1EK8A

Crystal structure of the ribosome recycling factor (rrf) from escherichia coli
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
185
Chain Sequence
MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ribosome recycling factor from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
molecule keywords RIBOSOME RECYCLING FACTOR
total genus 60
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2000-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1ek8A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1ek8A02
1BJTA 1WQHA 1Y698 2Y3PA 3FHZA 2P5MA 1F9NA 5CJ9A 4OYDB 1IS1A 3FOFA 3LF9A 1B4AA 4KC6A 4G0UA 2RGRA 5MLC9 1ISEA 4KB2A 4KB4A 2XCOA 3OPFA 4DDQA 2KWAA 1XXAA 2ZFZA 3CAGA 1WIHA 1DD5A 4KAWX 4KDDA 4L8IA 5JSNB 5JSBB 2PHCB 3VA7A 3OEPA 3L4JA 1B4BA 1ZVUA 4G0WA 3BUEA 1WQGA 3NUHA 2XCQA 3LAJA 3LAPA 1GE9A 3V4GA 1XXCA 1WQFA 3FOEA 1AB4A 3LPXA 4GFQA 3ERED 3QX3A 3L4KA 3OREA 1XXBA 3LHPS 3MMLB 1EH1A 1EK8A 4FM9A 2XCRB 1BGWA 5JVOA 4G0VA 4J3NA 4JLRC
chains in the Genus database with same CATH superfamily
4KN7A 4LR2A 2JA7K 3K5OA 3GTOA 4KASA 4OIQA 3S14C 1Q8IA 4A3DK 1VH2A 1YX2A 4OIPA 4P5BA 4XSZA 3K5LA 1K4SA 2R7ZA 2EBBA 1SC7A 4L8IA 4KMDA 1MIUA 4LQYA 3CQZK 4Q5VA 3LAPA 4KMUA 2NVTK 1EI6A 3GTJA 1Y1VC 1PJ6A 2V6SA 3CQZA 1G51A 5M3MK 1BJTA 4KARA 1TL8A 4WJ3M 4GT9A 4GTDA 3GTMA 4QJVA 3PO2K 2BE5A 5CHPA 1IS1A 4IP8A 4FYDA 1RU0A 1O2FB 3GTOK 1ZXOA 2D6FC 4GTEA 3AH5A 5TJ3A 4QIWD 2VUMA 2XCQA 3GTKA 4KMHA 2PMZA 3GTMK 3HKZA 1I6VD 1USOA 4A3CC 1F7UA 3HOYC 3LHPS 4KN4A 1J98A 3RZOK 1BS2A 2NVXK 3G4AA 3GTQC 3GSIA 3GDZA 5IP7C 3H3VD 4G7HA 4WILA 4P5AA 4C3IC 1F7VA 1ISEA 4AHCA 2A68A 1WCMK 5JFEA 4WJ4A 4G7OA 1WSRA 1XPPA 2GSNA 1I6VA 3HOZK 3OEPA 1SFOK 1Y1VA 5C4XC 1SMYD 3GEIA 3LPXA 1K83C 4BKWA 4QIWA 1USMA 3S17C 2B63K 4Q4ZA 4A3LC 1EH1A 5D4DA 4C3JK 4A3MK 4KATA 2BE5D 2WB1A 1R9TK 1ZYRD 3K7AK 1L0WA 5IYDK 4Q5SA 4KM8A 3OPFA 3S0XA 3K59A 4KM9A 3S2DC 2R7ZC 1O25A 2NVYA 4KAWX 1EQRA 3BP8C 1UV7A 3EQLA 1WQFA 4D3ZA 4BXXK 4BY7C 3Q3QA 2A6HD 1JOEA 2WAQD 5C4JC 2B9SB 5C9HA 3SJRA 4FGUA 1WSVA 3K7AC 1WQHA 3I4MK 1EFWA 3I4MC 4A3MC 4OYDB 2O5JA 4YG2A 3FOFA 3FKIK 1VJEA 1C0AA 4Q5GA 4AN8A 4BY1C 5FJ8K 3RZDK 2NVQK 5EGHA 3G4CA 4A93K 4GTFA 4G0WA 4F3EA 3HOUK 1J6XA 1YNND 1F93A 2R92C 3TTGA 1TWHC 5IP9K 3HOVC 5IP9C 1WCMC 2JA6C 1YNJD 3S1RK 4JLRC 2GSOA 2Y3PA 3HOUC 4X6AC 3H3VL 1ZBSA 2V6UA 3GTLC 3M4AA 2NVYK 1V9MA 2WB1L 5MLC9 2NVYC 2PA8L 2PMZL 2B63C 1Y1WA 1DCPA 4NOLA 4A3IC 3K58A 4D3YA 1HQMD 2R92A 1WQGA 2CFAA 4QCLA 3N0BA 2Y0SD 3LAJA 3K5NA 2R4GA 1IL2A 1JVIA 1NH3A 1DCOA 2R92K 1O2AA 2JA8K 5IOTA 5IYDC 1TWHK 3RZDC 2NVQC 4IP9A 1J6VA 2NVXC 4M1XA 3H0GC 3HOWC 4C45A 4A3FK 3N3YA 1V5VA 1R49A 4OINA 1A31A 1B4BA 1ZVUA 1DCHA 5FLMK 1TWHA 4A3DC 4A3IK 4LLGA 1R9TA 1I3QA 3HXAA 3S1RC 3QX3A 2A6ED 3IAYA 2E2HA 3AD8C 1K83A 1EJ9A 4AYBL 5CJ9A 1F9NA 3HOXC 1IQ0A 2JA6K 3GTGK 5M3FK 4KMAA 1I50A 4G0UA 4G7ZA 1Y1WK 1WORA 4EJ3A 4KB4A 3T02A 2XCOA 5C44C 3S1QC 2F4QA 2ZFZA 3CAGA 3S2HK 1A35A 4A3CK 4C3HK 1SEUA 3GIRA 1GE9A 1R9TC 4YFXA 4Y7NK 3MAQA 2Y0SL 3GTGA 4A3JK 1XXBA 4YFKA 4AYBD 4BXXC 4BY7K 3HOZC 1Y698 5C4XK 1TGOA 2A69A 3PO3K 3GTOC 1XZPA 3S15K 1WIHA 2CW0D 5JSNB 5JSBB 2JA5A 2NVTC 3A8JA 1O29A 3S2DK 3K5MA 4PAAA 4A93C 5L46A 1J6WA 4GTCA 3N0CA 1Y1VK 4A3GC 3I4NC 2RH6A 3GTMC 2V6TA 1T8IA 2E2JC 2JA5K 3GTGC 2JH3A 1TWFA 1I50K 1IW7A 3CQZC 4BLBA 2JA6A 2P5MA 4AYBA 1B4AA 2CW0A 3DU5A 3H0GA 3AQOA 4A3LK 4KB2A 2VUMC 3I4NK 3HOVK 4ILDA 2YU9A 1DD5A 1VGXA 2FQTA 2P8TA 4NOIA 4OIRA 1KQ4A 1SFOC 2W7VA 1XZQB 3NUHA 4GTBA 5EGEA 3V4GA 1I3QC 1RR8C 1AB4A 4BY1K 4O26A 3GTKC 4LK0A 4C3IK 2JA7A 3BP3A 1WOPA 2O5JD 5M5XK 3GTQK 4GTAA 5IYBC 1O2BA 3LF9A 3HOYK 4DDQA 2WAQA 5C4JK 2A6HA 4A3GK 4QIWL 4A3BK 5M5YK 3GTLK 1TWGA 1IW7D 2FQOA 1TWCK 1WOOA 2GAHC 3WODA 3GTPC 3S1MC 3PO2C 3S14K 3GTJK 3TFIA 2JA7C 4YFNA 3S1QK 3MMLB 3JSTA 3SZZA 4LMOA 3FKIA 4BBRK 4FM9A 1BGWA 1A36A 3GTJC 3KYLA 4MEXA 3S1MK 5IYCC 4RMFA 4C3JC 5TMCA 2ZUEA 2R7ZK 2R93C 4A3BC 5TMFA 5C3EC 4JK1A 3GTPA 1TWGC 4KDDA 1VRQC 3HKZL 3GEEA 4ZH4A 1HQMA 5FLMC 1HI9A 2YU9K 1TWGK 1O24A 5E68A 3L4KA 4A3KK 3S16K 3S17K 3GEHA 1JQWA 4QJVB 4XLNA 3M3YK 3S1NK 2A69D 4XCHA 1I3QK 4A3FC 1I6HC 1TWAA 3A8IA 2E2IK 4GTLA 2ZUFA 1YNJA 2JA8C 1IBAA 1XXAA 3SZYA 5IP7K 1SFOA 3HKZD 1YNNA 3L4JA 3BUEA 4FXDA 3RZOC 2E2IA 4H3TA 1PJ5A 3FOEA 4XLPA 2JA5C 1YCLA 3T01A 5HL8A 1EK8A 5CQGA 4A3EC 5JVOA 2R93A 4C2MK 3H0GK 3HOWK 1K83K 3AQPA 4P9SA 5IOSA 4Y52C 4BBSK 4BBRC 3WVOA 1XZQA 4KC6A 1R5ZA 3IPJA 2RGRA 1VLOA 3M4OK 1TWFK 4GZYA 2PPBA 2A6EA 4LJZA 5IOQA 2WB1D 3K57A 2B63A 4BBSC 4Y52K 2PHCB 3VA7A 3M4OC 4FZBA 3GTPK 2E2IC 2YU9C 4A3EK 3M3YC 1RRJA 3ERED 1I6HK 4O2DA 3OREA 1TWAK 1TWAC 3AD9C 4NOKA 1SMYA 3TFHA 1WCMA 3P9AA 2Y0SA 3FKIC 2WAQL 2CFAB 4LK1A 1O26A 4X6AK 1TWCA 1PJ7A 4BLAA 2E2HK 5C44K 2NVXA 4OIOA 1O27A 4MEYA 3S15C 2GSUA 3PO3C 1X31C 5IYCK 2GAGC 1ZYRA 3S1NC 3A8KA 1INNA 1O28A 4GFQA 3ADAC 4C2MC 2VUMK 4A3KC 3S16C 1TWFC 2A68D 3GTQA 4J3NA 1ZQ1C 5M5WK 2E2HC 1I50C 1TWCC 3FHZA 5IYBK 4NOMA 2E2JK 3AD7C 4XSXA 3TFJA 4LOWA 3DXJA 1IE0A 2KWAA 4A3JC 3GTLA 3S2HC 4Y7NC 2PA8D 2PMZD 2O5IA 1WOSA 5C3EK 1BDFA 1Y1WC 5IORA 4C3HC 3HOXK 4C2MA 1LPQA 1XXCA 3DU6A 2R93K 4PABA 3T00A 4AH6A 3GTKK 1K4TA 2XCRB 1XZPB 4G0VA 4MQ9A
chains in the Genus database with same CATH topology
1WQHA 1Y698 4LR2A 1TWAA 3K5OA 3GTOA 4KASA 4OYDB 1Q8IA 1TGOA 4GTLA 3FOFA 4P5BA 3K5LA 1K4SA 2R7ZA 4Q5GA 1XXAA 4AN8A 1SC7A 1WIHA 1SFOA 4L8IA 2CW0D 5JSNB 5JSBB 2JA5A 1MIUA 3G4CA 4GTFA 4KMDA 4LQYA 5EGHA 4F3EA 4Q5VA 3BUEA 4FXDA 4G0WA 3LAPA 1YNND 2E2IA 4H3TA 1O29A 3FOEA 3K5MA 3GTJA 4GTCA 3N0CA 3LAJA 2RH6A 3CQZA 1EK8A 5CQGA 1T8IA 5JVOA 1YNJD 2R93A 2JH3A 4JLRC 1TWFA 1BJTA 2GSOA 1TL8A 2Y3PA 3AQPA 4GT9A 4GTDA 3GTMA 4KARA 4BLBA 2JA6A 5IOSA 5CHPA 2P5MA 2A69D 1ZBSA 1IS1A 4IP8A 4AYBA 3WVOA 1B4AA 4KC6A 1R5ZA 3M4AA 4FYDA 2RGRA 1V9MA 3DU5A 3H0GA 5MLC9 3AQOA 4KB2A 1ZXOA 1Y1WA 4GTEA 4ILDA 3AH5A 4NOLA 5IOQA 2YU9A 1DD5A 5TJ3A 3K57A 3K58A 2VUMA 4D3YA 2B63A 1KQ4A 2PHCB 3VA7A 4FZBA 1HQMD 2R92A 3NUHA 1WQGA 2CFAA 4QCLA 2XCQA 3GTKA 3N0BA 4GTBA 2PMZA 3K5NA 4KMHA 2R4GA 3HKZA 1RR8C 5EGEA 1AB4A 1RRJA 3V4GA 3L4JA 1I6VD 4O26A 3ERED 3OREA 2JA7A 3LHPS 1NH3A 4NOKA 1O2AA 1WCMA 3P9AA 2Y0SA 2O5JD 3G4AA 2CFAB 5IOTA 1O26A 4IP9A 4GTAA 1TWCA 1O2BA 3LF9A 4M1XA 4BLAA 3N3YA 4P5AA 4C3IC 1ISEA 4AHCA 4DDQA 2WAQA 2NVXA 5JFEA 1R49A 1O27A 2GSNA 1A31A 2GSUA 1TWGA 1IW7D 3OEPA 1B4BA 1ZVUA 1TWHA 1Y1VA 1O28A 1SMYD 3LPXA 4GFQA 4BKWA 4QIWA 1R9TA 1I3QA 4C2MC 3QX3A 2A68D 2A6ED 3IAYA 2E2HA 1EH1A 3MMLB 4LMOA 3FKIA 1K83A 1EJ9A 4FM9A 1BGWA 3GTQA 1A36A 4J3NA 3KYLA 4KATA 3FHZA 4C3JC 2BE5D 5CJ9A 2WB1A 4NOMA 1F9NA 1ZYRD 4KMAA 1I50A 4G0UA 4EJ3A 4KB4A 3OPFA 2XCOA 3K59A 4KM8A 2KWAA 3S0XA 4KM9A 2F4QA 3GTLA 2ZFZA 3CAGA 1A35A 1O25A 3GTPA 2NVYA 4KAWX 4KDDA 5IORA 1SEUA 4C3HC 1GE9A 4C2MA 1WQFA 1LPQA 3DU6A 4D3ZA 1XXCA 1O24A 3MAQA 3L4KA 3Q3QA 2A6HD 3GTGA 1XXBA 2B9SB 5C9HA 1K4TA 2XCRB 3SJRA 4FGUA 4G0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJT A;  1WQH A;  1Y69 8;  2Y3P A;  3FHZ A;  2P5M A;  1F9N A;  5CJ9 A;  4OYD B;  1IS1 A;  3FOF A;  3LF9 A;  1B4A A;  4KC6 A;  4G0U A;  2RGR A;  5MLC 9;  1ISE A;  4KB2 A;  4KB4 A;  2XCO A;  3OPF A;  4DDQ A;  2KWA A;  1XXA A;  2ZFZ A;  3CAG A;  1WIH A;  1DD5 A;  4KAW X;  4KDD A;  4L8I A;  5JSN B;  5JSB B;  2PHC B;  3VA7 A;  3OEP A;  3L4J A;  1B4B A;  1ZVU A;  4G0W A;  3BUE A;  1WQG A;  3NUH A;  2XCQ A;  3LAJ A;  3LAP A;  1GE9 A;  3V4G A;  1XXC A;  1WQF A;  3FOE A;  1AB4 A;  3LPX A;  4GFQ A;  3ERE D;  3QX3 A;  3L4K A;  3ORE A;  1XXB A;  3LHP S;  3MML B;  1EH1 A;  1EK8 A;  4FM9 A;  2XCR B;  1BGW A;  5JVO A;  4G0V A;  4J3N A;  4JLR C; 
#chains in the Genus database with same CATH topology
 4KN7 A;  4LR2 A;  2JA7 K;  3K5O A;  3GTO A;  4KAS A;  4OIQ A;  3S14 C;  1Q8I A;  4A3D K;  1VH2 A;  1YX2 A;  4OIP A;  4P5B A;  4XSZ A;  3K5L A;  1K4S A;  2R7Z A;  2EBB A;  1SC7 A;  4L8I A;  4KMD A;  1MIU A;  4LQY A;  3CQZ K;  4Q5V A;  3LAP A;  4KMU A;  2NVT K;  1EI6 A;  3GTJ A;  1Y1V C;  1PJ6 A;  2V6S A;  3CQZ A;  1G51 A;  5M3M K;  1BJT A;  4KAR A;  1TL8 A;  4WJ3 M;  4GT9 A;  4GTD A;  3GTM A;  4QJV A;  3PO2 K;  2BE5 A;  5CHP A;  1IS1 A;  4IP8 A;  4FYD A;  1RU0 A;  1O2F B;  3GTO K;  1ZXO A;  2D6F C;  4GTE A;  3AH5 A;  5TJ3 A;  4QIW D;  2VUM A;  2XCQ A;  3GTK A;  4KMH A;  2PMZ A;  3GTM K;  3HKZ A;  1I6V D;  1USO A;  4A3C C;  1F7U A;  3HOY C;  3LHP S;  4KN4 A;  1J98 A;  3RZO K;  1BS2 A;  2NVX K;  3G4A A;  3GTQ C;  3GSI A;  3GDZ A;  5IP7 C;  3H3V D;  4G7H A;  4WIL A;  4P5A A;  4C3I C;  1F7V A;  1ISE A;  4AHC A;  2A68 A;  1WCM K;  5JFE A;  4WJ4 A;  4G7O A;  1WSR A;  1XPP A;  2GSN A;  1I6V A;  3HOZ K;  3OEP A;  1SFO K;  1Y1V A;  5C4X C;  1SMY D;  3GEI A;  3LPX A;  1K83 C;  4BKW A;  4QIW A;  1USM A;  3S17 C;  2B63 K;  4Q4Z A;  4A3L C;  1EH1 A;  5D4D A;  4C3J K;  4A3M K;  4KAT A;  2BE5 D;  2WB1 A;  1R9T K;  1ZYR D;  3K7A K;  1L0W A;  5IYD K;  4Q5S A;  4KM8 A;  3OPF A;  3S0X A;  3K59 A;  4KM9 A;  3S2D C;  2R7Z C;  1O25 A;  2NVY A;  4KAW X;  1EQR A;  3BP8 C;  1UV7 A;  3EQL A;  1WQF A;  4D3Z A;  4BXX K;  4BY7 C;  3Q3Q A;  2A6H D;  1JOE A;  2WAQ D;  5C4J C;  2B9S B;  5C9H A;  3SJR A;  4FGU A;  1WSV A;  3K7A C;  1WQH A;  3I4M K;  1EFW A;  3I4M C;  4A3M C;  4OYD B;  2O5J A;  4YG2 A;  3FOF A;  3FKI K;  1VJE A;  1C0A A;  4Q5G A;  4AN8 A;  4BY1 C;  5FJ8 K;  3RZD K;  2NVQ K;  5EGH A;  3G4C A;  4A93 K;  4GTF A;  4G0W A;  4F3E A;  3HOU K;  1J6X A;  1YNN D;  1F93 A;  2R92 C;  3TTG A;  1TWH C;  5IP9 K;  3HOV C;  5IP9 C;  1WCM C;  2JA6 C;  1YNJ D;  3S1R K;  4JLR C;  2GSO A;  2Y3P A;  3HOU C;  4X6A C;  3H3V L;  1ZBS A;  2V6U A;  3GTL C;  3M4A A;  2NVY K;  1V9M A;  2WB1 L;  5MLC 9;  2NVY C;  2PA8 L;  2PMZ L;  2B63 C;  1Y1W A;  1DCP A;  4NOL A;  4A3I C;  3K58 A;  4D3Y A;  1HQM D;  2R92 A;  1WQG A;  2CFA A;  4QCL A;  3N0B A;  2Y0S D;  3LAJ A;  3K5N A;  2R4G A;  1IL2 A;  1JVI A;  1NH3 A;  1DCO A;  2R92 K;  1O2A A;  2JA8 K;  5IOT A;  5IYD C;  1TWH K;  3RZD C;  2NVQ C;  4IP9 A;  1J6V A;  2NVX C;  4M1X A;  3H0G C;  3HOW C;  4C45 A;  4A3F K;  3N3Y A;  1V5V A;  1R49 A;  4OIN A;  1A31 A;  1B4B A;  1ZVU A;  1DCH A;  5FLM K;  1TWH A;  4A3D C;  4A3I K;  4LLG A;  1R9T A;  1I3Q A;  3HXA A;  3S1R C;  3QX3 A;  2A6E D;  3IAY A;  2E2H A;  3AD8 C;  1K83 A;  1EJ9 A;  4AYB L;  5CJ9 A;  1F9N A;  3HOX C;  1IQ0 A;  2JA6 K;  3GTG K;  5M3F K;  4KMA A;  1I50 A;  4G0U A;  4G7Z A;  1Y1W K;  1WOR A;  4EJ3 A;  4KB4 A;  3T02 A;  2XCO A;  5C44 C;  3S1Q C;  2F4Q A;  2ZFZ A;  3CAG A;  3S2H K;  1A35 A;  4A3C K;  4C3H K;  1SEU A;  3GIR A;  1GE9 A;  1R9T C;  4YFX A;  4Y7N K;  3MAQ A;  2Y0S L;  3GTG A;  4A3J K;  1XXB A;  4YFK A;  4AYB D;  4BXX C;  4BY7 K;  3HOZ C;  1Y69 8;  5C4X K;  1TGO A;  2A69 A;  3PO3 K;  3GTO C;  1XZP A;  3S15 K;  1WIH A;  2CW0 D;  5JSN B;  5JSB B;  2JA5 A;  2NVT C;  3A8J A;  1O29 A;  3S2D K;  3K5M A;  4PAA A;  4A93 C;  5L46 A;  1J6W A;  4GTC A;  3N0C A;  1Y1V K;  4A3G C;  3I4N C;  2RH6 A;  3GTM C;  2V6T A;  1T8I A;  2E2J C;  2JA5 K;  3GTG C;  2JH3 A;  1TWF A;  1I50 K;  1IW7 A;  3CQZ C;  4BLB A;  2JA6 A;  2P5M A;  4AYB A;  1B4A A;  2CW0 A;  3DU5 A;  3H0G A;  3AQO A;  4A3L K;  4KB2 A;  2VUM C;  3I4N K;  3HOV K;  4ILD A;  2YU9 A;  1DD5 A;  1VGX A;  2FQT A;  2P8T A;  4NOI A;  4OIR A;  1KQ4 A;  1SFO C;  2W7V A;  1XZQ B;  3NUH A;  4GTB A;  5EGE A;  3V4G A;  1I3Q C;  1RR8 C;  1AB4 A;  4BY1 K;  4O26 A;  3GTK C;  4LK0 A;  4C3I K;  2JA7 A;  3BP3 A;  1WOP A;  2O5J D;  5M5X K;  3GTQ K;  4GTA A;  5IYB C;  1O2B A;  3LF9 A;  3HOY K;  4DDQ A;  2WAQ A;  5C4J K;  2A6H A;  4A3G K;  4QIW L;  4A3B K;  5M5Y K;  3GTL K;  1TWG A;  1IW7 D;  2FQO A;  1TWC K;  1WOO A;  2GAH C;  3WOD A;  3GTP C;  3S1M C;  3PO2 C;  3S14 K;  3GTJ K;  3TFI A;  2JA7 C;  4YFN A;  3S1Q K;  3MML B;  3JST A;  3SZZ A;  4LMO A;  3FKI A;  4BBR K;  4FM9 A;  1BGW A;  1A36 A;  3GTJ C;  3KYL A;  4MEX A;  3S1M K;  5IYC C;  4RMF A;  4C3J C;  5TMC A;  2ZUE A;  2R7Z K;  2R93 C;  4A3B C;  5TMF A;  5C3E C;  4JK1 A;  3GTP A;  1TWG C;  4KDD A;  1VRQ C;  3HKZ L;  3GEE A;  4ZH4 A;  1HQM A;  5FLM C;  1HI9 A;  2YU9 K;  1TWG K;  1O24 A;  5E68 A;  3L4K A;  4A3K K;  3S16 K;  3S17 K;  3GEH A;  1JQW A;  4QJV B;  4XLN A;  3M3Y K;  3S1N K;  2A69 D;  4XCH A;  1I3Q K;  4A3F C;  1I6H C;  1TWA A;  3A8I A;  2E2I K;  4GTL A;  2ZUF A;  1YNJ A;  2JA8 C;  1IBA A;  1XXA A;  3SZY A;  5IP7 K;  1SFO A;  3HKZ D;  1YNN A;  3L4J A;  3BUE A;  4FXD A;  3RZO C;  2E2I A;  4H3T A;  1PJ5 A;  3FOE A;  4XLP A;  2JA5 C;  1YCL A;  3T01 A;  5HL8 A;  1EK8 A;  5CQG A;  4A3E C;  5JVO A;  2R93 A;  4C2M K;  3H0G K;  3HOW K;  1K83 K;  3AQP A;  4P9S A;  5IOS A;  4Y52 C;  4BBS K;  4BBR C;  3WVO A;  1XZQ A;  4KC6 A;  1R5Z A;  3IPJ A;  2RGR A;  1VLO A;  3M4O K;  1TWF K;  4GZY A;  2PPB A;  2A6E A;  4LJZ A;  5IOQ A;  2WB1 D;  3K57 A;  2B63 A;  4BBS C;  4Y52 K;  2PHC B;  3VA7 A;  3M4O C;  4FZB A;  3GTP K;  2E2I C;  2YU9 C;  4A3E K;  3M3Y C;  1RRJ A;  3ERE D;  1I6H K;  4O2D A;  3ORE A;  1TWA K;  1TWA C;  3AD9 C;  4NOK A;  1SMY A;  3TFH A;  1WCM A;  3P9A A;  2Y0S A;  3FKI C;  2WAQ L;  2CFA B;  4LK1 A;  1O26 A;  4X6A K;  1TWC A;  1PJ7 A;  4BLA A;  2E2H K;  5C44 K;  2NVX A;  4OIO A;  1O27 A;  4MEY A;  3S15 C;  2GSU A;  3PO3 C;  1X31 C;  5IYC K;  2GAG C;  1ZYR A;  3S1N C;  3A8K A;  1INN A;  1O28 A;  4GFQ A;  3ADA C;  4C2M C;  2VUM K;  4A3K C;  3S16 C;  1TWF C;  2A68 D;  3GTQ A;  4J3N A;  1ZQ1 C;  5M5W K;  2E2H C;  1I50 C;  1TWC C;  3FHZ A;  5IYB K;  4NOM A;  2E2J K;  3AD7 C;  4XSX A;  3TFJ A;  4LOW A;  3DXJ A;  1IE0 A;  2KWA A;  4A3J C;  3GTL A;  3S2H C;  4Y7N C;  2PA8 D;  2PMZ D;  2O5I A;  1WOS A;  5C3E K;  1BDF A;  1Y1W C;  5IOR A;  4C3H C;  3HOX K;  4C2M A;  1LPQ A;  1XXC A;  3DU6 A;  2R93 K;  4PAB A;  3T00 A;  4AH6 A;  3GTK K;  1K4T A;  2XCR B;  1XZP B;  4G0V A;  4MQ9 A; 
#chains in the Genus database with same CATH homology
 1WQH A;  1Y69 8;  4LR2 A;  1TWA A;  3K5O A;  3GTO A;  4KAS A;  4OYD B;  1Q8I A;  1TGO A;  4GTL A;  3FOF A;  4P5B A;  3K5L A;  1K4S A;  2R7Z A;  4Q5G A;  1XXA A;  4AN8 A;  1SC7 A;  1WIH A;  1SFO A;  4L8I A;  2CW0 D;  5JSN B;  5JSB B;  2JA5 A;  1MIU A;  3G4C A;  4GTF A;  4KMD A;  4LQY A;  5EGH A;  4F3E A;  4Q5V A;  3BUE A;  4FXD A;  4G0W A;  3LAP A;  1YNN D;  2E2I A;  4H3T A;  1O29 A;  3FOE A;  3K5M A;  3GTJ A;  4GTC A;  3N0C A;  3LAJ A;  2RH6 A;  3CQZ A;  1EK8 A;  5CQG A;  1T8I A;  5JVO A;  1YNJ D;  2R93 A;  2JH3 A;  4JLR C;  1TWF A;  1BJT A;  2GSO A;  1TL8 A;  2Y3P A;  3AQP A;  4GT9 A;  4GTD A;  3GTM A;  4KAR A;  4BLB A;  2JA6 A;  5IOS A;  5CHP A;  2P5M A;  2A69 D;  1ZBS A;  1IS1 A;  4IP8 A;  4AYB A;  3WVO A;  1B4A A;  4KC6 A;  1R5Z A;  3M4A A;  4FYD A;  2RGR A;  1V9M A;  3DU5 A;  3H0G A;  5MLC 9;  3AQO A;  4KB2 A;  1ZXO A;  1Y1W A;  4GTE A;  4ILD A;  3AH5 A;  4NOL A;  5IOQ A;  2YU9 A;  1DD5 A;  5TJ3 A;  3K57 A;  3K58 A;  2VUM A;  4D3Y A;  2B63 A;  1KQ4 A;  2PHC B;  3VA7 A;  4FZB A;  1HQM D;  2R92 A;  3NUH A;  1WQG A;  2CFA A;  4QCL A;  2XCQ A;  3GTK A;  3N0B A;  4GTB A;  2PMZ A;  3K5N A;  4KMH A;  2R4G A;  3HKZ A;  1RR8 C;  5EGE A;  1AB4 A;  1RRJ A;  3V4G A;  3L4J A;  1I6V D;  4O26 A;  3ERE D;  3ORE A;  2JA7 A;  3LHP S;  1NH3 A;  4NOK A;  1O2A A;  1WCM A;  3P9A A;  2Y0S A;  2O5J D;  3G4A A;  2CFA B;  5IOT A;  1O26 A;  4IP9 A;  4GTA A;  1TWC A;  1O2B A;  3LF9 A;  4M1X A;  4BLA A;  3N3Y A;  4P5A A;  4C3I C;  1ISE A;  4AHC A;  4DDQ A;  2WAQ A;  2NVX A;  5JFE A;  1R49 A;  1O27 A;  2GSN A;  1A31 A;  2GSU A;  1TWG A;  1IW7 D;  3OEP A;  1B4B A;  1ZVU A;  1TWH A;  1Y1V A;  1O28 A;  1SMY D;  3LPX A;  4GFQ A;  4BKW A;  4QIW A;  1R9T A;  1I3Q A;  4C2M C;  3QX3 A;  2A68 D;  2A6E D;  3IAY A;  2E2H A;  1EH1 A;  3MML B;  4LMO A;  3FKI A;  1K83 A;  1EJ9 A;  4FM9 A;  1BGW A;  3GTQ A;  1A36 A;  4J3N A;  3KYL A;  4KAT A;  3FHZ A;  4C3J C;  2BE5 D;  5CJ9 A;  2WB1 A;  4NOM A;  1F9N A;  1ZYR D;  4KMA A;  1I50 A;  4G0U A;  4EJ3 A;  4KB4 A;  3OPF A;  2XCO A;  3K59 A;  4KM8 A;  2KWA A;  3S0X A;  4KM9 A;  2F4Q A;  3GTL A;  2ZFZ A;  3CAG A;  1A35 A;  1O25 A;  3GTP A;  2NVY A;  4KAW X;  4KDD A;  5IOR A;  1SEU A;  4C3H C;  1GE9 A;  4C2M A;  1WQF A;  1LPQ A;  3DU6 A;  4D3Z A;  1XXC A;  1O24 A;  3MAQ A;  3L4K A;  3Q3Q A;  2A6H D;  3GTG A;  1XXB A;  2B9S B;  5C9H A;  1K4T A;  2XCR B;  3SJR A;  4FGU A;  4G0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...