4L8IA

Crystal structure of rsv epitope scaffold ffl_005
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
114
structure length
114
Chain Sequence
b'SMSDIRKDLEERFDKLVEALKNKVDKMKAAFRMDQFHEERMKDWFKDLRKEVEQMRRAVRNYASEALSKINDLPITNDDKKLASNDVLKLVAEVWKKLEAILADVEAWFTHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RSV epitope scaffold FFL_005
publication title Proof of principle for epitope-focused vaccine design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Immune system
total genus 49
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4l8iA00
4KDDA 1EK8A 1IS1A 4KB2A 4KB4A 4KC6A 5JSNB 4OYDB 1GE9A 3LHPS 4GFQA 1WQFA 1DD5A 1EH1A 5MLC9 4L8IA 1ISEA 5JSBB 1Y698 3LF9A 1WQHA 4KAWX 1WQGA 4JLRC
chains in the Genus database with same CATH superfamily
1TGOA 4QIWA 2E2HA 1TWAA 2YU9A 5JSNB 4O26A 4F3EA 2BE5D 1Y1VA 1GE9A 4FXDA 1YNJD 3FKIA 4AHCA 4NOKA 3CQZA 1MIUA 4H3TA 3K5OA 1SC7A 2Y0SA 4IP9A 2R4GA 4LMOA 3SJRA 5JSBB 1EJ9A 1R9TA 3K5NA 1HQMD 1K4TA 4FYDA 2A6HD 3GTKA 2VUMA 1NH3A 4QCLA 3GTJA 4D3ZA 3DU5A 3K58A 3P9AA 4Q5GA 4AYBA 2B9SB 3K57A 4KB4A 1WCMA 1TWFA 1K4SA 1SFOA 3GTMA 3K59A 3GTPA 4GFQA 4Q5VA 3WVOA 1T8IA 5MLC9 2WB1A 2E2IA 2NVXA 1RR8C 3HKZA 3DU6A 1TL8A 4JLRC 1IW7D 1SEUA 1RRJA 3GTLA 3K5MA 3K5LA 1I50A 4C2MA 5C9HA 3IAYA 4KDDA 4KB2A 1YNND 4D3YA 2NVYA 2A68D 1I3QA 3MAQA 4KC6A 3GTOA 1TWGA 1A35A 3GTQA 1DD5A 1EH1A 4IP8A 4NOLA 3KYLA 1ZYRD 1Y698 4KAWX 2JA7A 1TWHA 2WAQA 3H0GA 4AN8A 1SMYD 2R92A 3M4AA 1LPQA 1V9MA 2A6ED 2PMZA 4EJ3A 2R7ZA 1EK8A 1A31A 1IS1A 1I6VD 2B63A 2JA5A 1A36A 4OYDB 2F4QA 1R5ZA 4FGUA 3LHPS 1WQFA 4L8IA 2R93A 4NOMA 1ISEA 3GTGA 1TWCA 3LF9A 1WQHA 5CQGA 1R49A 1WQGA 2CW0D 1K83A 2JA6A 2O5JD 1Y1WA 1Q8IA 2A69D
chains in the Genus database with same CATH topology
1TGOA 4QIWA 2E2HA 1TWAA 2YU9A 5JSNB 4O26A 4F3EA 2BE5D 1Y1VA 1GE9A 4FXDA 1YNJD 3FKIA 4AHCA 4NOKA 3CQZA 1MIUA 4H3TA 3K5OA 1SC7A 2Y0SA 4IP9A 2R4GA 4LMOA 3SJRA 5JSBB 1EJ9A 1R9TA 3K5NA 1HQMD 1K4TA 4FYDA 2A6HD 3GTKA 2VUMA 1NH3A 4QCLA 3GTJA 4D3ZA 3DU5A 3K58A 3P9AA 4Q5GA 4AYBA 2B9SB 3K57A 4KB4A 1WCMA 1TWFA 1K4SA 1SFOA 3GTMA 3K59A 3GTPA 4GFQA 4Q5VA 3WVOA 1T8IA 5MLC9 2WB1A 2E2IA 2NVXA 1RR8C 3HKZA 3DU6A 1TL8A 4JLRC 1IW7D 1SEUA 1RRJA 3GTLA 3K5MA 3K5LA 1I50A 4C2MA 5C9HA 3IAYA 4KDDA 4KB2A 1YNND 4D3YA 2NVYA 2A68D 1I3QA 3MAQA 4KC6A 3GTOA 1TWGA 1A35A 3GTQA 1DD5A 1EH1A 4IP8A 4NOLA 3KYLA 1ZYRD 1Y698 4KAWX 2JA7A 1TWHA 2WAQA 3H0GA 4AN8A 1SMYD 2R92A 3M4AA 1LPQA 1V9MA 2A6ED 2PMZA 4EJ3A 2R7ZA 1EK8A 1A31A 1IS1A 1I6VD 2B63A 2JA5A 1A36A 4OYDB 2F4QA 1R5ZA 4FGUA 3LHPS 1WQFA 4L8IA 2R93A 4NOMA 1ISEA 3GTGA 1TWCA 3LF9A 1WQHA 5CQGA 1R49A 1WQGA 2CW0D 1K83A 2JA6A 2O5JD 1Y1WA 1Q8IA 2A69D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDD A;  1EK8 A;  1IS1 A;  4KB2 A;  4KB4 A;  4KC6 A;  5JSN B;  4OYD B;  1GE9 A;  3LHP S;  4GFQ A;  1WQF A;  1DD5 A;  1EH1 A;  5MLC 9;  4L8I A;  1ISE A;  5JSB B;  1Y69 8;  3LF9 A;  1WQH A;  4KAW X;  1WQG A;  4JLR C; 
#chains in the Genus database with same CATH topology
 1TGO A;  4QIW A;  2E2H A;  1TWA A;  2YU9 A;  5JSN B;  4O26 A;  4F3E A;  2BE5 D;  1Y1V A;  1GE9 A;  4FXD A;  1YNJ D;  3FKI A;  4AHC A;  4NOK A;  3CQZ A;  1MIU A;  4H3T A;  3K5O A;  1SC7 A;  2Y0S A;  4IP9 A;  2R4G A;  4LMO A;  3SJR A;  5JSB B;  1EJ9 A;  1R9T A;  3K5N A;  1HQM D;  1K4T A;  4FYD A;  2A6H D;  3GTK A;  2VUM A;  1NH3 A;  4QCL A;  3GTJ A;  4D3Z A;  3DU5 A;  3K58 A;  3P9A A;  4Q5G A;  4AYB A;  2B9S B;  3K57 A;  4KB4 A;  1WCM A;  1TWF A;  1K4S A;  1SFO A;  3GTM A;  3K59 A;  3GTP A;  4GFQ A;  4Q5V A;  3WVO A;  1T8I A;  5MLC 9;  2WB1 A;  2E2I A;  2NVX A;  1RR8 C;  3HKZ A;  3DU6 A;  1TL8 A;  4JLR C;  1IW7 D;  1SEU A;  1RRJ A;  3GTL A;  3K5M A;  3K5L A;  1I50 A;  4C2M A;  5C9H A;  3IAY A;  4KDD A;  4KB2 A;  1YNN D;  4D3Y A;  2NVY A;  2A68 D;  1I3Q A;  3MAQ A;  4KC6 A;  3GTO A;  1TWG A;  1A35 A;  3GTQ A;  1DD5 A;  1EH1 A;  4IP8 A;  4NOL A;  3KYL A;  1ZYR D;  1Y69 8;  4KAW X;  2JA7 A;  1TWH A;  2WAQ A;  3H0G A;  4AN8 A;  1SMY D;  2R92 A;  3M4A A;  1LPQ A;  1V9M A;  2A6E D;  2PMZ A;  4EJ3 A;  2R7Z A;  1EK8 A;  1A31 A;  1IS1 A;  1I6V D;  2B63 A;  2JA5 A;  1A36 A;  4OYD B;  2F4Q A;  1R5Z A;  4FGU A;  3LHP S;  1WQF A;  4L8I A;  2R93 A;  4NOM A;  1ISE A;  3GTG A;  1TWC A;  3LF9 A;  1WQH A;  5CQG A;  1R49 A;  1WQG A;  2CW0 D;  1K83 A;  2JA6 A;  2O5J D;  1Y1W A;  1Q8I A;  2A69 D; 
#chains in the Genus database with same CATH homology
 1TGO A;  4QIW A;  2E2H A;  1TWA A;  2YU9 A;  5JSN B;  4O26 A;  4F3E A;  2BE5 D;  1Y1V A;  1GE9 A;  4FXD A;  1YNJ D;  3FKI A;  4AHC A;  4NOK A;  3CQZ A;  1MIU A;  4H3T A;  3K5O A;  1SC7 A;  2Y0S A;  4IP9 A;  2R4G A;  4LMO A;  3SJR A;  5JSB B;  1EJ9 A;  1R9T A;  3K5N A;  1HQM D;  1K4T A;  4FYD A;  2A6H D;  3GTK A;  2VUM A;  1NH3 A;  4QCL A;  3GTJ A;  4D3Z A;  3DU5 A;  3K58 A;  3P9A A;  4Q5G A;  4AYB A;  2B9S B;  3K57 A;  4KB4 A;  1WCM A;  1TWF A;  1K4S A;  1SFO A;  3GTM A;  3K59 A;  3GTP A;  4GFQ A;  4Q5V A;  3WVO A;  1T8I A;  5MLC 9;  2WB1 A;  2E2I A;  2NVX A;  1RR8 C;  3HKZ A;  3DU6 A;  1TL8 A;  4JLR C;  1IW7 D;  1SEU A;  1RRJ A;  3GTL A;  3K5M A;  3K5L A;  1I50 A;  4C2M A;  5C9H A;  3IAY A;  4KDD A;  4KB2 A;  1YNN D;  4D3Y A;  2NVY A;  2A68 D;  1I3Q A;  3MAQ A;  4KC6 A;  3GTO A;  1TWG A;  1A35 A;  3GTQ A;  1DD5 A;  1EH1 A;  4IP8 A;  4NOL A;  3KYL A;  1ZYR D;  1Y69 8;  4KAW X;  2JA7 A;  1TWH A;  2WAQ A;  3H0G A;  4AN8 A;  1SMY D;  2R92 A;  3M4A A;  1LPQ A;  1V9M A;  2A6E D;  2PMZ A;  4EJ3 A;  2R7Z A;  1EK8 A;  1A31 A;  1IS1 A;  1I6V D;  2B63 A;  2JA5 A;  1A36 A;  4OYD B;  2F4Q A;  1R5Z A;  4FGU A;  3LHP S;  1WQF A;  4L8I A;  2R93 A;  4NOM A;  1ISE A;  3GTG A;  1TWC A;  3LF9 A;  1WQH A;  5CQG A;  1R49 A;  1WQG A;  2CW0 D;  1K83 A;  2JA6 A;  2O5J D;  1Y1W A;  1Q8I A;  2A69 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...