4KB4A

Crystal structure of ribosome recycling factor mutant r31a from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
184
structure length
184
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGAANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 62
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kb4A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kb4A02
1EH1A 3LHPS 1BJTA 3OPFA 3L4JA 1WIHA 1XXCA 4KB4A 4JLRC 3OEPA 5JVOA 3VA7A 1IS1A 3L4KA 3ERED 1XXAA 2KWAA 4KAWX 4KDDA 1XXBA 1BGWA 3LF9A 3V4GA 4KB2A 2ZFZA 3FHZA 4DDQA 1WQGA 4KC6A 1ZVUA 3LAJA 2P5MA 1Y698 4J3NA 3FOFA 4GFQA 3NUHA 4FM9A 5JSBB 2Y3PA 5CJ9A 4G0WA 2XCOA 3CAGA 3LPXA 1ISEA 2XCRB 4L8IA 3LAPA 4G0VA 1DD5A 5JSNB 3FOEA 2RGRA 3QX3A 3BUEA 2PHCB 1GE9A 1EK8A 5MLC9 1AB4A 1B4AA 3OREA 1WQHA 4OYDB 1B4BA 1F9NA 2XCQA 3MMLB 1WQFA 4G0UA
chains in the Genus database with same CATH superfamily
2CFAA 3LHPS 4IP8A 3S1RK 2PMZA 1L0WA 2W7VA 4XSZA 4XLPA 2ZFZA 1EFWA 3HOYK 1Y698 5TMFA 4GFQA 2NVTK 2RH6A 2CW0A 1DD5A 1EI6A 3T02A 1B4AA 2Y0SL 2JH3A 4OYDB 2JA8K 4LK1A 2V6UA 3WODA 3CQZC 5FLMC 4Q5SA 5C4JK 1K83A 3HOYC 2JA5K 1JOEA 4KB4A 1I6VA 3S14K 4AN8A 3LF9A 4NOMA 3K7AK 4YFXA 1WORA 2E2HK 1WQGA 4A3CC 5TMCA 4ILDA 4NOLA 2BE5D 3MAQA 4G0WA 4FGUA 3S15K 1IW7A 4Q5VA 5M5WK 3TFHA 4QJVB 3S1QK 3IPJA 4M1XA 3DXJA 4Y7NK 3SZYA 5M3MK 4Y52K 1TWHC 3K7AC 4LQYA 2R93C 3S14C 2R7ZC 1O24A 1ZYRA 3ERED 4LOWA 3HKZD 3HOUK 3H0GA 1T8IA 4AYBL 3FHZA 3RZDC 4KASA 5IORA 2E2JC 2B9SB 1TWHA 2NVYK 4A3MC 3GTOK 4L8IA 4A3FK 1ZXOA 5C44C 1RR8C 1AB4A 4J3NA 1UV7A 5HL8A 4F3EA 4GTCA 1O26A 2NVYC 2KWAA 4KMUA 1BGWA 3N0BA 2JA7A 1DCHA 2A6EA 3WVOA 2JA6A 4YFNA 4NOKA 3LAJA 4A3JK 3GEHA 4RMFA 2JA6C 4A3BC 4A3DK 4EJ3A 3HOXC 3S16C 2R7ZK 4LLGA 5M5XK 1YNNA 5IP7K 3PO3C 4WJ4A 1WSVA 4A93C 4P5BA 4G7HA 3GTLA 1TWAK 2PPBA 3GTGC 2EBBA 1ZQ1C 1VH2A 4LJZA 5M3FK 1R9TK 4Y52C 4YFKA 4O2DA 2JA6K 4A3DC 4KDDA 3G4CA 4QIWL 4WJ3M 5IP9C 2NVXK 5TJ3A 4BBRC 3GTJA 1X31C 2P5MA 4C3IC 2GAHC 1I50C 4AH6A 1SFOC 1O2FB 4C3JK 4GTDA 2E2IC 3S2DC 3LAPA 4G0VA 1K4SA 3FOEA 1SEUA 1J98A 3S2HK 3EQLA 2A69A 4PAAA 2R7ZA 2CFAB 1O29A 3N3YA 1F9NA 2R93A 5IYDC 4G7ZA 2Y0SA 4AYBA 4D3YA 3HOUC 1XPPA 3RZDK 1IS1A 4BBRK 4KAWX 3GTMC 3S2DK 1INNA 4OINA 4DDQA 1BS2A 4FYDA 1Y1VA 4BBSC 1NH3A 3LPXA 2WAQL 3H0GC 1HQMD 3ADAC 4XCHA 1EK8A 5MLC9 5CHPA 4C3HK 3G4AA 1J6XA 4GT9A 4KN7A 3HOVC 4A3BK 3M3YK 4QCLA 4C2MC 4MEXA 4JK1A 1IBAA 3S1QC 1HQMA 4MEYA 3IAYA 5IP7C 3PO3K 1I50A 1SFOA 4JLRC 3HKZL 1MIUA 1VGXA 3HOWC 2O5JA 3GTQC 2PA8L 1VLOA 4A3IK 3K57A 4A3CK 3TFIA 4FM9A 1HI9A 1WOPA 4X6AK 4P9SA 2A6HA 2FQTA 1WCMK 5C4XC 5E68A 4A3GC 5D4DA 3GTPA 3GTLC 3M4OC 3GTKK 1WQHA 5EGEA 2NVTC 3HXAA 3DU5A 2WAQD 4QIWD 2A68D 3AD7C 4BY1C 5IYCC 4GTLA 3GTQK 4Q4ZA 1XXAA 1XZPB 1YX2A 1F7VA 4O26A 1I50K 4A3IC 4KB2A 3K59A 4C3JC 2NVYA 3HOVK 3DU6A 3T01A 3TFJA 5JSBB 3GTPC 2R4GA 4KARA 4OIPA 4ZH4A 3GTOA 3HOZC 4BBSK 3GTMA 3BP3A 3S16K 1TWGK 2GSOA 2WB1A 1Q8IA 1EH1A 3TTGA 3GTQA 4A3JC 4A93K 3OPFA 1YNND 1F7UA 4G7OA 4A3LK 1VJEA 4QIWA 2WAQA 3GSIA 4BKWA 2A6ED 3SJRA 4D3ZA 3K58A 1XZQA 4PABA 4GTEA 2E2HA 3AD9C 4KM8A 5CJ9A 3S1MK 4XLNA 5FJ8K 2NVQK 2RGRA 3GTJC 2V6TA 4WILA 4A3FC 3QX3A 1SMYA 3OREA 2E2JK 1Y1VC 3FKIK 3AH5A 1WQFA 3M4OK 3AD8C 4GTFA 2YU9A 5C3EC 3S2HC 1TGOA 1O2AA 4A3GK 1BJTA 3S17K 3L4KA 4AHCA 2VUMA 1DCPA 1C0AA 3FOFA 1SC7A 3HKZA 1I6HK 1Y1WC 1ZYRD 3I4MC 4FXDA 3S15C 4OIRA 1PJ5A 2R92A 1ZVUA 2XCQA 3GTPK 4GTBA 4G0UA 2PA8D 1YCLA 3VA7A 1IW7D 1I6HC 3H3VD 1RU0A 3A8KA 3RZOK 3GTGA 4XSXA 3PO2K 4KC6A 3GDZA 4AYBD 2Y0SD 2JA7K 4P5AA 2E2IK 1I6VD 2A69D 2JA5C 5C44K 2R92K 3BP8C 1R9TA 1JQWA 1V9MA 5IYDK 2JA8C 1Y1WA 1SFOK 3RZOC 3CQZK 5FLMK 1TWAA 3GTLK 3N0CA 5M5YK 2NVXA 1BDFA 1O27A 3L4JA 2O5IA 2CW0D 1ZBSA 2VUMC 1A35A 3JSTA 1F93A 2WB1L 1USOA 5IOTA 1USMA 1TWHK 4A3MK 2GAGC 4A3EC 4BY7C 1WCMA 3S1NK 3NUHA 1TWCC 3A8IA 3H0GK 5IOSA 1O28A 2PMZD 3I4NK 3FKIA 1TWFC 3HOXK 1Y1WK 3K5LA 1A36A 2PHCB 1WOOA 1B4BA 4H3TA 5IOQA 1TWAC 1PJ6A 3SZZA 2P8TA 4QJVA 3HOZK 3OEPA 3K5NA 1J6WA 1I3QK 1O25A 4NOIA 5L46A 5IYBC 2YU9K 4BY1K 1IE0A 2JA5A 3I4NC 4BY7K 3GEIA 4MQ9A 4Q5GA 1XZQB 2Y3PA 3CAGA 5JFEA 4GTAA 3GTKC 2GSUA 1WCMC 1XZPA 4BLBA 3GTOC 1TWGA 3P9AA 1LPQA 5C4JC 4A3KC 4LR2A 4LMOA 1IQ0A 4KMAA 2GSNA 3MMLB 1I3QA 1SMYD 1DCOA 5IP9K 2ZUFA 2NVXC 2R92C 2D6FC 1WIHA 3S1MC 5C9HA 3K5OA 4X6AC 3AQOA 3GTJK 1YNJD 1V5VA 5C4XK 3Q3QA 4LK0A 3PO2C 1EJ9A 3A8JA 2JA7C 1EQRA 3HOWK 3GTGK 4BXXK 4FZBA 2F4QA 1I3QC 1JVIA 2ZUEA 2V6SA 4C45A 4GZYA 3GEEA 3S1RC 3M3YC 3S1NC 1TWGC 2BE5A 2WB1D 2XCRB 1KQ4A 4C3HC 5EGHA 1VRQC 3GTKA 1TWFK 1RRJA 3I4MK 2VUMK 4KM9A 3H3VL 1R5ZA 3S17C 1K83K 3K5MA 1TWCK 3V4GA 2PMZL 5IYCK 2E2HC 2B63K 4OIOA 4C2MA 1YNJA 1J6VA 1Y1VK 5CQGA 3GTMK 4KN4A 2A68A 1WOSA 4BLAA 5C3EK 3BUEA 1GE9A 3GIRA 1TWFA 3FKIC 3AQPA 1O2BA 4A3KK 4A3LC 3KYLA 1TWCA 2B63C 5JVOA 1XXCA 1G51A 5IYBK 2YU9C 1K4TA 2A6HD 1PJ7A 3M4AA 2B63A 1XXBA 2NVQC 4IP9A 4C3IK 4C2MK 1R49A 1IL2A 3T00A 2O5JD 3S0XA 2XCOA 4A3EK 1ISEA 4YG2A 2FQOA 4Y7NC 2R93K 5JSNB 1K83C 4BXXC 4KMDA 1R9TC 1WSRA 1A31A 3CQZA 2E2IA 4KATA 4KMHA 1TL8A 4OIQA
chains in the Genus database with same CATH topology
1EH1A 3GTQA 2CFAA 3LHPS 4IP8A 3OPFA 3OEPA 1YNND 3K5NA 1O25A 2PMZA 4KDDA 3G4CA 2JA5A 5TJ3A 2ZFZA 4QIWA 2WAQA 3GTJA 4BKWA 2P5MA 1Y698 2A6ED 3SJRA 4D3ZA 3K58A 4GFQA 4C3IC 4Q5GA 4GTEA 2E2HA 4KM8A 2Y3PA 5CJ9A 2RH6A 3CAGA 5JFEA 4GTAA 2GSUA 4GTDA 4BLBA 3LAPA 4G0VA 1TWGA 1DD5A 3P9AA 1K4SA 1LPQA 1SEUA 3FOEA 2RGRA 3QX3A 2R7ZA 1B4AA 2CFAB 3OREA 4LMOA 1O29A 4LR2A 3N3YA 2GSNA 4OYDB 2R93A 1F9NA 2JH3A 3MMLB 4KMAA 3AH5A 1WQFA 1I3QA 4GTFA 2Y0SA 2YU9A 4AYBA 1SMYD 4D3YA 1TGOA 1K83A 1O2AA 1BJTA 1WIHA 3L4KA 4KB4A 1IS1A 5C9HA 3K5OA 4KAWX 3AQOA 1YNJD 4AN8A 3LF9A 4NOMA 4AHCA 3Q3QA 2VUMA 4DDQA 1WQGA 4FYDA 1Y1VA 1EJ9A 3FOFA 1NH3A 4ILDA 1SC7A 4NOLA 2BE5D 3HKZA 3MAQA 4G0WA 4FZBA 4FGUA 3LPXA 2F4QA 1ZYRD 4Q5VA 4FXDA 1HQMD 4M1XA 1EK8A 5MLC9 5CHPA 3G4AA 2R92A 1ZVUA 2XCQA 4GT9A 2XCRB 1KQ4A 4C3HC 4QCLA 4GTBA 5EGHA 4C2MC 4G0UA 4LQYA 3IAYA 3GTKA 1I50A 1RRJA 1SFOA 4JLRC 3VA7A 1IW7D 4KM9A 1O24A 3ERED 1R5ZA 1MIUA 3K5MA 3V4GA 3H0GA 1T8IA 3GTGA 3FHZA 4KASA 4KC6A 5IORA 2B9SB 3K57A 4P5AA 1TWHA 4C2MA 4FM9A 5CQGA 4L8IA 1I6VD 2A69D 4BLAA 3GTPA 1ZXOA 3BUEA 1GE9A 1RR8C 1R9TA 1AB4A 1V9MA 1WQHA 1TWFA 5EGEA 3AQPA 1Y1WA 1O2BA 4J3NA 3DU5A 1TWAA 3KYLA 1TWCA 2A68D 3N0CA 2NVXA 1O27A 3L4JA 5JVOA 4F3EA 1XXCA 2CW0D 1ZBSA 1K4TA 4GTCA 1O26A 4GTLA 1XXAA 2A6HD 1A35A 2KWAA 3M4AA 2B63A 4O26A 1BGWA 1XXBA 3N0BA 2JA7A 4IP9A 4KB2A 3K59A 5IOTA 4C3JC 3WVOA 2NVYA 1R49A 2JA6A 4NOKA 3LAJA 3DU6A 1WCMA 3NUHA 2O5JD 3S0XA 5JSBB 2R4GA 4EJ3A 1TL8A 1O28A 1ISEA 2XCOA 4KARA 5IOSA 3FKIA 5JSNB 4KMDA 3K5LA 1A36A 1A31A 2PHCB 3CQZA 4P5BA 3GTLA 3GTOA 2E2IA 4KATA 3GTMA 4KMHA 1B4BA 4H3TA 2WB1A 2GSOA 5IOQA 1Q8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH1 A;  3LHP S;  1BJT A;  3OPF A;  3L4J A;  1WIH A;  1XXC A;  4KB4 A;  4JLR C;  3OEP A;  5JVO A;  3VA7 A;  1IS1 A;  3L4K A;  3ERE D;  1XXA A;  2KWA A;  4KAW X;  4KDD A;  1XXB A;  1BGW A;  3LF9 A;  3V4G A;  4KB2 A;  2ZFZ A;  3FHZ A;  4DDQ A;  1WQG A;  4KC6 A;  1ZVU A;  3LAJ A;  2P5M A;  1Y69 8;  4J3N A;  3FOF A;  4GFQ A;  3NUH A;  4FM9 A;  5JSB B;  2Y3P A;  5CJ9 A;  4G0W A;  2XCO A;  3CAG A;  3LPX A;  1ISE A;  2XCR B;  4L8I A;  3LAP A;  4G0V A;  1DD5 A;  5JSN B;  3FOE A;  2RGR A;  3QX3 A;  3BUE A;  2PHC B;  1GE9 A;  1EK8 A;  5MLC 9;  1AB4 A;  1B4A A;  3ORE A;  1WQH A;  4OYD B;  1B4B A;  1F9N A;  2XCQ A;  3MML B;  1WQF A;  4G0U A; 
#chains in the Genus database with same CATH topology
 2CFA A;  3LHP S;  4IP8 A;  3S1R K;  2PMZ A;  1L0W A;  2W7V A;  4XSZ A;  4XLP A;  2ZFZ A;  1EFW A;  3HOY K;  1Y69 8;  5TMF A;  4GFQ A;  2NVT K;  2RH6 A;  2CW0 A;  1DD5 A;  1EI6 A;  3T02 A;  1B4A A;  2Y0S L;  2JH3 A;  4OYD B;  2JA8 K;  4LK1 A;  2V6U A;  3WOD A;  3CQZ C;  5FLM C;  4Q5S A;  5C4J K;  1K83 A;  3HOY C;  2JA5 K;  1JOE A;  4KB4 A;  1I6V A;  3S14 K;  4AN8 A;  3LF9 A;  4NOM A;  3K7A K;  4YFX A;  1WOR A;  2E2H K;  1WQG A;  4A3C C;  5TMC A;  4ILD A;  4NOL A;  2BE5 D;  3MAQ A;  4G0W A;  4FGU A;  3S15 K;  1IW7 A;  4Q5V A;  5M5W K;  3TFH A;  4QJV B;  3S1Q K;  3IPJ A;  4M1X A;  3DXJ A;  4Y7N K;  3SZY A;  5M3M K;  4Y52 K;  1TWH C;  3K7A C;  4LQY A;  2R93 C;  3S14 C;  2R7Z C;  1O24 A;  1ZYR A;  3ERE D;  4LOW A;  3HKZ D;  3HOU K;  3H0G A;  1T8I A;  4AYB L;  3FHZ A;  3RZD C;  4KAS A;  5IOR A;  2E2J C;  2B9S B;  1TWH A;  2NVY K;  4A3M C;  3GTO K;  4L8I A;  4A3F K;  1ZXO A;  5C44 C;  1RR8 C;  1AB4 A;  4J3N A;  1UV7 A;  5HL8 A;  4F3E A;  4GTC A;  1O26 A;  2NVY C;  2KWA A;  4KMU A;  1BGW A;  3N0B A;  2JA7 A;  1DCH A;  2A6E A;  3WVO A;  2JA6 A;  4YFN A;  4NOK A;  3LAJ A;  4A3J K;  3GEH A;  4RMF A;  2JA6 C;  4A3B C;  4A3D K;  4EJ3 A;  3HOX C;  3S16 C;  2R7Z K;  4LLG A;  5M5X K;  1YNN A;  5IP7 K;  3PO3 C;  4WJ4 A;  1WSV A;  4A93 C;  4P5B A;  4G7H A;  3GTL A;  1TWA K;  2PPB A;  3GTG C;  2EBB A;  1ZQ1 C;  1VH2 A;  4LJZ A;  5M3F K;  1R9T K;  4Y52 C;  4YFK A;  4O2D A;  2JA6 K;  4A3D C;  4KDD A;  3G4C A;  4QIW L;  4WJ3 M;  5IP9 C;  2NVX K;  5TJ3 A;  4BBR C;  3GTJ A;  1X31 C;  2P5M A;  4C3I C;  2GAH C;  1I50 C;  4AH6 A;  1SFO C;  1O2F B;  4C3J K;  4GTD A;  2E2I C;  3S2D C;  3LAP A;  4G0V A;  1K4S A;  3FOE A;  1SEU A;  1J98 A;  3S2H K;  3EQL A;  2A69 A;  4PAA A;  2R7Z A;  2CFA B;  1O29 A;  3N3Y A;  1F9N A;  2R93 A;  5IYD C;  4G7Z A;  2Y0S A;  4AYB A;  4D3Y A;  3HOU C;  1XPP A;  3RZD K;  1IS1 A;  4BBR K;  4KAW X;  3GTM C;  3S2D K;  1INN A;  4OIN A;  4DDQ A;  1BS2 A;  4FYD A;  1Y1V A;  4BBS C;  1NH3 A;  3LPX A;  2WAQ L;  3H0G C;  1HQM D;  3ADA C;  4XCH A;  1EK8 A;  5MLC 9;  5CHP A;  4C3H K;  3G4A A;  1J6X A;  4GT9 A;  4KN7 A;  3HOV C;  4A3B K;  3M3Y K;  4QCL A;  4C2M C;  4MEX A;  4JK1 A;  1IBA A;  3S1Q C;  1HQM A;  4MEY A;  3IAY A;  5IP7 C;  3PO3 K;  1I50 A;  1SFO A;  4JLR C;  3HKZ L;  1MIU A;  1VGX A;  3HOW C;  2O5J A;  3GTQ C;  2PA8 L;  1VLO A;  4A3I K;  3K57 A;  4A3C K;  3TFI A;  4FM9 A;  1HI9 A;  1WOP A;  4X6A K;  4P9S A;  2A6H A;  2FQT A;  1WCM K;  5C4X C;  5E68 A;  4A3G C;  5D4D A;  3GTP A;  3GTL C;  3M4O C;  3GTK K;  1WQH A;  5EGE A;  2NVT C;  3HXA A;  3DU5 A;  2WAQ D;  4QIW D;  2A68 D;  3AD7 C;  4BY1 C;  5IYC C;  4GTL A;  3GTQ K;  4Q4Z A;  1XXA A;  1XZP B;  1YX2 A;  1F7V A;  4O26 A;  1I50 K;  4A3I C;  4KB2 A;  3K59 A;  4C3J C;  2NVY A;  3HOV K;  3DU6 A;  3T01 A;  3TFJ A;  5JSB B;  3GTP C;  2R4G A;  4KAR A;  4OIP A;  4ZH4 A;  3GTO A;  3HOZ C;  4BBS K;  3GTM A;  3BP3 A;  3S16 K;  1TWG K;  2GSO A;  2WB1 A;  1Q8I A;  1EH1 A;  3TTG A;  3GTQ A;  4A3J C;  4A93 K;  3OPF A;  1YNN D;  1F7U A;  4G7O A;  4A3L K;  1VJE A;  4QIW A;  2WAQ A;  3GSI A;  4BKW A;  2A6E D;  3SJR A;  4D3Z A;  3K58 A;  1XZQ A;  4PAB A;  4GTE A;  2E2H A;  3AD9 C;  4KM8 A;  5CJ9 A;  3S1M K;  4XLN A;  5FJ8 K;  2NVQ K;  2RGR A;  3GTJ C;  2V6T A;  4WIL A;  4A3F C;  3QX3 A;  1SMY A;  3ORE A;  2E2J K;  1Y1V C;  3FKI K;  3AH5 A;  1WQF A;  3M4O K;  3AD8 C;  4GTF A;  2YU9 A;  5C3E C;  3S2H C;  1TGO A;  1O2A A;  4A3G K;  1BJT A;  3S17 K;  3L4K A;  4AHC A;  2VUM A;  1DCP A;  1C0A A;  3FOF A;  1SC7 A;  3HKZ A;  1I6H K;  1Y1W C;  1ZYR D;  3I4M C;  4FXD A;  3S15 C;  4OIR A;  1PJ5 A;  2R92 A;  1ZVU A;  2XCQ A;  3GTP K;  4GTB A;  4G0U A;  2PA8 D;  1YCL A;  3VA7 A;  1IW7 D;  1I6H C;  3H3V D;  1RU0 A;  3A8K A;  3RZO K;  3GTG A;  4XSX A;  3PO2 K;  4KC6 A;  3GDZ A;  4AYB D;  2Y0S D;  2JA7 K;  4P5A A;  2E2I K;  1I6V D;  2A69 D;  2JA5 C;  5C44 K;  2R92 K;  3BP8 C;  1R9T A;  1JQW A;  1V9M A;  5IYD K;  2JA8 C;  1Y1W A;  1SFO K;  3RZO C;  3CQZ K;  5FLM K;  1TWA A;  3GTL K;  3N0C A;  5M5Y K;  2NVX A;  1BDF A;  1O27 A;  3L4J A;  2O5I A;  2CW0 D;  1ZBS A;  2VUM C;  1A35 A;  3JST A;  1F93 A;  2WB1 L;  1USO A;  5IOT A;  1USM A;  1TWH K;  4A3M K;  2GAG C;  4A3E C;  4BY7 C;  1WCM A;  3S1N K;  3NUH A;  1TWC C;  3A8I A;  3H0G K;  5IOS A;  1O28 A;  2PMZ D;  3I4N K;  3FKI A;  1TWF C;  3HOX K;  1Y1W K;  3K5L A;  1A36 A;  2PHC B;  1WOO A;  1B4B A;  4H3T A;  5IOQ A;  1TWA C;  1PJ6 A;  3SZZ A;  2P8T A;  4QJV A;  3HOZ K;  3OEP A;  3K5N A;  1J6W A;  1I3Q K;  1O25 A;  4NOI A;  5L46 A;  5IYB C;  2YU9 K;  4BY1 K;  1IE0 A;  2JA5 A;  3I4N C;  4BY7 K;  3GEI A;  4MQ9 A;  4Q5G A;  1XZQ B;  2Y3P A;  3CAG A;  5JFE A;  4GTA A;  3GTK C;  2GSU A;  1WCM C;  1XZP A;  4BLB A;  3GTO C;  1TWG A;  3P9A A;  1LPQ A;  5C4J C;  4A3K C;  4LR2 A;  4LMO A;  1IQ0 A;  4KMA A;  2GSN A;  3MML B;  1I3Q A;  1SMY D;  1DCO A;  5IP9 K;  2ZUF A;  2NVX C;  2R92 C;  2D6F C;  1WIH A;  3S1M C;  5C9H A;  3K5O A;  4X6A C;  3AQO A;  3GTJ K;  1YNJ D;  1V5V A;  5C4X K;  3Q3Q A;  4LK0 A;  3PO2 C;  1EJ9 A;  3A8J A;  2JA7 C;  1EQR A;  3HOW K;  3GTG K;  4BXX K;  4FZB A;  2F4Q A;  1I3Q C;  1JVI A;  2ZUE A;  2V6S A;  4C45 A;  4GZY A;  3GEE A;  3S1R C;  3M3Y C;  3S1N C;  1TWG C;  2BE5 A;  2WB1 D;  2XCR B;  1KQ4 A;  4C3H C;  5EGH A;  1VRQ C;  3GTK A;  1TWF K;  1RRJ A;  3I4M K;  2VUM K;  4KM9 A;  3H3V L;  1R5Z A;  3S17 C;  1K83 K;  3K5M A;  1TWC K;  3V4G A;  2PMZ L;  5IYC K;  2E2H C;  2B63 K;  4OIO A;  4C2M A;  1YNJ A;  1J6V A;  1Y1V K;  5CQG A;  3GTM K;  4KN4 A;  2A68 A;  1WOS A;  4BLA A;  5C3E K;  3BUE A;  1GE9 A;  3GIR A;  1TWF A;  3FKI C;  3AQP A;  1O2B A;  4A3K K;  4A3L C;  3KYL A;  1TWC A;  2B63 C;  5JVO A;  1XXC A;  1G51 A;  5IYB K;  2YU9 C;  1K4T A;  2A6H D;  1PJ7 A;  3M4A A;  2B63 A;  1XXB A;  2NVQ C;  4IP9 A;  4C3I K;  4C2M K;  1R49 A;  1IL2 A;  3T00 A;  2O5J D;  3S0X A;  2XCO A;  4A3E K;  1ISE A;  4YG2 A;  2FQO A;  4Y7N C;  2R93 K;  5JSN B;  1K83 C;  4BXX C;  4KMD A;  1R9T C;  1WSR A;  1A31 A;  3CQZ A;  2E2I A;  4KAT A;  4KMH A;  1TL8 A;  4OIQ A; 
#chains in the Genus database with same CATH homology
 1EH1 A;  3GTQ A;  2CFA A;  3LHP S;  4IP8 A;  3OPF A;  3OEP A;  1YNN D;  3K5N A;  1O25 A;  2PMZ A;  4KDD A;  3G4C A;  2JA5 A;  5TJ3 A;  2ZFZ A;  4QIW A;  2WAQ A;  3GTJ A;  4BKW A;  2P5M A;  1Y69 8;  2A6E D;  3SJR A;  4D3Z A;  3K58 A;  4GFQ A;  4C3I C;  4Q5G A;  4GTE A;  2E2H A;  4KM8 A;  2Y3P A;  5CJ9 A;  2RH6 A;  3CAG A;  5JFE A;  4GTA A;  2GSU A;  4GTD A;  4BLB A;  3LAP A;  4G0V A;  1TWG A;  1DD5 A;  3P9A A;  1K4S A;  1LPQ A;  1SEU A;  3FOE A;  2RGR A;  3QX3 A;  2R7Z A;  1B4A A;  2CFA B;  3ORE A;  4LMO A;  1O29 A;  4LR2 A;  3N3Y A;  2GSN A;  4OYD B;  2R93 A;  1F9N A;  2JH3 A;  3MML B;  4KMA A;  3AH5 A;  1WQF A;  1I3Q A;  4GTF A;  2Y0S A;  2YU9 A;  4AYB A;  1SMY D;  4D3Y A;  1TGO A;  1K83 A;  1O2A A;  1BJT A;  1WIH A;  3L4K A;  4KB4 A;  1IS1 A;  5C9H A;  3K5O A;  4KAW X;  3AQO A;  1YNJ D;  4AN8 A;  3LF9 A;  4NOM A;  4AHC A;  3Q3Q A;  2VUM A;  4DDQ A;  1WQG A;  4FYD A;  1Y1V A;  1EJ9 A;  3FOF A;  1NH3 A;  4ILD A;  1SC7 A;  4NOL A;  2BE5 D;  3HKZ A;  3MAQ A;  4G0W A;  4FZB A;  4FGU A;  3LPX A;  2F4Q A;  1ZYR D;  4Q5V A;  4FXD A;  1HQM D;  4M1X A;  1EK8 A;  5MLC 9;  5CHP A;  3G4A A;  2R92 A;  1ZVU A;  2XCQ A;  4GT9 A;  2XCR B;  1KQ4 A;  4C3H C;  4QCL A;  4GTB A;  5EGH A;  4C2M C;  4G0U A;  4LQY A;  3IAY A;  3GTK A;  1I50 A;  1RRJ A;  1SFO A;  4JLR C;  3VA7 A;  1IW7 D;  4KM9 A;  1O24 A;  3ERE D;  1R5Z A;  1MIU A;  3K5M A;  3V4G A;  3H0G A;  1T8I A;  3GTG A;  3FHZ A;  4KAS A;  4KC6 A;  5IOR A;  2B9S B;  3K57 A;  4P5A A;  1TWH A;  4C2M A;  4FM9 A;  5CQG A;  4L8I A;  1I6V D;  2A69 D;  4BLA A;  3GTP A;  1ZXO A;  3BUE A;  1GE9 A;  1RR8 C;  1R9T A;  1AB4 A;  1V9M A;  1WQH A;  1TWF A;  5EGE A;  3AQP A;  1Y1W A;  1O2B A;  4J3N A;  3DU5 A;  1TWA A;  3KYL A;  1TWC A;  2A68 D;  3N0C A;  2NVX A;  1O27 A;  3L4J A;  5JVO A;  4F3E A;  1XXC A;  2CW0 D;  1ZBS A;  1K4T A;  4GTC A;  1O26 A;  4GTL A;  1XXA A;  2A6H D;  1A35 A;  2KWA A;  3M4A A;  2B63 A;  4O26 A;  1BGW A;  1XXB A;  3N0B A;  2JA7 A;  4IP9 A;  4KB2 A;  3K59 A;  5IOT A;  4C3J C;  3WVO A;  2NVY A;  1R49 A;  2JA6 A;  4NOK A;  3LAJ A;  3DU6 A;  1WCM A;  3NUH A;  2O5J D;  3S0X A;  5JSB B;  2R4G A;  4EJ3 A;  1TL8 A;  1O28 A;  1ISE A;  2XCO A;  4KAR A;  5IOS A;  3FKI A;  5JSN B;  4KMD A;  3K5L A;  1A36 A;  1A31 A;  2PHC B;  3CQZ A;  4P5B A;  3GTL A;  3GTO A;  2E2I A;  4KAT A;  3GTM A;  4KMH A;  1B4B A;  4H3T A;  2WB1 A;  2GSO A;  5IOQ A;  1Q8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...