1EK8A

Crystal structure of the ribosome recycling factor (rrf) from escherichia coli
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
185
Chain Sequence
MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords RIBOSOME RECYCLING FACTOR
publication title Crystal structure of the ribosome recycling factor from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 60
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2000-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1ek8A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1ek8A02
3CAGA 3MMLB 5JSBB 4GFQA 1GE9A 2XCOA 3NUHA 3VA7A 1DD5A 3LPXA 4G0VA 3LF9A 3LHPS 1B4AA 2XCQA 4KB4A 5JSNB 3OEPA 5JVOA 3OREA 3V4GA 3LAJA 1BJTA 3L4JA 1XXAA 4KAWX 1ZVUA 2RGRA 3L4KA 1WQGA 1IS1A 2PHCB 3BUEA 1B4BA 4DDQA 3QX3A 1XXBA 1F9NA 4G0UA 1AB4A 3FOFA 1BGWA 2ZFZA 2XCRB 3FOEA 4OYDB 1XXCA 3OPFA 5MLC9 3FHZA 4FM9A 1Y698 4KC6A 1EH1A 4KB2A 3ERED 1WIHA 2KWAA 2P5MA 5CJ9A 1EK8A 3LAPA 2Y3PA 4L8IA 4G0WA 1WQHA 4J3NA 1ISEA 4JLRC 1WQFA 4KDDA
chains in the Genus database with same CATH superfamily
3CAGA 4GTCA 4BKWA 2BE5D 1XZQA 4LMOA 2GSUA 1Y1VC 3FKIK 3GTKK 2E2IA 1F7UA 3K58A 1O27A 4KAWX 2RH6A 4BLAA 3FKIC 3GTKC 2A6HD 3EQLA 3ADAC 3GDZA 3BP3A 1VRQC 3GTQA 3SZZA 2R92A 5FJ8K 2E2JC 2NVXK 1TGOA 5HL8A 2P5MA 4Y52C 3K5MA 3GEEA 2NVXC 1HQMA 3S1MC 5CHPA 1WQHA 1A36A 4IP9A 4OIPA 3DU5A 4FGUA 1GE9A 1BDFA 3NUHA 4KM8A 5IYDK 4M1XA 4A3IK 1V9MA 4WJ4A 4X6AK 5IYDC 1TWCK 3AH5A 1SMYD 3IAYA 3CQZK 5CQGA 3L4KA 4X6AC 2WB1A 1TWCC 5D4DA 3CQZC 1YNJD 2Y0SD 5M3MK 5MLC9 4KASA 4NOMA 3RZOK 1O26A 4PABA 2WAQA 1O28A 3G4AA 4YFKA 3GTLK 3RZOC 1F7VA 3OREA 1WSRA 1J6VA 3SZYA 3HOZC 3GTLC 3HKZD 1IW7D 3DU6A 4A3DC 4GTDA 2NVQK 4C3JK 4MEYA 4BLBA 2NVQC 3RZDK 5C44K 4A3LK 4QIWA 4C3JC 1B4BA 3RZDC 5C44C 4D3ZA 4A3LC 1INNA 4KC6A 1EH1A 4NOLA 4KB2A 1TWGK 3ERED 1A35A 2Y0SL 1SFOA 1PJ5A 1EK8A 1O2FB 4KMDA 2GAHC 4FZBA 1TWGC 4A3JK 4BBRK 4A3JC 1ZYRA 4GFQA 4YG2A 4BBRC 3HKZL 1O2AA 1MIUA 2YU9K 4WILA 4LJZA 4C2MA 1TWAA 4AH6A 4A3KK 2YU9C 5TMFA 2JA6A 2PA8L 3GTPA 4A3CK 4A3KC 4PAAA 3AD8C 2KWAA 1I6VA 3HOUK 2R4GA 3M3YK 4A93K 4BXXK 1ISEA 4OIRA 3HOUC 1I50A 3M3YC 4KATA 4A93C 4ILDA 4BXXC 3GSIA 3AD9C 5IP7C 3OEPA 4KMAA 3M4AA 3PO2K 3KYLA 4IP8A 2O5IA 4A3EK 3PO2C 1O29A 1SFOK 4KN7A 1VH2A 4A3EC 1SFOC 3N0BA 4AHCA 1TL8A 1TWFK 1L0WA 3JSTA 1RU0A 5IYCK 1TWFC 1LPQA 3S16C 4NOKA 2BE5A 3G4CA 5IYCC 4MEXA 3GTOA 5EGEA 1SEUA 1ZQ1C 1VJEA 4GTBA 1J6WA 4C2MK 3GEHA 1TWAK 2A6HA 1Y1WA 4P9SA 4C2MC 1TWAC 3GTPK 4OIOA 1F9NA 4C3HC 1AB4A 2E2JK 3SJRA 2JA6C 2ZFZA 3GTPC 4FYDA 4Y52K 3T01A 3S1MK 1TWHK 4G7ZA 2Y3PA 5E68A 1I50C 1TWHC 3HOVK 2V6TA 4J3NA 1VGXA 1R49A 1A31A 5C4JC 1USOA 3HOVC 2XCOA 5IYBK 1SMYA 1WOOA 4AN8A 4AYBD 4QJVA 4XSZA 5IYBC 3GTJA 2PHCB 1JOEA 1YNJA 4MQ9A 1T8IA 5L46A 2Y0SA 4KMUA 3FOEA 3GTGA 1O2BA 4A3BK 4P5BA 3GTOK 1V5VA 3T02A 3HOZK 4A3BC 4G0WA 1C0AA 2A69D 3HKZA 1IW7A 3GTOC 4KDDA 3HOXK 2JH3A 5IORA 3S2DK 4A3DK 2E2IK 3GTMA 1Y1WK 2EBBA 3S2DC 3HOXC 5JFEA 2E2IC 1Y1WC 3GTQK 3S15K 2R92K 1ZVUA 2O5JD 1WQGA 3S1QK 4AYBL 2D6FC 1WCMA 3GTQC 3S15C 3WVOA 2R92C 3S14K 3S1QC 2PA8D 4OYDB 3S14C 1R5ZA 2CFAB 5CJ9A 3K5OA 2P8TA 2B63A 4JK1A 2NVTK 5TJ3A 4BY1K 1KQ4A 2A6ED 2NVTC 4BY1C 3AD7C 1IBAA 3L4JA 5TMCA 4XSXA 2CW0D 4QJVB 3I4MK 4OIQA 3QX3A 3GTGK 3I4MC 1K4SA 4O26A 5M5WK 1WORA 3GTGC 4GTEA 5IOQA 4FM9A 5C3EK 3GTMK 1WOSA 3WODA 1O25A 5C3EC 3K5LA 4O2DA 3GTMC 1YNND 1I6HK 5IP7K 1DCOA 3H3VL 3VA7A 5IOTA 1WCMK 1I6HC 4RMFA 1RR8C 4WJ3M 4GTAA 2ZUFA 4LQYA 1WCMC 3GTKA 1EFWA 3Q3QA 3T00A 5C9HA 3H0GA 3S0XA 3HOWK 1BGWA 4GT9A 1Y698 1IQ0A 5EGHA 2B63K 3HOWC 4LK0A 4H3TA 5IOSA 4A3GC 3S16K 1YX2A 3DXJA 2B63C 1K4TA 1WQFA 1Q8IA 3IPJA 3MMLB 4BBSK 4LOWA 1IL2A 4LK1A 5JVOA 5JSNB 4BBSC 1I3QA 3I4NK 1XXAA 4NOIA 3MAQA 1PJ6A 2VUMA 4C3HK 3BUEA 3I4NC 1ZBSA 2JA6K 1JVIA 1ZXOA 3FOFA 2GSOA 1XXCA 3HOYC 2R93A 2PMZD 3K57A 2CFAA 2E2HA 1I50K 3K7AK 1WOPA 2V6UA 3N0CA 4KM9A 5C4JK 4LR2A 2A68D 3K7AC 3GTLA 4ZH4A 4Q5SA 1EQRA 3LF9A 4KB4A 4AYBA 1BJTA 3H0GK 2R7ZA 3TFJA 3H0GC 4Q4ZA 1DCHA 2NVYA 3N3YA 1F93A 3OPFA 5C4XK 4LLGA 5C4XC 2PMZL 1HQMD 5M5YK 2A69A 1TWGA 1RRJA 1J6XA 2ZUEA 4C45A 1I3QK 1R9TA 1DCPA 2VUMK 2GAGC 4G0VA 1G51A 1I3QC 4A3MK 1VLOA 3LAJA 4GZYA 2VUMC 2FQTA 4A3IC 2O5JA 4A3MC 2JA8K 1XZPB 4DDQA 2R93K 1X31C 4XLPA 2WB1D 2E2HK 2JA8C 3P9AA 1IE0A 2R93C 2YU9A 3FHZA 2E2HC 3K59A 4F3EA 2WAQD 4Y7NK 1SC7A 5M5XK 1EI6A 4KARA 1XPPA 5FLMK 3H3VD 2JA5A 2GSNA 4Y7NC 2R7ZK 2A6EA 1XZQB 5IP9K 3LPXA 1B4AA 2XCQA 5FLMC 1BS2A 3GTJK 3M4OK 2R7ZC 3V4GA 2W7VA 2CW0A 5IP9C 1EJ9A 2FQOA 2NVYK 3M4OC 3S2HK 3GTJC 3AQPA 3TFHA 4QIWD 3S1RK 2NVYC 3S17K 4QCLA 3S2HC 3A8IA 2XCRB 1HI9A 3S1RC 2WB1L 3S17C 1J98A 1JQWA 1WIHA 1R9TK 2JA7A 4XCHA 1TWFA 1R9TC 1K83A 1UV7A 1YNNA 2WAQL 1YCLA 4D3YA 4FXDA 3TTGA 2B9SB 1NH3A 1ZYRD 3A8JA 1DD5A 3S1NK 3LHPS 1Y1VA 3TFIA 3S1NC 2RGRA 1IS1A 3FKIA 4P5AA 3GIRA 3A8KA 4Q5VA 4Q5GA 4QIWL 2PPBA 4GTLA 4KN4A 4A3GK 2JA5K 4GTFA 3LAPA 5M3FK 4OINA 1I6VD 4A3CC 2NVXA 4L8IA 1PJ7A 3HXAA 1TWHA 2JA5C 4JLRC 4A3FK 5JSBB 2F4QA 3BP8C 4A3FC 3K5NA 3AQOA 4BY7K 1XZPA 1USMA 3PO3K 1XXBA 4YFXA 4G7OA 1O24A 4G0UA 3HOYK 4KMHA 2V6SA 2JA7K 1TWCA 4BY7C 3CQZA 2PMZA 4XLNA 3PO3C 4C3IK 1K83K 2JA7C 4EJ3A 4YFNA 4C3IC 4G7HA 1K83C 2A68A 3GEIA 1WSVA 1Y1VK
chains in the Genus database with same CATH topology
1R9TA 3CAGA 4GTCA 5TJ3A 2BE5D 4BKWA 1KQ4A 4ILDA 4LMOA 2GSUA 2A6ED 4G0VA 3OEPA 3LAJA 2E2IA 3M4AA 4KMAA 3L4JA 3K58A 3KYLA 4KAWX 1O27A 2RH6A 2CW0D 4IP8A 2A6HD 4BLAA 4DDQA 3QX3A 1O29A 3GTQA 2R92A 1K4SA 4O26A 3P9AA 2YU9A 4GTEA 5IOQA 3FHZA 1TGOA 4FM9A 3N0BA 4AHCA 1TL8A 3K59A 2P5MA 3K5MA 4F3EA 1O25A 5CHPA 1SC7A 3K5LA 1WQHA 1LPQA 4IP9A 4NOKA 1A36A 4KARA 3DU5A 1YNND 4FGUA 3G4CA 2JA5A 2GSNA 3GTOA 1GE9A 4KM8A 3NUHA 5EGEA 1SEUA 3VA7A 4M1XA 3LPXA 5IOTA 1B4AA 2XCQA 4GTBA 1V9MA 3V4GA 1RR8C 3AH5A 4GTAA 1SMYD 1EJ9A 3IAYA 4LQYA 5CQGA 1Y1WA 3GTKA 3AQPA 4C2MC 3L4KA 2WB1A 3Q3QA 5C9HA 1F9NA 1YNJD 3H0GA 4QCLA 1AB4A 3SJRA 4C3HC 3S0XA 1BGWA 2ZFZA 2XCRB 4GT9A 5MLC9 4FYDA 4KASA 1Y698 4NOMA 5EGHA 1O26A 1WIHA 4H3TA 2JA7A 2WAQA 5IOSA 2Y3PA 1O28A 3G4AA 1K4TA 1TWFA 4J3NA 1K83A 1WQFA 3OREA 1R49A 1Q8IA 1A31A 1IW7D 4D3YA 3DU6A 4FXDA 3MMLB 2B9SB 2XCOA 1NH3A 1ZYRD 1DD5A 4GTDA 3LHPS 5JVOA 5JSNB 1Y1VA 1I3QA 4AN8A 4BLBA 1XXAA 3MAQA 2RGRA 2VUMA 4QIWA 1IS1A 3GTJA 2PHCB 1B4BA 3BUEA 3FKIA 1ZBSA 1T8IA 4C3JC 4P5AA 4D3ZA 1ZXOA 2Y0SA 4Q5GA 4Q5VA 2GSOA 3FOFA 3FOEA 1XXCA 4GTLA 2R93A 1EH1A 4NOLA 3GTGA 3K57A 4KB2A 1O2BA 2CFAA 1A35A 3ERED 1SFOA 2E2HA 4GTFA 1EK8A 4P5BA 3LAPA 1I6VD 4KMDA 4FZBA 2NVXA 4L8IA 3N0CA 4KM9A 4G0WA 2A69D 1TWHA 4LR2A 2A68D 4JLRC 3HKZA 4KDDA 2JH3A 5IORA 5JSBB 4GFQA 3GTLA 3GTMA 2F4QA 3LF9A 3K5NA 3AQOA 4KB4A 1O2AA 5JFEA 4AYBA 1BJTA 1MIUA 2R7ZA 1ZVUA 2O5JD 1WQGA 1WCMA 1XXBA 3WVOA 1O24A 4G0UA 4C2MA 4KMHA 1TWAA 1TWCA 2NVYA 3N3YA 3CQZA 4OYDB 2PMZA 3OPFA 2JA6A 3GTPA 4EJ3A 1R5ZA 2CFAB 2KWAA 5CJ9A 1ISEA 2R4GA 3K5OA 4C3IC 1HQMD 1TWGA 2B63A 4KC6A 1RRJA 1I50A 4KATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAG A;  3MML B;  5JSB B;  4GFQ A;  1GE9 A;  2XCO A;  3NUH A;  3VA7 A;  1DD5 A;  3LPX A;  4G0V A;  3LF9 A;  3LHP S;  1B4A A;  2XCQ A;  4KB4 A;  5JSN B;  3OEP A;  5JVO A;  3ORE A;  3V4G A;  3LAJ A;  1BJT A;  3L4J A;  1XXA A;  4KAW X;  1ZVU A;  2RGR A;  3L4K A;  1WQG A;  1IS1 A;  2PHC B;  3BUE A;  1B4B A;  4DDQ A;  3QX3 A;  1XXB A;  1F9N A;  4G0U A;  1AB4 A;  3FOF A;  1BGW A;  2ZFZ A;  2XCR B;  3FOE A;  4OYD B;  1XXC A;  3OPF A;  5MLC 9;  3FHZ A;  4FM9 A;  1Y69 8;  4KC6 A;  1EH1 A;  4KB2 A;  3ERE D;  1WIH A;  2KWA A;  2P5M A;  5CJ9 A;  1EK8 A;  3LAP A;  2Y3P A;  4L8I A;  4G0W A;  1WQH A;  4J3N A;  1ISE A;  4JLR C;  1WQF A;  4KDD A; 
#chains in the Genus database with same CATH topology
 3CAG A;  4GTC A;  4BKW A;  2BE5 D;  1XZQ A;  4LMO A;  2GSU A;  1Y1V C;  3FKI K;  3GTK K;  2E2I A;  1F7U A;  3K58 A;  1O27 A;  4KAW X;  2RH6 A;  4BLA A;  3FKI C;  3GTK C;  2A6H D;  3EQL A;  3ADA C;  3GDZ A;  3BP3 A;  1VRQ C;  3GTQ A;  3SZZ A;  2R92 A;  5FJ8 K;  2E2J C;  2NVX K;  1TGO A;  5HL8 A;  2P5M A;  4Y52 C;  3K5M A;  3GEE A;  2NVX C;  1HQM A;  3S1M C;  5CHP A;  1WQH A;  1A36 A;  4IP9 A;  4OIP A;  3DU5 A;  4FGU A;  1GE9 A;  1BDF A;  3NUH A;  4KM8 A;  5IYD K;  4M1X A;  4A3I K;  1V9M A;  4WJ4 A;  4X6A K;  5IYD C;  1TWC K;  3AH5 A;  1SMY D;  3IAY A;  3CQZ K;  5CQG A;  3L4K A;  4X6A C;  2WB1 A;  1TWC C;  5D4D A;  3CQZ C;  1YNJ D;  2Y0S D;  5M3M K;  5MLC 9;  4KAS A;  4NOM A;  3RZO K;  1O26 A;  4PAB A;  2WAQ A;  1O28 A;  3G4A A;  4YFK A;  3GTL K;  3RZO C;  1F7V A;  3ORE A;  1WSR A;  1J6V A;  3SZY A;  3HOZ C;  3GTL C;  3HKZ D;  1IW7 D;  3DU6 A;  4A3D C;  4GTD A;  2NVQ K;  4C3J K;  4MEY A;  4BLB A;  2NVQ C;  3RZD K;  5C44 K;  4A3L K;  4QIW A;  4C3J C;  1B4B A;  3RZD C;  5C44 C;  4D3Z A;  4A3L C;  1INN A;  4KC6 A;  1EH1 A;  4NOL A;  4KB2 A;  1TWG K;  3ERE D;  1A35 A;  2Y0S L;  1SFO A;  1PJ5 A;  1EK8 A;  1O2F B;  4KMD A;  2GAH C;  4FZB A;  1TWG C;  4A3J K;  4BBR K;  4A3J C;  1ZYR A;  4GFQ A;  4YG2 A;  4BBR C;  3HKZ L;  1O2A A;  1MIU A;  2YU9 K;  4WIL A;  4LJZ A;  4C2M A;  1TWA A;  4AH6 A;  4A3K K;  2YU9 C;  5TMF A;  2JA6 A;  2PA8 L;  3GTP A;  4A3C K;  4A3K C;  4PAA A;  3AD8 C;  2KWA A;  1I6V A;  3HOU K;  2R4G A;  3M3Y K;  4A93 K;  4BXX K;  1ISE A;  4OIR A;  3HOU C;  1I50 A;  3M3Y C;  4KAT A;  4A93 C;  4ILD A;  4BXX C;  3GSI A;  3AD9 C;  5IP7 C;  3OEP A;  4KMA A;  3M4A A;  3PO2 K;  3KYL A;  4IP8 A;  2O5I A;  4A3E K;  3PO2 C;  1O29 A;  1SFO K;  4KN7 A;  1VH2 A;  4A3E C;  1SFO C;  3N0B A;  4AHC A;  1TL8 A;  1TWF K;  1L0W A;  3JST A;  1RU0 A;  5IYC K;  1TWF C;  1LPQ A;  3S16 C;  4NOK A;  2BE5 A;  3G4C A;  5IYC C;  4MEX A;  3GTO A;  5EGE A;  1SEU A;  1ZQ1 C;  1VJE A;  4GTB A;  1J6W A;  4C2M K;  3GEH A;  1TWA K;  2A6H A;  1Y1W A;  4P9S A;  4C2M C;  1TWA C;  3GTP K;  4OIO A;  1F9N A;  4C3H C;  1AB4 A;  2E2J K;  3SJR A;  2JA6 C;  2ZFZ A;  3GTP C;  4FYD A;  4Y52 K;  3T01 A;  3S1M K;  1TWH K;  4G7Z A;  2Y3P A;  5E68 A;  1I50 C;  1TWH C;  3HOV K;  2V6T A;  4J3N A;  1VGX A;  1R49 A;  1A31 A;  5C4J C;  1USO A;  3HOV C;  2XCO A;  5IYB K;  1SMY A;  1WOO A;  4AN8 A;  4AYB D;  4QJV A;  4XSZ A;  5IYB C;  3GTJ A;  2PHC B;  1JOE A;  1YNJ A;  4MQ9 A;  1T8I A;  5L46 A;  2Y0S A;  4KMU A;  3FOE A;  3GTG A;  1O2B A;  4A3B K;  4P5B A;  3GTO K;  1V5V A;  3T02 A;  3HOZ K;  4A3B C;  4G0W A;  1C0A A;  2A69 D;  3HKZ A;  1IW7 A;  3GTO C;  4KDD A;  3HOX K;  2JH3 A;  5IOR A;  3S2D K;  4A3D K;  2E2I K;  3GTM A;  1Y1W K;  2EBB A;  3S2D C;  3HOX C;  5JFE A;  2E2I C;  1Y1W C;  3GTQ K;  3S15 K;  2R92 K;  1ZVU A;  2O5J D;  1WQG A;  3S1Q K;  4AYB L;  2D6F C;  1WCM A;  3GTQ C;  3S15 C;  3WVO A;  2R92 C;  3S14 K;  3S1Q C;  2PA8 D;  4OYD B;  3S14 C;  1R5Z A;  2CFA B;  5CJ9 A;  3K5O A;  2P8T A;  2B63 A;  4JK1 A;  2NVT K;  5TJ3 A;  4BY1 K;  1KQ4 A;  2A6E D;  2NVT C;  4BY1 C;  3AD7 C;  1IBA A;  3L4J A;  5TMC A;  4XSX A;  2CW0 D;  4QJV B;  3I4M K;  4OIQ A;  3QX3 A;  3GTG K;  3I4M C;  1K4S A;  4O26 A;  5M5W K;  1WOR A;  3GTG C;  4GTE A;  5IOQ A;  4FM9 A;  5C3E K;  3GTM K;  1WOS A;  3WOD A;  1O25 A;  5C3E C;  3K5L A;  4O2D A;  3GTM C;  1YNN D;  1I6H K;  5IP7 K;  1DCO A;  3H3V L;  3VA7 A;  5IOT A;  1WCM K;  1I6H C;  4RMF A;  1RR8 C;  4WJ3 M;  4GTA A;  2ZUF A;  4LQY A;  1WCM C;  3GTK A;  1EFW A;  3Q3Q A;  3T00 A;  5C9H A;  3H0G A;  3S0X A;  3HOW K;  1BGW A;  4GT9 A;  1Y69 8;  1IQ0 A;  5EGH A;  2B63 K;  3HOW C;  4LK0 A;  4H3T A;  5IOS A;  4A3G C;  3S16 K;  1YX2 A;  3DXJ A;  2B63 C;  1K4T A;  1WQF A;  1Q8I A;  3IPJ A;  3MML B;  4BBS K;  4LOW A;  1IL2 A;  4LK1 A;  5JVO A;  5JSN B;  4BBS C;  1I3Q A;  3I4N K;  1XXA A;  4NOI A;  3MAQ A;  1PJ6 A;  2VUM A;  4C3H K;  3BUE A;  3I4N C;  1ZBS A;  2JA6 K;  1JVI A;  1ZXO A;  3FOF A;  2GSO A;  1XXC A;  3HOY C;  2R93 A;  2PMZ D;  3K57 A;  2CFA A;  2E2H A;  1I50 K;  3K7A K;  1WOP A;  2V6U A;  3N0C A;  4KM9 A;  5C4J K;  4LR2 A;  2A68 D;  3K7A C;  3GTL A;  4ZH4 A;  4Q5S A;  1EQR A;  3LF9 A;  4KB4 A;  4AYB A;  1BJT A;  3H0G K;  2R7Z A;  3TFJ A;  3H0G C;  4Q4Z A;  1DCH A;  2NVY A;  3N3Y A;  1F93 A;  3OPF A;  5C4X K;  4LLG A;  5C4X C;  2PMZ L;  1HQM D;  5M5Y K;  2A69 A;  1TWG A;  1RRJ A;  1J6X A;  2ZUE A;  4C45 A;  1I3Q K;  1R9T A;  1DCP A;  2VUM K;  2GAG C;  4G0V A;  1G51 A;  1I3Q C;  4A3M K;  1VLO A;  3LAJ A;  4GZY A;  2VUM C;  2FQT A;  4A3I C;  2O5J A;  4A3M C;  2JA8 K;  1XZP B;  4DDQ A;  2R93 K;  1X31 C;  4XLP A;  2WB1 D;  2E2H K;  2JA8 C;  3P9A A;  1IE0 A;  2R93 C;  2YU9 A;  3FHZ A;  2E2H C;  3K59 A;  4F3E A;  2WAQ D;  4Y7N K;  1SC7 A;  5M5X K;  1EI6 A;  4KAR A;  1XPP A;  5FLM K;  3H3V D;  2JA5 A;  2GSN A;  4Y7N C;  2R7Z K;  2A6E A;  1XZQ B;  5IP9 K;  3LPX A;  1B4A A;  2XCQ A;  5FLM C;  1BS2 A;  3GTJ K;  3M4O K;  2R7Z C;  3V4G A;  2W7V A;  2CW0 A;  5IP9 C;  1EJ9 A;  2FQO A;  2NVY K;  3M4O C;  3S2H K;  3GTJ C;  3AQP A;  3TFH A;  4QIW D;  3S1R K;  2NVY C;  3S17 K;  4QCL A;  3S2H C;  3A8I A;  2XCR B;  1HI9 A;  3S1R C;  2WB1 L;  3S17 C;  1J98 A;  1JQW A;  1WIH A;  1R9T K;  2JA7 A;  4XCH A;  1TWF A;  1R9T C;  1K83 A;  1UV7 A;  1YNN A;  2WAQ L;  1YCL A;  4D3Y A;  4FXD A;  3TTG A;  2B9S B;  1NH3 A;  1ZYR D;  3A8J A;  1DD5 A;  3S1N K;  3LHP S;  1Y1V A;  3TFI A;  3S1N C;  2RGR A;  1IS1 A;  3FKI A;  4P5A A;  3GIR A;  3A8K A;  4Q5V A;  4Q5G A;  4QIW L;  2PPB A;  4GTL A;  4KN4 A;  4A3G K;  2JA5 K;  4GTF A;  3LAP A;  5M3F K;  4OIN A;  1I6V D;  4A3C C;  2NVX A;  4L8I A;  1PJ7 A;  3HXA A;  1TWH A;  2JA5 C;  4JLR C;  4A3F K;  5JSB B;  2F4Q A;  3BP8 C;  4A3F C;  3K5N A;  3AQO A;  4BY7 K;  1XZP A;  1USM A;  3PO3 K;  1XXB A;  4YFX A;  4G7O A;  1O24 A;  4G0U A;  3HOY K;  4KMH A;  2V6S A;  2JA7 K;  1TWC A;  4BY7 C;  3CQZ A;  2PMZ A;  4XLN A;  3PO3 C;  4C3I K;  1K83 K;  2JA7 C;  4EJ3 A;  4YFN A;  4C3I C;  4G7H A;  1K83 C;  2A68 A;  3GEI A;  1WSV A;  1Y1V K; 
#chains in the Genus database with same CATH homology
 1R9T A;  3CAG A;  4GTC A;  5TJ3 A;  2BE5 D;  4BKW A;  1KQ4 A;  4ILD A;  4LMO A;  2GSU A;  2A6E D;  4G0V A;  3OEP A;  3LAJ A;  2E2I A;  3M4A A;  4KMA A;  3L4J A;  3K58 A;  3KYL A;  4KAW X;  1O27 A;  2RH6 A;  2CW0 D;  4IP8 A;  2A6H D;  4BLA A;  4DDQ A;  3QX3 A;  1O29 A;  3GTQ A;  2R92 A;  1K4S A;  4O26 A;  3P9A A;  2YU9 A;  4GTE A;  5IOQ A;  3FHZ A;  1TGO A;  4FM9 A;  3N0B A;  4AHC A;  1TL8 A;  3K59 A;  2P5M A;  3K5M A;  4F3E A;  1O25 A;  5CHP A;  1SC7 A;  3K5L A;  1WQH A;  1LPQ A;  4IP9 A;  4NOK A;  1A36 A;  4KAR A;  3DU5 A;  1YNN D;  4FGU A;  3G4C A;  2JA5 A;  2GSN A;  3GTO A;  1GE9 A;  4KM8 A;  3NUH A;  5EGE A;  1SEU A;  3VA7 A;  4M1X A;  3LPX A;  5IOT A;  1B4A A;  2XCQ A;  4GTB A;  1V9M A;  3V4G A;  1RR8 C;  3AH5 A;  4GTA A;  1SMY D;  1EJ9 A;  3IAY A;  4LQY A;  5CQG A;  1Y1W A;  3GTK A;  3AQP A;  4C2M C;  3L4K A;  2WB1 A;  3Q3Q A;  5C9H A;  1F9N A;  1YNJ D;  3H0G A;  4QCL A;  1AB4 A;  3SJR A;  4C3H C;  3S0X A;  1BGW A;  2ZFZ A;  2XCR B;  4GT9 A;  5MLC 9;  4FYD A;  4KAS A;  1Y69 8;  4NOM A;  5EGH A;  1O26 A;  1WIH A;  4H3T A;  2JA7 A;  2WAQ A;  5IOS A;  2Y3P A;  1O28 A;  3G4A A;  1K4T A;  1TWF A;  4J3N A;  1K83 A;  1WQF A;  3ORE A;  1R49 A;  1Q8I A;  1A31 A;  1IW7 D;  4D3Y A;  3DU6 A;  4FXD A;  3MML B;  2B9S B;  2XCO A;  1NH3 A;  1ZYR D;  1DD5 A;  4GTD A;  3LHP S;  5JVO A;  5JSN B;  1Y1V A;  1I3Q A;  4AN8 A;  4BLB A;  1XXA A;  3MAQ A;  2RGR A;  2VUM A;  4QIW A;  1IS1 A;  3GTJ A;  2PHC B;  1B4B A;  3BUE A;  3FKI A;  1ZBS A;  1T8I A;  4C3J C;  4P5A A;  4D3Z A;  1ZXO A;  2Y0S A;  4Q5G A;  4Q5V A;  2GSO A;  3FOF A;  3FOE A;  1XXC A;  4GTL A;  2R93 A;  1EH1 A;  4NOL A;  3GTG A;  3K57 A;  4KB2 A;  1O2B A;  2CFA A;  1A35 A;  3ERE D;  1SFO A;  2E2H A;  4GTF A;  1EK8 A;  4P5B A;  3LAP A;  1I6V D;  4KMD A;  4FZB A;  2NVX A;  4L8I A;  3N0C A;  4KM9 A;  4G0W A;  2A69 D;  1TWH A;  4LR2 A;  2A68 D;  4JLR C;  3HKZ A;  4KDD A;  2JH3 A;  5IOR A;  5JSB B;  4GFQ A;  3GTL A;  3GTM A;  2F4Q A;  3LF9 A;  3K5N A;  3AQO A;  4KB4 A;  1O2A A;  5JFE A;  4AYB A;  1BJT A;  1MIU A;  2R7Z A;  1ZVU A;  2O5J D;  1WQG A;  1WCM A;  1XXB A;  3WVO A;  1O24 A;  4G0U A;  4C2M A;  4KMH A;  1TWA A;  1TWC A;  2NVY A;  3N3Y A;  3CQZ A;  4OYD B;  2PMZ A;  3OPF A;  2JA6 A;  3GTP A;  4EJ3 A;  1R5Z A;  2CFA B;  2KWA A;  5CJ9 A;  1ISE A;  2R4G A;  3K5O A;  4C3I C;  1HQM D;  1TWG A;  2B63 A;  4KC6 A;  1RRJ A;  1I50 A;  4KAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...