2A6E A;  4BLB A;  1K83 K;  4OYD B;  2R4G A;  3CAG A;  3H0G A;  3S17 K;  4A3K C;  1Y1W A;  3HOY K;  3LHP S;  3QX3 A;  1TGO A;  4IP9 A;  4O2D A;  4BKW A;  4KAT A;  3HOU C;  3HOW K;  3I4N K;  2R7Z K;  3M3Y C;  1PJ5 A;  3N3Y A;  1IW7 A;  2WAQ D;  5IOR A;  3S1Q K;  2A68 A;  3S1N K;  2PMZ A;  3L4J A;  3GTL K;  3K5M A;  1RRJ A;  3GTG C;  5M5X K;  2R92 K;  3S16 K;  4LJZ A;  4A93 C;  4LMO A;  2JA8 C;  4NOL A;  4QJV B;  4KAS A;  1VLO A;  4GFQ A;  1XZQ B;  2E2J K;  4L8I A;  4IP8 A;  2JA7 A;  1ZYR D;  3JST A;  3S1R C;  5FLM K;  2V6T A;  3PO2 K;  4LLG A;  2JA6 K;  3K58 A;  3FKI A;  1JOE A;  1G51 A;  1R9T C;  3S14 K;  3GTJ A;  5C9H A;  3ERE D;  1R5Z A;  1XPP A;  3WVO A;  1IL2 A;  3VA7 A;  3N0C A;  4A3D C;  3GEI A;  3GDZ A;  3T01 A;  1X31 C;  4P5B A;  4JLR C;  4P5A A;  5L46 A;  3GTP A;  2A69 D;  4J3N A;  3SZZ A;  2O5J A;  5TMC A;  4C2M C;  4H3T A;  1DD5 A;  5JSB B;  2PA8 D;  3AD7 C;  3TTG A;  5IYC K;  3HKZ D;  4LK1 A;  4Y52 C;  2Y0S L;  3MML B;  1L0W A;  1IE0 A;  2D6F C;  3N0B A;  3ORE A;  3K59 A;  2B63 K;  1Y69 8;  1IBA A;  4AHC A;  1Y1V C;  4A3M K;  5C44 C;  3RZO K;  3GTK A;  3S2H K;  2PHC B;  4P9S A;  3AQP A;  3LAP A;  1K83 A;  2EBB A;  4BY1 K;  2R93 K;  1DCO A;  3MAQ A;  4C3J K;  2NVQ C;  1TWF K;  3WOD A;  1EH1 A;  1TWA K;  4KMU A;  3ADA C;  3HOV K;  2YU9 K;  4KAW X;  2V6U A;  4C3H C;  4BBS K;  2E2H C;  2R7Z A;  3HOZ C;  4QIW L;  4FGU A;  3S15 C;  2JA7 K;  4F3E A;  3GTO A;  3I4M C;  3H0G C;  3RZD K;  1Y1W C;  4A3L C;  1I6V A;  1VH2 A;  4GZY A;  1MIU A;  4AYB D;  1I50 K;  2WAQ L;  5IYB C;  3GSI A;  3Q3Q A;  4XSX A;  3FOE A;  4A3F K;  1TWG K;  3CQZ K;  4NOM A;  3LF9 A;  5JFE A;  1AB4 A;  5IP7 K;  3G4A A;  3P9A A;  1EI6 A;  4BBR C;  1TWH K;  2GSU A;  1ZBS A;  1R49 A;  1WCM C;  2WB1 L;  5C4J K;  2JA6 A;  5IYD C;  2CW0 A;  3DXJ A;  2NVX A;  4ILD A;  4D3Z A;  2CW0 D;  4A3I C;  3V4G A;  1YX2 A;  1SMY A;  4C3I K;  3FKI C;  1XZP B;  3DU6 A;  4QCL A;  3GTJ C;  1HI9 A;  4A3E C;  4GTC A;  3GTM A;  3HOX K;  3GTQ A;  2VUM K;  4BXX K;  4QJV A;  2PA8 L;  3AD8 C;  2FQO A;  4KMH A;  2A6E D;  1XZQ A;  3HKZ L;  4XSZ A;  4MEX A;  1I6H C;  2B63 A;  4OIR A;  1KQ4 A;  4KDD A;  4KB2 A;  3GTG K;  5FJ8 K;  4NOI A;  5M3M K;  3GTO K;  1ISE A;  4G0U A;  3LAJ A;  2R93 A;  5C3E C;  4KN7 A;  1K4T A;  5EGE A;  1IW7 D;  1TWF A;  2GAG C;  1EK8 A;  2A68 D;  3EQL A;  1TWA A;  1VJE A;  1TWC C;  2PMZ D;  1DCH A;  2YU9 A;  4G7Z A;  3GTK C;  1R9T K;  3BP8 C;  1C0A A;  4Q5G A;  1K83 C;  4KM8 A;  3S17 C;  3HOY C;  1WSR A;  3AD9 C;  1I50 A;  4MQ9 A;  2NVX K;  2FQT A;  1O24 A;  1YNJ A;  1ZVU A;  4DDQ A;  1J6X A;  3HOW C;  4GTB A;  2R7Z C;  3I4N C;  2W7V A;  5TMF A;  4A3B K;  1TWG A;  4FYD A;  2WB1 A;  3CQZ A;  4XLN A;  4Q4Z A;  3PO3 K;  3S1M K;  3S1Q C;  4EJ3 A;  4A3J K;  1I3Q C;  2B9S B;  1WQH A;  1TWH A;  1IQ0 A;  4ZH4 A;  1WQF A;  2O5J D;  5M5Y K;  3GTL C;  3H3V D;  2R92 C;  5CHP A;  3GTM K;  2NVT K;  2RGR A;  1Y1V K;  4WJ3 M;  3GTQ K;  1BJT A;  5C44 K;  1WIH A;  1VRQ C;  4Q5S A;  1HQM A;  5C4X C;  2E2J C;  1SFO K;  4D3Y A;  1WOR A;  2Y3P A;  3BP3 A;  5FLM C;  3K5L A;  4LK0 A;  4Y7N C;  5HL8 A;  3PO2 C;  1JVI A;  2NVQ K;  2E2I C;  1T8I A;  3K7A K;  5M5W K;  3M4A A;  4WJ4 A;  1SC7 A;  1O2B A;  2VUM A;  1WOO A;  3L4K A;  2E2H K;  4G0V A;  3HOZ K;  3A8I A;  3FOF A;  1VGX A;  1JQW A;  3AH5 A;  3OEP A;  3TFJ A;  3I4M K;  2JA5 C;  2XCO A;  5JSN B;  2PPB A;  1YNN A;  4GT9 A;  4OIQ A;  3GTG A;  5IYC C;  2A6H A;  1YNN D;  3SJR A;  5EGH A;  4A3C K;  2GAH C;  3AQO A;  4BY7 K;  4OIO A;  5MLC 9;  3T00 A;  1I6V D;  4KAR A;  1WOP A;  4A3M C;  4O26 A;  5IP9 K;  1XZP A;  2CFA A;  1R9T A;  2PMZ L;  3HXA A;  5CJ9 A;  4X6A C;  4GTF A;  1TL8 A;  1ZXO A;  4AN8 A;  2NVY K;  3GIR A;  4BY1 C;  3FHZ A;  1F7V A;  4C3J C;  3S2D K;  2YU9 C;  3M4O C;  1YCL A;  3IPJ A;  4OIN A;  4BBS C;  4GTD A;  3SZY A;  2JA7 C;  1INN A;  1EFW A;  4C45 A;  4KMD A;  4A3K K;  3K5N A;  1I6H K;  2CFA B;  1I50 C;  1BGW A;  1SMY D;  2Y0S A;  1A35 A;  1Y1V A;  5IOQ A;  3HOU K;  4A3F C;  4XLP A;  3M3Y K;  1WSV A;  4GTL A;  3GTP C;  3CQZ C;  1SFO A;  1PJ6 A;  5IP7 C;  1TWH C;  3K5O A;  1J6V A;  5C3E K;  4JK1 A;  1TWC K;  1V9M A;  4A93 K;  2JA8 K;  1SEU A;  1O2A A;  3DU5 A;  3BUE A;  1K4S A;  2E2H A;  3A8J A;  4KM9 A;  2P5M A;  3S1R K;  4C3I C;  4QIW A;  4A3G C;  1NH3 A;  4QIW D;  3HOX C;  5IOT A;  4A3D K;  2P8T A;  2VUM C;  4BXX C;  3A8K A;  2WAQ A;  4GTA A;  5E68 A;  3G4C A;  1I3Q K;  1GE9 A;  4C2M K;  4AYB L;  1WCM A;  1DCP A;  1EQR A;  1RR8 C;  1YNJ D;  3GTO C;  1O29 A;  1ZYR A;  2NVY A;  3S1N C;  4Y52 K;  5C4X K;  1O26 A;  1J6W A;  4YFN A;  1XXC A;  4AH6 A;  2WB1 D;  4YFX A;  3S16 C;  5CQG A;  4Y7N K;  4M1X A;  4KN4 A;  2E2I K;  1F9N A;  4FXD A;  4RMF A;  4KB4 A;  1HQM D;  1WQG A;  2A69 A;  1ZQ1 C;  4YFK A;  5JVO A;  4XCH A;  2ZUF A;  2JA6 C;  1O2F B;  2XCQ A;  1B4A A;  5D4D A;  5M3F K;  3K57 A;  3S14 C;  3T02 A;  1Q8I A;  2NVX C;  2JA5 K;  4G7O A;  2KWA A;  3HKZ A;  2XCR B;  1V5V A;  4C3H K;  2GSN A;  3TFH A;  3TFI A;  1IS1 A;  4A3B C;  3S15 K;  1J98 A;  3PO3 C;  3S1M C;  3H0G K;  4A3J C;  1PJ7 A;  1Y1W K;  4A3L K;  1BS2 A;  2RH6 A;  4KMA A;  1O25 A;  5IYB K;  3GTM C;  4OIP A;  2NVT C;  1B4B A;  1A31 A;  1TWC A;  3GTQ C;  1F93 A;  4YG2 A;  4G0W A;  1A36 A;  1WOS A;  1SFO C;  2A6H D;  4MEY A;  4X6A K;  2B63 C;  3OPF A;  1F7U A;  1EJ9 A;  3NUH A;  4BBR K;  1XXB A;  1WCM K;  3RZO C;  4LOW A;  4FM9 A;  4Q5V A;  5IYD K;  1RU0 A;  2GSO A;  3K7A C;  3S2H C;  5IOS A;  4PAB A;  3M4O K;  1UV7 A;  2R93 C;  4LR2 A;  2ZFZ A;  4A3I K;  1TWF C;  4AYB A;  1TWA C;  1USM A;  2BE5 A;  3HOV C;  1I3Q A;  3FKI K;  1LPQ A;  4C2M A;  4WIL A;  3GTL A;  3GTJ K;  2BE5 D;  2R92 A;  4A3E K;  1O28 A;  4A3C C;  1BDF A;  1O27 A;  3RZD C;  4FZB A;  4BY7 C;  3KYL A;  4PAA A;  3GTP K;  2ZUE A;  4NOK A;  3GEH A;  5TJ3 A;  4G7H A;  2F4Q A;  3H3V L;  2JH3 A;  5IP9 C;  3GEE A;  2E2I A;  2Y0S D;  4BLA A;  1TWG C;  4LQY A; 
#chains in the Genus database with same CATH homology
 2WAQ A;  4GTA A;  4F3E A;  3GTO A;  4D3Y A;  2Y3P A;  3G4C A;  3K5L A;  1MIU A;  3S0X A;  1GE9 A;  2JA5 A;  1WCM A;  1T8I A;  3IAY A;  3Q3Q A;  3M4A A;  4GTE A;  1RR8 C;  1SC7 A;  1YNJ D;  3FOE A;  1O2B A;  2VUM A;  3LPX A;  4KC6 A;  1XXA A;  1O29 A;  4BLB A;  3L4K A;  4G0V A;  2NVY A;  4OYD B;  4NOM A;  1O26 A;  2R4G A;  3FOF A;  3LF9 A;  5JFE A;  1XXC A;  3H0G A;  3CAG A;  1AB4 A;  1Y1W A;  3AH5 A;  3G4A A;  3OEP A;  3P9A A;  3LHP S;  2GSU A;  1ZBS A;  1R49 A;  2XCO A;  5JSN B;  5CQG A;  1TGO A;  4IP9 A;  3QX3 A;  2JA6 A;  4BKW A;  4M1X A;  4GT9 A;  4KAT A;  3GTG A;  2NVX A;  4FXD A;  1F9N A;  4ILD A;  1YNN D;  3SJR A;  5EGH A;  4D3Z A;  2CW0 D;  4KB4 A;  1HQM D;  1WQG A;  3AQO A;  3N3Y A;  5JVO A;  5IOR A;  3V4G A;  2PMZ A;  2XCQ A;  1B4A A;  5MLC 9;  3L4J A;  1I6V D;  3K57 A;  3K5M A;  1RRJ A;  1Q8I A;  4KAR A;  3DU6 A;  4O26 A;  4QCL A;  2KWA A;  4GTC A;  3HKZ A;  4LMO A;  2XCR B;  4NOL A;  3GTM A;  2CFA A;  1R9T A;  2GSN A;  4KAS A;  5CJ9 A;  3GTQ A;  1IS1 A;  4GFQ A;  4GTF A;  1TL8 A;  1ZXO A;  4AN8 A;  4KMH A;  4L8I A;  4IP8 A;  2A6E D;  2JA7 A;  1ZYR D;  3FHZ A;  4C3J C;  2B63 A;  2RH6 A;  4KMA A;  1O25 A;  3K58 A;  3FKI A;  4KDD A;  4KB2 A;  1KQ4 A;  3GTJ A;  5C9H A;  3ERE D;  1R5Z A;  1A31 A;  1TWC A;  3WVO A;  1B4B A;  3VA7 A;  3N0C A;  4GTD A;  4G0W A;  1A36 A;  1ISE A;  2A6H D;  4G0U A;  3LAJ A;  4P5B A;  4JLR C;  4P5A A;  2R93 A;  3GTP A;  2A69 D;  4J3N A;  4KMD A;  1K4T A;  5EGE A;  3OPF A;  1IW7 D;  3K5N A;  1EJ9 A;  1TWF A;  3NUH A;  1XXB A;  1EK8 A;  2A68 D;  1TWA A;  1BGW A;  2CFA B;  1SMY D;  4C2M C;  4FM9 A;  2Y0S A;  4Q5V A;  1A35 A;  2GSO A;  2YU9 A;  5IOS A;  4H3T A;  1DD5 A;  1Y1V A;  5JSB B;  5IOQ A;  4Q5G A;  4GTL A;  4LR2 A;  2ZFZ A;  1SFO A;  4KM8 A;  3MML B;  3N0B A;  4AYB A;  3ORE A;  3K59 A;  3K5O A;  1Y69 8;  4AHC A;  1I3Q A;  1I50 A;  1LPQ A;  4C2M A;  3GTL A;  1O24 A;  2BE5 D;  1ZVU A;  3GTK A;  1V9M A;  2R92 A;  4DDQ A;  1SEU A;  1O28 A;  4GTB A;  1O2A A;  2PHC B;  3DU5 A;  3BUE A;  1K4S A;  1TWG A;  1O27 A;  4FYD A;  2E2H A;  2WB1 A;  3CQZ A;  1K83 A;  2P5M A;  3AQP A;  4FZB A;  4KM9 A;  3KYL A;  3LAP A;  4EJ3 A;  2B9S B;  4NOK A;  5TJ3 A;  1WQH A;  3MAQ A;  1TWH A;  4C3I C;  4QIW A;  1WQF A;  1EH1 A;  2O5J D;  5CHP A;  2F4Q A;  2JH3 A;  1NH3 A;  4KAW X;  2RGR A;  4C3H C;  2E2I A;  1BJT A;  4BLA A;  5IOT A;  1WIH A;  2R7Z A;  4LQY A;  4FGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...