4KB4A

Crystal structure of ribosome recycling factor mutant r31a from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
184
structure length
184
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGAANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 62
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kb4A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kb4A02
1WIHA 1Y698 2Y3PA 5JVOA 1XXAA 2PHCB 1AB4A 3VA7A 3QX3A 4J3NA 3FOEA 3L4KA 1WQHA 3CAGA 1ZVUA 3OPFA 1IS1A 4KDDA 5JSBB 4OYDB 1XXCA 4G0VA 4L8IA 1GE9A 3ERED 4FM9A 1F9NA 3LF9A 1BGWA 3FHZA 4G0WA 5JSNB 1XXBA 5MLC9 3MMLB 3LAPA 3LHPS 2ZFZA 3FOFA 2XCQA 5CJ9A 2KWAA 1WQFA 3OREA 4G0UA 1B4AA 2XCRB 3BUEA 4DDQA 2RGRA 3LAJA 4GFQA 1B4BA 1EK8A 1EH1A 4KC6A 2P5MA 3LPXA 3OEPA 4KAWX 4JLRC 4KB4A 3NUHA 1WQGA 1BJTA 1DD5A 2XCOA 3V4GA 4KB2A 3L4JA 1ISEA
chains in the Genus database with same CATH superfamily
1Q8IA 3S1RK 2BE5D 3H3VL 1PJ7A 4C3IC 3S1RC 4BY7K 4J3NA 4BY7C 4BY1K 5IORA 2O5IA 3GEIA 3GTGK 4BY1C 2A69D 3GTGC 1Y1WA 2O5JD 2W7VA 3N0BA 4P9SA 2PMZA 2R92K 2VUMA 1O29A 1EJ9A 2NVQK 1O2AA 5CQGA 2NVQC 2D6FC 2KWAA 5CHPA 3HKZA 1I3QK 5TJ3A 1I3QC 4DDQA 2ZUFA 4NOIA 2EBBA 1I6HK 1I6HC 3NUHA 3V4GA 4GTDA 2YU9K 1WIHA 5IYDK 4BLAA 3G4CA 2JA6K 2YU9C 3TTGA 5IYDC 2A6EA 2JA6C 1Y1VA 4FZBA 3S2HK 2A6HA 4YG2A 3S2HC 1X31C 1WCMK 4AHCA 1WCMC 2WB1L 1I6VA 2JA8K 2NVYK 1TWFA 4KM8A 2JA8C 2NVYC 1INNA 3T00A 3M4OK 4IP8A 3S17C 1JVIA 4A3JK 3M4OC 3A8JA 4KAWX 4XLNA 4A3JC 3N0CA 1ZBSA 3BP3A 2PA8L 3AH5A 1T8IA 4AYBL 3SZZA 4BBRK 4OIPA 1TWHK 3QX3A 3L4KA 1F7UA 3CAGA 4BBRC 1TWHC 1WORA 3OPFA 4O26A 2Y0SL 3WODA 2F4QA 4FM9A 2WAQL 3LF9A 4KM9A 4LR2A 4KARA 3K5NA 1WQFA 1YNJD 4P5AA 1ZYRA 1R9TA 4AYBA 1J6XA 2P5MA 1A35A 4GTCA 3GTKK 1A31A 5C4XK 3RZOK 1HI9A 3GTKC 3GTMA 2PHCB 3RZOC 5C4XC 4XCHA 5C3EK 2WAQA 1ZXOA 1AB4A 4BKWA 4C3HK 5C3EC 4C3HC 2FQTA 3TFHA 3K5MA 1WOPA 3GTJK 4QIWL 1HQMA 3GTJC 1RR8C 4PAAA 4L8IA 1BDFA 1USOA 3K5LA 1V5VA 3M4AA 4C2MK 2JH3A 3LHPS 3S14K 4C2MC 1K83K 2PMZD 5HL8A 3HXAA 5C44K 3S14C 3OREA 1DCPA 1K83C 3AD7C 2GAHC 3G4AA 3GIRA 2XCRB 4C45A 1EH1A 1EK8A 3GTQA 3HKZD 4JLRC 2JA7A 2V6TA 1EFWA 3T01A 1UV7A 1SEUA 1XXAA 1V9MA 4LOWA 4XLPA 3GTLA 2A6ED 4OYDB 1TGOA 2A6HD 2NVXA 2V6SA 1XZPB 1BGWA 1YCLA 4C3IK 3WVOA 4GTFA 1VH2A 2E2IA 4GTLA 1I6VD 4KMAA 1I50A 1EI6A 3JSTA 4KN7A 1WSRA 5M5YK 4KMDA 4KASA 2E2HK 4IP9A 1YNNA 4XSXA 5IP7K 2E2HC 5IP7C 1J6WA 3S2DK 3S2DC 5M3MK 2PPBA 2R7ZA 4Q5SA 4NOMA 2GAGC 1F9NA 4QJVB 2R93A 3GEEA 1Y1WK 3T02A 1Y1WC 1O25A 1WOOA 3I4NK 1TWGA 4H3TA 3I4NC 4BXXK 1ZYRD 2PA8D 3DU6A 4OIRA 4BXXC 4AYBD 3FKIA 3GTGA 3K58A 1SC7A 3GTPK 2R92A 4WILA 4D3ZA 3GTPC 2WAQD 3GSIA 3SJRA 1Y1VK 3PO3K 1GE9A 1Y1VC 1I3QA 3PO3C 1HQMD 1WOSA 1XZQB 2XCQA 3AD8C 2GSUA 1PJ6A 1TWFK 1JQWA 4A3LK 3S17K 1TWFC 3Q3QA 4A3LC 1ZQ1C 2P8TA 1A36A 4AN8A 4Y52K 3H0GK 2WB1A 4Y52C 2ZUEA 3H0GC 5D4DA 5IOSA 4A3GK 3CQZA 5JSBB 4A3GC 4G7ZA 4A3EK 3M3YK 4A3EC 3M3YC 3IPJA 3LAPA 3HOWK 4XSZA 3AQOA 1LPQA 3HOWC 4FYDA 1K4TA 4LLGA 4A3FK 3LAJA 4A3FC 2E2JK 1JOEA 3ADAC 2CFAB 2E2JC 1R9TK 3L4JA 1YX2A 1TWCA 1R9TC 2Y0SA 1Y698 5M5WK 4A3CK 3I4MK 1YNND 5M3FK 4A3CC 3GTMK 4KMHA 3I4MC 3GTOA 1VGXA 4A3BK 3GTMC 1NH3A 4A3BC 2CW0A 4G0WA 5MLC9 4QCLA 1RU0A 5FLMK 3GTKA 4G0UA 5FLMC 4ZH4A 1KQ4A 1F93A 4M1XA 1IBAA 3AQPA 1WSVA 4Q4ZA 1C0AA 1DD5A 1SFOA 4QIWA 1G51A 3H3VD 4AH6A 5IOQA 4X6AK 3GTQK 4Q5GA 4EJ3A 1EQRA 1VLOA 3EQLA 3GTQC 4RMFA 4X6AC 2JA7K 1SMYA 2JA7C 5C4JK 4A3DK 5C4JC 4A3DC 2NVTK 1O27A 4BBSC 4KATA 2NVTC 1IE0A 4LJZA 4PABA 4YFNA 1O24A 3GTLK 3HOYK 1TWAA 3GTLC 3HOYC 3KYLA 3RZDK 3RZDC 2E2IK 2JA5A 2B63A 2E2IC 4OIQA 1I50K 3GEHA 1I50C 4Y7NK 4FGUA 4Y7NC 5JFEA 3GDZA 5L46A 1IS1A 4KDDA 2WB1D 4MQ9A 1YNJA 3FHZA 4MEXA 2GSNA 4JK1A 5TMCA 2R93K 3N3YA 4A3KK 2PMZL 2RH6A 2R93C 2VUMK 1IL2A 4A3KC 2VUMC 3LPXA 3HOXK 3K57A 4KB4A 3HOXC 1DCHA 3HOZK 3K59A 4GTEA 1BJTA 3HKZL 1TWGK 3K5OA 3A8KA 3HOZC 4NOLA 1TWGC 1IW7A 4F3EA 4G7OA 3VA7A 4LMOA 4A3MK 3FOEA 3FKIK 4A3MC 3SZYA 3S1NK 2Y0SD 3FKIC 5FJ8K 3S1NC 5EGHA 4G0VA 1MIUA 4MEYA 3S0XA 1XPPA 2R92C 1XXBA 2CW0D 3FOFA 4KN4A 1XZPA 2A68A 2YU9A 3TFIA 1F7VA 3GTPA 2JA6A 4GT9A 1TL8A 1O26A 4WJ3M 1VJEA 1WCMA 2R4GA 4QIWD 4BLBA 2NVYA 4FXDA 1SMYD 4Q5VA 3CQZK 3MMLB 3HOVK 5CJ9A 3CQZC 4OIOA 4A93K 4QJVA 3HOVC 4A93C 4ILDA 3S1MK 4LK1A 3S1MC 4GFQA 4NOKA 2BE5A 5E68A 3H0GA 2Y3PA 1TWHA 4GTBA 1IQ0A 5IYCK 1K4SA 2A69A 2GSOA 5IYCC 2O5JA 1TWCK 1ZVUA 1TWCC 1O2FB 3A8IA 3GTOK 3GTOC 5JSNB 2ZFZA 1L0WA 5M5XK 1XZQA 3BUEA 3MAQA 3S16K 4OINA 3S16C 4G7HA 1R5ZA 1WQGA 1BS2A 4C3JK 3DU5A 2XCOA 1USMA 4C3JC 3GTJA 1SFOK 1WQHA 1SFOC 1IW7D 4YFKA 5C9HA 4C2MA 4P5BA 4LQYA 3S15K 4BBSK 3ERED 4GTAA 5EGEA 1K83A 3S15C 4KMUA 3K7AK 3P9AA 3K7AC 1O2BA 4WJ4A 5C44C 5TMFA 2NVXK 4GZYA 3BP8C 1J6VA 1PJ5A 4A3IK 2NVXC 3HOUK 1DCOA 1TWAK 4A3IC 3HOUC 1B4BA 4KC6A 4O2DA 1TWAC 3TFJA 2A68D 3PO2K 2B9SB 3PO2C 2JA5K 2B63K 5JVOA 1R49A 2CFAA 2JA5C 2B63C 5IP9K 5IYBK 5IP9C 3AD9C 4LK0A 5IYBC 1XXCA 1RRJA 5IOTA 4D3YA 3DXJA 2FQOA 4YFXA 2R7ZK 2V6UA 1VRQC 2R7ZC 1B4AA 2RGRA 2E2HA 3OEPA 3IAYA 1O28A 3S1QK 1J98A 4KB2A 3S1QC 1ISEA
chains in the Genus database with same CATH topology
1Q8IA 1TWCA 2BE5D 2Y0SA 1SEUA 1Y698 1O26A 4C3IC 1XXAA 1V9MA 1WCMA 2R4GA 1YNND 4J3NA 4KMHA 5IORA 3GTOA 1TL8A 1NH3A 2A69D 4BLBA 3GTLA 2A6ED 2NVYA 4OYDB 4FXDA 1TGOA 1SMYD 2A6HD 2NVXA 2O5JD 1Y1WA 3N0BA 2PMZA 1BGWA 4Q5VA 2VUMA 1O29A 4G0WA 3MMLB 5MLC9 1EJ9A 3WVOA 4QCLA 1O2AA 4GTFA 5CQGA 5CJ9A 2E2IA 4GTLA 2KWAA 3GTKA 1I6VD 4ILDA 3HKZA 5CHPA 5TJ3A 4G0UA 4DDQA 4KMAA 1I50A 1KQ4A 4GFQA 4M1XA 4NOKA 3AQPA 3H0GA 4KMDA 3NUHA 4KASA 2Y3PA 1TWHA 4IP9A 1DD5A 4QIWA 1SFOA 3V4GA 4GTBA 4GTDA 5IOQA 1WIHA 4BLAA 4Q5GA 1K4SA 4EJ3A 3G4CA 2GSOA 1Y1VA 4FZBA 1ZVUA 2R7ZA 4AHCA 1O27A 4NOMA 4KATA 1F9NA 2R93A 5JSNB 1O24A 1TWFA 4KM8A 2ZFZA 1TWAA 3KYLA 1O25A 3BUEA 4IP8A 1TWGA 4H3TA 3MAQA 2JA5A 2B63A 4KAWX 1ZYRD 3DU6A 1R5ZA 1WQGA 3DU5A 2XCOA 3FKIA 3N0CA 3GTGA 1ZBSA 3K58A 3GTJA 4C3JC 1SC7A 3AH5A 1T8IA 4FGUA 3QX3A 2R92A 5JFEA 3L4KA 4D3ZA 1WQHA 3CAGA 1IW7D 3SJRA 3OPFA 1IS1A 4O26A 4C2MA 4KDDA 5C9HA 4LQYA 4P5BA 3ERED 2F4QA 1GE9A 4GTAA 4FM9A 5EGEA 1K83A 1I3QA 3LF9A 3FHZA 1HQMD 3P9AA 2GSNA 2XCQA 4KM9A 1O2BA 4KARA 4LR2A 3K5NA 1WQFA 1YNJD 2GSUA 4P5AA 3N3YA 2RH6A 1R9TA 4AYBA 1B4BA 3Q3QA 4KC6A 2P5MA 3LPXA 3K57A 1A35A 4GTCA 4KB4A 1A31A 1A36A 3K59A 2A68D 1BJTA 4GTEA 3K5OA 3GTMA 2PHCB 2B9SB 4AN8A 4NOLA 2WAQA 5JVOA 4F3EA 1R49A 1ZXOA 1AB4A 2CFAA 4BKWA 4LMOA 3VA7A 2WB1A 3FOEA 4C3HC 3K5MA 5IOSA 3CQZA 5JSBB 1RR8C 1XXCA 1RRJA 5EGHA 1MIUA 5IOTA 4L8IA 4D3YA 3S0XA 4G0VA 3K5LA 3M4AA 1XXBA 2CW0D 2JH3A 3LAPA 3LHPS 3FOFA 4C2MC 3AQOA 1LPQA 4FYDA 1K4TA 3OREA 1B4AA 3G4AA 2XCRB 2E2HA 2RGRA 3LAJA 3OEPA 3IAYA 1EH1A 1EK8A 2YU9A 3GTQA 1O28A 3GTPA 2JA6A 4JLRC 2CFAB 2JA7A 4GT9A 4KB2A 3L4JA 1ISEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIH A;  1Y69 8;  2Y3P A;  5JVO A;  1XXA A;  2PHC B;  1AB4 A;  3VA7 A;  3QX3 A;  4J3N A;  3FOE A;  3L4K A;  1WQH A;  3CAG A;  1ZVU A;  3OPF A;  1IS1 A;  4KDD A;  5JSB B;  4OYD B;  1XXC A;  4G0V A;  4L8I A;  1GE9 A;  3ERE D;  4FM9 A;  1F9N A;  3LF9 A;  1BGW A;  3FHZ A;  4G0W A;  5JSN B;  1XXB A;  5MLC 9;  3MML B;  3LAP A;  3LHP S;  2ZFZ A;  3FOF A;  2XCQ A;  5CJ9 A;  2KWA A;  1WQF A;  3ORE A;  4G0U A;  1B4A A;  2XCR B;  3BUE A;  4DDQ A;  2RGR A;  3LAJ A;  4GFQ A;  1B4B A;  1EK8 A;  1EH1 A;  4KC6 A;  2P5M A;  3LPX A;  3OEP A;  4KAW X;  4JLR C;  4KB4 A;  3NUH A;  1WQG A;  1BJT A;  1DD5 A;  2XCO A;  3V4G A;  4KB2 A;  3L4J A;  1ISE A; 
#chains in the Genus database with same CATH topology
 1Q8I A;  3S1R K;  2BE5 D;  3H3V L;  1PJ7 A;  4C3I C;  3S1R C;  4BY7 K;  4J3N A;  4BY7 C;  4BY1 K;  5IOR A;  2O5I A;  3GEI A;  3GTG K;  4BY1 C;  2A69 D;  3GTG C;  1Y1W A;  2O5J D;  2W7V A;  3N0B A;  4P9S A;  2PMZ A;  2R92 K;  2VUM A;  1O29 A;  1EJ9 A;  2NVQ K;  1O2A A;  5CQG A;  2NVQ C;  2D6F C;  2KWA A;  5CHP A;  3HKZ A;  1I3Q K;  5TJ3 A;  1I3Q C;  4DDQ A;  2ZUF A;  4NOI A;  2EBB A;  1I6H K;  1I6H C;  3NUH A;  3V4G A;  4GTD A;  2YU9 K;  1WIH A;  5IYD K;  4BLA A;  3G4C A;  2JA6 K;  2YU9 C;  3TTG A;  5IYD C;  2A6E A;  2JA6 C;  1Y1V A;  4FZB A;  3S2H K;  2A6H A;  4YG2 A;  3S2H C;  1X31 C;  1WCM K;  4AHC A;  1WCM C;  2WB1 L;  1I6V A;  2JA8 K;  2NVY K;  1TWF A;  4KM8 A;  2JA8 C;  2NVY C;  1INN A;  3T00 A;  3M4O K;  4IP8 A;  3S17 C;  1JVI A;  4A3J K;  3M4O C;  3A8J A;  4KAW X;  4XLN A;  4A3J C;  3N0C A;  1ZBS A;  3BP3 A;  2PA8 L;  3AH5 A;  1T8I A;  4AYB L;  3SZZ A;  4BBR K;  4OIP A;  1TWH K;  3QX3 A;  3L4K A;  1F7U A;  3CAG A;  4BBR C;  1TWH C;  1WOR A;  3OPF A;  4O26 A;  2Y0S L;  3WOD A;  2F4Q A;  4FM9 A;  2WAQ L;  3LF9 A;  4KM9 A;  4LR2 A;  4KAR A;  3K5N A;  1WQF A;  1YNJ D;  4P5A A;  1ZYR A;  1R9T A;  4AYB A;  1J6X A;  2P5M A;  1A35 A;  4GTC A;  3GTK K;  1A31 A;  5C4X K;  3RZO K;  1HI9 A;  3GTK C;  3GTM A;  2PHC B;  3RZO C;  5C4X C;  4XCH A;  5C3E K;  2WAQ A;  1ZXO A;  1AB4 A;  4BKW A;  4C3H K;  5C3E C;  4C3H C;  2FQT A;  3TFH A;  3K5M A;  1WOP A;  3GTJ K;  4QIW L;  1HQM A;  3GTJ C;  1RR8 C;  4PAA A;  4L8I A;  1BDF A;  1USO A;  3K5L A;  1V5V A;  3M4A A;  4C2M K;  2JH3 A;  3LHP S;  3S14 K;  4C2M C;  1K83 K;  2PMZ D;  5HL8 A;  3HXA A;  5C44 K;  3S14 C;  3ORE A;  1DCP A;  1K83 C;  3AD7 C;  2GAH C;  3G4A A;  3GIR A;  2XCR B;  4C45 A;  1EH1 A;  1EK8 A;  3GTQ A;  3HKZ D;  4JLR C;  2JA7 A;  2V6T A;  1EFW A;  3T01 A;  1UV7 A;  1SEU A;  1XXA A;  1V9M A;  4LOW A;  4XLP A;  3GTL A;  2A6E D;  4OYD B;  1TGO A;  2A6H D;  2NVX A;  2V6S A;  1XZP B;  1BGW A;  1YCL A;  4C3I K;  3WVO A;  4GTF A;  1VH2 A;  2E2I A;  4GTL A;  1I6V D;  4KMA A;  1I50 A;  1EI6 A;  3JST A;  4KN7 A;  1WSR A;  5M5Y K;  4KMD A;  4KAS A;  2E2H K;  4IP9 A;  1YNN A;  4XSX A;  5IP7 K;  2E2H C;  5IP7 C;  1J6W A;  3S2D K;  3S2D C;  5M3M K;  2PPB A;  2R7Z A;  4Q5S A;  4NOM A;  2GAG C;  1F9N A;  4QJV B;  2R93 A;  3GEE A;  1Y1W K;  3T02 A;  1Y1W C;  1O25 A;  1WOO A;  3I4N K;  1TWG A;  4H3T A;  3I4N C;  4BXX K;  1ZYR D;  2PA8 D;  3DU6 A;  4OIR A;  4BXX C;  4AYB D;  3FKI A;  3GTG A;  3K58 A;  1SC7 A;  3GTP K;  2R92 A;  4WIL A;  4D3Z A;  3GTP C;  2WAQ D;  3GSI A;  3SJR A;  1Y1V K;  3PO3 K;  1GE9 A;  1Y1V C;  1I3Q A;  3PO3 C;  1HQM D;  1WOS A;  1XZQ B;  2XCQ A;  3AD8 C;  2GSU A;  1PJ6 A;  1TWF K;  1JQW A;  4A3L K;  3S17 K;  1TWF C;  3Q3Q A;  4A3L C;  1ZQ1 C;  2P8T A;  1A36 A;  4AN8 A;  4Y52 K;  3H0G K;  2WB1 A;  4Y52 C;  2ZUE A;  3H0G C;  5D4D A;  5IOS A;  4A3G K;  3CQZ A;  5JSB B;  4A3G C;  4G7Z A;  4A3E K;  3M3Y K;  4A3E C;  3M3Y C;  3IPJ A;  3LAP A;  3HOW K;  4XSZ A;  3AQO A;  1LPQ A;  3HOW C;  4FYD A;  1K4T A;  4LLG A;  4A3F K;  3LAJ A;  4A3F C;  2E2J K;  1JOE A;  3ADA C;  2CFA B;  2E2J C;  1R9T K;  3L4J A;  1YX2 A;  1TWC A;  1R9T C;  2Y0S A;  1Y69 8;  5M5W K;  4A3C K;  3I4M K;  1YNN D;  5M3F K;  4A3C C;  3GTM K;  4KMH A;  3I4M C;  3GTO A;  1VGX A;  4A3B K;  3GTM C;  1NH3 A;  4A3B C;  2CW0 A;  4G0W A;  5MLC 9;  4QCL A;  1RU0 A;  5FLM K;  3GTK A;  4G0U A;  5FLM C;  4ZH4 A;  1KQ4 A;  1F93 A;  4M1X A;  1IBA A;  3AQP A;  1WSV A;  4Q4Z A;  1C0A A;  1DD5 A;  1SFO A;  4QIW A;  1G51 A;  3H3V D;  4AH6 A;  5IOQ A;  4X6A K;  3GTQ K;  4Q5G A;  4EJ3 A;  1EQR A;  1VLO A;  3EQL A;  3GTQ C;  4RMF A;  4X6A C;  2JA7 K;  1SMY A;  2JA7 C;  5C4J K;  4A3D K;  5C4J C;  4A3D C;  2NVT K;  1O27 A;  4BBS C;  4KAT A;  2NVT C;  1IE0 A;  4LJZ A;  4PAB A;  4YFN A;  1O24 A;  3GTL K;  3HOY K;  1TWA A;  3GTL C;  3HOY C;  3KYL A;  3RZD K;  3RZD C;  2E2I K;  2JA5 A;  2B63 A;  2E2I C;  4OIQ A;  1I50 K;  3GEH A;  1I50 C;  4Y7N K;  4FGU A;  4Y7N C;  5JFE A;  3GDZ A;  5L46 A;  1IS1 A;  4KDD A;  2WB1 D;  4MQ9 A;  1YNJ A;  3FHZ A;  4MEX A;  2GSN A;  4JK1 A;  5TMC A;  2R93 K;  3N3Y A;  4A3K K;  2PMZ L;  2RH6 A;  2R93 C;  2VUM K;  1IL2 A;  4A3K C;  2VUM C;  3LPX A;  3HOX K;  3K57 A;  4KB4 A;  3HOX C;  1DCH A;  3HOZ K;  3K59 A;  4GTE A;  1BJT A;  3HKZ L;  1TWG K;  3K5O A;  3A8K A;  3HOZ C;  4NOL A;  1TWG C;  1IW7 A;  4F3E A;  4G7O A;  3VA7 A;  4LMO A;  4A3M K;  3FOE A;  3FKI K;  4A3M C;  3SZY A;  3S1N K;  2Y0S D;  3FKI C;  5FJ8 K;  3S1N C;  5EGH A;  4G0V A;  1MIU A;  4MEY A;  3S0X A;  1XPP A;  2R92 C;  1XXB A;  2CW0 D;  3FOF A;  4KN4 A;  1XZP A;  2A68 A;  2YU9 A;  3TFI A;  1F7V A;  3GTP A;  2JA6 A;  4GT9 A;  1TL8 A;  1O26 A;  4WJ3 M;  1VJE A;  1WCM A;  2R4G A;  4QIW D;  4BLB A;  2NVY A;  4FXD A;  1SMY D;  4Q5V A;  3CQZ K;  3MML B;  3HOV K;  5CJ9 A;  3CQZ C;  4OIO A;  4A93 K;  4QJV A;  3HOV C;  4A93 C;  4ILD A;  3S1M K;  4LK1 A;  3S1M C;  4GFQ A;  4NOK A;  2BE5 A;  5E68 A;  3H0G A;  2Y3P A;  1TWH A;  4GTB A;  1IQ0 A;  5IYC K;  1K4S A;  2A69 A;  2GSO A;  5IYC C;  2O5J A;  1TWC K;  1ZVU A;  1TWC C;  1O2F B;  3A8I A;  3GTO K;  3GTO C;  5JSN B;  2ZFZ A;  1L0W A;  5M5X K;  1XZQ A;  3BUE A;  3MAQ A;  3S16 K;  4OIN A;  3S16 C;  4G7H A;  1R5Z A;  1WQG A;  1BS2 A;  4C3J K;  3DU5 A;  2XCO A;  1USM A;  4C3J C;  3GTJ A;  1SFO K;  1WQH A;  1SFO C;  1IW7 D;  4YFK A;  5C9H A;  4C2M A;  4P5B A;  4LQY A;  3S15 K;  4BBS K;  3ERE D;  4GTA A;  5EGE A;  1K83 A;  3S15 C;  4KMU A;  3K7A K;  3P9A A;  3K7A C;  1O2B A;  4WJ4 A;  5C44 C;  5TMF A;  2NVX K;  4GZY A;  3BP8 C;  1J6V A;  1PJ5 A;  4A3I K;  2NVX C;  3HOU K;  1DCO A;  1TWA K;  4A3I C;  3HOU C;  1B4B A;  4KC6 A;  4O2D A;  1TWA C;  3TFJ A;  2A68 D;  3PO2 K;  2B9S B;  3PO2 C;  2JA5 K;  2B63 K;  5JVO A;  1R49 A;  2CFA A;  2JA5 C;  2B63 C;  5IP9 K;  5IYB K;  5IP9 C;  3AD9 C;  4LK0 A;  5IYB C;  1XXC A;  1RRJ A;  5IOT A;  4D3Y A;  3DXJ A;  2FQO A;  4YFX A;  2R7Z K;  2V6U A;  1VRQ C;  2R7Z C;  1B4A A;  2RGR A;  2E2H A;  3OEP A;  3IAY A;  1O28 A;  3S1Q K;  1J98 A;  4KB2 A;  3S1Q C;  1ISE A; 
#chains in the Genus database with same CATH homology
 1Q8I A;  1TWC A;  2BE5 D;  2Y0S A;  1SEU A;  1Y69 8;  1O26 A;  4C3I C;  1XXA A;  1V9M A;  1WCM A;  2R4G A;  1YNN D;  4J3N A;  4KMH A;  5IOR A;  3GTO A;  1TL8 A;  1NH3 A;  2A69 D;  4BLB A;  3GTL A;  2A6E D;  2NVY A;  4OYD B;  4FXD A;  1TGO A;  1SMY D;  2A6H D;  2NVX A;  2O5J D;  1Y1W A;  3N0B A;  2PMZ A;  1BGW A;  4Q5V A;  2VUM A;  1O29 A;  4G0W A;  3MML B;  5MLC 9;  1EJ9 A;  3WVO A;  4QCL A;  1O2A A;  4GTF A;  5CQG A;  5CJ9 A;  2E2I A;  4GTL A;  2KWA A;  3GTK A;  1I6V D;  4ILD A;  3HKZ A;  5CHP A;  5TJ3 A;  4G0U A;  4DDQ A;  4KMA A;  1I50 A;  1KQ4 A;  4GFQ A;  4M1X A;  4NOK A;  3AQP A;  3H0G A;  4KMD A;  3NUH A;  4KAS A;  2Y3P A;  1TWH A;  4IP9 A;  1DD5 A;  4QIW A;  1SFO A;  3V4G A;  4GTB A;  4GTD A;  5IOQ A;  1WIH A;  4BLA A;  4Q5G A;  1K4S A;  4EJ3 A;  3G4C A;  2GSO A;  1Y1V A;  4FZB A;  1ZVU A;  2R7Z A;  4AHC A;  1O27 A;  4NOM A;  4KAT A;  1F9N A;  2R93 A;  5JSN B;  1O24 A;  1TWF A;  4KM8 A;  2ZFZ A;  1TWA A;  3KYL A;  1O25 A;  3BUE A;  4IP8 A;  1TWG A;  4H3T A;  3MAQ A;  2JA5 A;  2B63 A;  4KAW X;  1ZYR D;  3DU6 A;  1R5Z A;  1WQG A;  3DU5 A;  2XCO A;  3FKI A;  3N0C A;  3GTG A;  1ZBS A;  3K58 A;  3GTJ A;  4C3J C;  1SC7 A;  3AH5 A;  1T8I A;  4FGU A;  3QX3 A;  2R92 A;  5JFE A;  3L4K A;  4D3Z A;  1WQH A;  3CAG A;  1IW7 D;  3SJR A;  3OPF A;  1IS1 A;  4O26 A;  4C2M A;  4KDD A;  5C9H A;  4LQY A;  4P5B A;  3ERE D;  2F4Q A;  1GE9 A;  4GTA A;  4FM9 A;  5EGE A;  1K83 A;  1I3Q A;  3LF9 A;  3FHZ A;  1HQM D;  3P9A A;  2GSN A;  2XCQ A;  4KM9 A;  1O2B A;  4KAR A;  4LR2 A;  3K5N A;  1WQF A;  1YNJ D;  2GSU A;  4P5A A;  3N3Y A;  2RH6 A;  1R9T A;  4AYB A;  1B4B A;  3Q3Q A;  4KC6 A;  2P5M A;  3LPX A;  3K57 A;  1A35 A;  4GTC A;  4KB4 A;  1A31 A;  1A36 A;  3K59 A;  2A68 D;  1BJT A;  4GTE A;  3K5O A;  3GTM A;  2PHC B;  2B9S B;  4AN8 A;  4NOL A;  2WAQ A;  5JVO A;  4F3E A;  1R49 A;  1ZXO A;  1AB4 A;  2CFA A;  4BKW A;  4LMO A;  3VA7 A;  2WB1 A;  3FOE A;  4C3H C;  3K5M A;  5IOS A;  3CQZ A;  5JSB B;  1RR8 C;  1XXC A;  1RRJ A;  5EGH A;  1MIU A;  5IOT A;  4L8I A;  4D3Y A;  3S0X A;  4G0V A;  3K5L A;  3M4A A;  1XXB A;  2CW0 D;  2JH3 A;  3LAP A;  3LHP S;  3FOF A;  4C2M C;  3AQO A;  1LPQ A;  4FYD A;  1K4T A;  3ORE A;  1B4A A;  3G4A A;  2XCR B;  2E2H A;  2RGR A;  3LAJ A;  3OEP A;  3IAY A;  1EH1 A;  1EK8 A;  2YU9 A;  3GTQ A;  1O28 A;  3GTP A;  2JA6 A;  4JLR C;  2CFA B;  2JA7 A;  4GT9 A;  4KB2 A;  3L4J A;  1ISE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...