4L8IA

Crystal structure of rsv epitope scaffold ffl_005
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
114
structure length
114
Chain Sequence
SMSDIRKDLEERFDKLVEALKNKVDKMKAAFRMDQFHEERMKDWFKDLRKEVEQMRRAVRNYASEALSKINDLPITNDDKKLASNDVLKLVAEVWKKLEAILADVEAWFTHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RSV epitope scaffold FFL_005
publication title Proof of principle for epitope-focused vaccine design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Immune system
total genus 49
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4l8iA00
5MLC9 1ISEA 1EH1A 4KC6A 1EK8A 1WQFA 1DD5A 3LF9A 4KB2A 1IS1A 3LHPS 1GE9A 4JLRC 1Y698 4KAWX 4GFQA 4L8IA 4OYDB 4KB4A 1WQGA 4KDDA 1WQHA 5JSNB 5JSBB
chains in the Genus database with same CATH superfamily
4FXDA 3H0GA 1WCMA 4QIWA 1EJ9A 4KB2A 3GTQA 3K58A 1Y698 1V9MA 2A69D 4H3TA 2JA7A 4EJ3A 1I6VD 1A31A 1Y1VA 2WB1A 3GTKA 3FKIA 5JSNB 1NH3A 5C9HA 3GTJA 1TWCA 2E2IA 3KYLA 1EK8A 4AHCA 4NOMA 3MAQA 4AN8A 4QCLA 3K5MA 1HQMD 3HKZA 4NOKA 1SEUA 1IS1A 4FGUA 3CQZA 4FYDA 1TWHA 4Q5GA 3DU5A 1TWAA 2NVYA 4D3ZA 1I3QA 2O5JD 3K5OA 4L8IA 4IP8A 4AYBA 2F4QA 3GTGA 3GTPA 4KB4A 1SMYD 2Y0SA 3IAYA 4C2MA 1YNJD 1Y1WA 5MLC9 1ISEA 1I50A 3GTMA 1EH1A 3K5LA 2R7ZA 2A68D 4KC6A 1WQFA 1K4TA 1A36A 1K83A 1YNND 4Q5VA 5CQGA 2R4GA 3GTOA 2PMZA 1TWFA 1MIUA 3LHPS 1R9TA 2NVXA 4JLRC 1T8IA 4KAWX 1IW7D 4GFQA 2JA6A 2JA5A 4OYDB 1RR8C 3P9AA 1R49A 3K5NA 1RRJA 2WAQA 1WQHA 5JSBB 2A6HD 2VUMA 4NOLA 4IP9A 3K59A 3GTLA 1R5ZA 2CW0D 4D3YA 3M4AA 3K57A 2BE5D 1TGOA 1TWGA 1ZYRD 1DD5A 3SJRA 3LF9A 2YU9A 2B9SB 2B63A 3DU6A 2E2HA 2R92A 1GE9A 1A35A 4F3EA 1K4SA 3WVOA 1SC7A 1WQGA 1LPQA 1Q8IA 4KDDA 4O26A 2A6ED 2R93A 1TL8A 4LMOA 1SFOA
chains in the Genus database with same CATH topology
4FXDA 3H0GA 1WCMA 4QIWA 1EJ9A 4KB2A 3GTQA 3K58A 1Y698 1V9MA 2A69D 4H3TA 2JA7A 4EJ3A 1I6VD 1A31A 1Y1VA 2WB1A 3GTKA 3FKIA 5JSNB 1NH3A 5C9HA 3GTJA 1TWCA 2E2IA 3KYLA 1EK8A 4AHCA 4NOMA 3MAQA 4AN8A 4QCLA 3K5MA 1HQMD 3HKZA 4NOKA 1SEUA 1IS1A 4FGUA 3CQZA 4FYDA 1TWHA 4Q5GA 3DU5A 1TWAA 2NVYA 4D3ZA 1I3QA 2O5JD 3K5OA 4L8IA 4IP8A 4AYBA 2F4QA 3GTGA 3GTPA 4KB4A 1SMYD 2Y0SA 3IAYA 4C2MA 1YNJD 1Y1WA 5MLC9 1ISEA 1I50A 3GTMA 1EH1A 3K5LA 2R7ZA 2A68D 4KC6A 1WQFA 1K4TA 1A36A 1K83A 1YNND 4Q5VA 5CQGA 2R4GA 3GTOA 2PMZA 1TWFA 1MIUA 3LHPS 1R9TA 2NVXA 4JLRC 1T8IA 4KAWX 1IW7D 4GFQA 2JA6A 2JA5A 4OYDB 1RR8C 3P9AA 1R49A 3K5NA 1RRJA 2WAQA 1WQHA 5JSBB 2A6HD 2VUMA 4NOLA 4IP9A 3K59A 3GTLA 1R5ZA 2CW0D 4D3YA 3M4AA 3K57A 2BE5D 1TGOA 1TWGA 1ZYRD 1DD5A 3SJRA 3LF9A 2YU9A 2B9SB 2B63A 3DU6A 2E2HA 2R92A 1GE9A 1A35A 4F3EA 1K4SA 3WVOA 1SC7A 1WQGA 1LPQA 1Q8IA 4KDDA 4O26A 2A6ED 2R93A 1TL8A 4LMOA 1SFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MLC 9;  1ISE A;  1EH1 A;  4KC6 A;  1EK8 A;  1WQF A;  1DD5 A;  3LF9 A;  4KB2 A;  1IS1 A;  3LHP S;  1GE9 A;  4JLR C;  1Y69 8;  4KAW X;  4GFQ A;  4L8I A;  4OYD B;  4KB4 A;  1WQG A;  4KDD A;  1WQH A;  5JSN B;  5JSB B; 
#chains in the Genus database with same CATH topology
 4FXD A;  3H0G A;  1WCM A;  4QIW A;  1EJ9 A;  4KB2 A;  3GTQ A;  3K58 A;  1Y69 8;  1V9M A;  2A69 D;  4H3T A;  2JA7 A;  4EJ3 A;  1I6V D;  1A31 A;  1Y1V A;  2WB1 A;  3GTK A;  3FKI A;  5JSN B;  1NH3 A;  5C9H A;  3GTJ A;  1TWC A;  2E2I A;  3KYL A;  1EK8 A;  4AHC A;  4NOM A;  3MAQ A;  4AN8 A;  4QCL A;  3K5M A;  1HQM D;  3HKZ A;  4NOK A;  1SEU A;  1IS1 A;  4FGU A;  3CQZ A;  4FYD A;  1TWH A;  4Q5G A;  3DU5 A;  1TWA A;  2NVY A;  4D3Z A;  1I3Q A;  2O5J D;  3K5O A;  4L8I A;  4IP8 A;  4AYB A;  2F4Q A;  3GTG A;  3GTP A;  4KB4 A;  1SMY D;  2Y0S A;  3IAY A;  4C2M A;  1YNJ D;  1Y1W A;  5MLC 9;  1ISE A;  1I50 A;  3GTM A;  1EH1 A;  3K5L A;  2R7Z A;  2A68 D;  4KC6 A;  1WQF A;  1K4T A;  1A36 A;  1K83 A;  1YNN D;  4Q5V A;  5CQG A;  2R4G A;  3GTO A;  2PMZ A;  1TWF A;  1MIU A;  3LHP S;  1R9T A;  2NVX A;  4JLR C;  1T8I A;  4KAW X;  1IW7 D;  4GFQ A;  2JA6 A;  2JA5 A;  4OYD B;  1RR8 C;  3P9A A;  1R49 A;  3K5N A;  1RRJ A;  2WAQ A;  1WQH A;  5JSB B;  2A6H D;  2VUM A;  4NOL A;  4IP9 A;  3K59 A;  3GTL A;  1R5Z A;  2CW0 D;  4D3Y A;  3M4A A;  3K57 A;  2BE5 D;  1TGO A;  1TWG A;  1ZYR D;  1DD5 A;  3SJR A;  3LF9 A;  2YU9 A;  2B9S B;  2B63 A;  3DU6 A;  2E2H A;  2R92 A;  1GE9 A;  1A35 A;  4F3E A;  1K4S A;  3WVO A;  1SC7 A;  1WQG A;  1LPQ A;  1Q8I A;  4KDD A;  4O26 A;  2A6E D;  2R93 A;  1TL8 A;  4LMO A;  1SFO A; 
#chains in the Genus database with same CATH homology
 4FXD A;  3H0G A;  1WCM A;  4QIW A;  1EJ9 A;  4KB2 A;  3GTQ A;  3K58 A;  1Y69 8;  1V9M A;  2A69 D;  4H3T A;  2JA7 A;  4EJ3 A;  1I6V D;  1A31 A;  1Y1V A;  2WB1 A;  3GTK A;  3FKI A;  5JSN B;  1NH3 A;  5C9H A;  3GTJ A;  1TWC A;  2E2I A;  3KYL A;  1EK8 A;  4AHC A;  4NOM A;  3MAQ A;  4AN8 A;  4QCL A;  3K5M A;  1HQM D;  3HKZ A;  4NOK A;  1SEU A;  1IS1 A;  4FGU A;  3CQZ A;  4FYD A;  1TWH A;  4Q5G A;  3DU5 A;  1TWA A;  2NVY A;  4D3Z A;  1I3Q A;  2O5J D;  3K5O A;  4L8I A;  4IP8 A;  4AYB A;  2F4Q A;  3GTG A;  3GTP A;  4KB4 A;  1SMY D;  2Y0S A;  3IAY A;  4C2M A;  1YNJ D;  1Y1W A;  5MLC 9;  1ISE A;  1I50 A;  3GTM A;  1EH1 A;  3K5L A;  2R7Z A;  2A68 D;  4KC6 A;  1WQF A;  1K4T A;  1A36 A;  1K83 A;  1YNN D;  4Q5V A;  5CQG A;  2R4G A;  3GTO A;  2PMZ A;  1TWF A;  1MIU A;  3LHP S;  1R9T A;  2NVX A;  4JLR C;  1T8I A;  4KAW X;  1IW7 D;  4GFQ A;  2JA6 A;  2JA5 A;  4OYD B;  1RR8 C;  3P9A A;  1R49 A;  3K5N A;  1RRJ A;  2WAQ A;  1WQH A;  5JSB B;  2A6H D;  2VUM A;  4NOL A;  4IP9 A;  3K59 A;  3GTL A;  1R5Z A;  2CW0 D;  4D3Y A;  3M4A A;  3K57 A;  2BE5 D;  1TGO A;  1TWG A;  1ZYR D;  1DD5 A;  3SJR A;  3LF9 A;  2YU9 A;  2B9S B;  2B63 A;  3DU6 A;  2E2H A;  2R92 A;  1GE9 A;  1A35 A;  4F3E A;  1K4S A;  3WVO A;  1SC7 A;  1WQG A;  1LPQ A;  1Q8I A;  4KDD A;  4O26 A;  2A6E D;  2R93 A;  1TL8 A;  4LMO A;  1SFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...