1EK8A

Crystal structure of the ribosome recycling factor (rrf) from escherichia coli
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
185
Chain Sequence
MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME RECYCLING FACTOR
publication title Crystal structure of the ribosome recycling factor from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
total genus 60
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2000-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1ek8A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1ek8A02
3L4KA 4GFQA 5JSBB 1DD5A 1F9NA 1EH1A 3FOEA 2Y3PA 4KC6A 4G0WA 1B4BA 2KWAA 3LPXA 3LAPA 3OPFA 4G0VA 3NUHA 1XXAA 3FOFA 5MLC9 2XCRB 1WQHA 4DDQA 3L4JA 2XCQA 1BJTA 3CAGA 2XCOA 1IS1A 5JVOA 5JSNB 3LAJA 1WQGA 1EK8A 4G0UA 1AB4A 1Y698 1B4AA 1ISEA 1XXBA 4OYDB 3ERED 2RGRA 1WQFA 1WIHA 4KB2A 1XXCA 3LF9A 2P5MA 2PHCB 1BGWA 3VA7A 4L8IA 5CJ9A 3OEPA 1ZVUA 3MMLB 3QX3A 1GE9A 4FM9A 2ZFZA 3V4GA 3OREA 3FHZA 4KB4A 3LHPS 4JLRC 4KAWX 3BUEA 4J3NA 4KDDA
chains in the Genus database with same CATH superfamily
4FZBA 1WOOA 4AYBL 2V6SA 1VJEA 4ILDA 3LAJA 1IE0A 1TWGC 2PMZD 2P5MA 3GTGC 2PA8D 3I4MC 4P5BA 2A68D 5HL8A 3K5MA 3PO2C 5TMFA 3MMLB 2EBBA 1TWFA 4A3BK 2GSOA 2NVQC 4LMOA 3H3VL 4MEXA 1LPQA 3BUEA 4GZYA 5FLMC 1WCMA 3L4KA 1I6HK 4GTEA 4GTBA 1TWHK 2B63K 1ZQ1C 4MEYA 2KWAA 4G7ZA 1DCOA 3M3YK 5CHPA 3S1QK 4C3HK 1ZYRA 3CQZA 1ISEA 4Y7NC 1EJ9A 3BP3A 4XLNA 4AN8A 4L8IA 1R49A 5IYCK 5IP7K 2D6FC 3S0XA 1I50A 1TWGK 4BY1C 3HOVC 2A6HD 1R9TA 3PO3C 3I4MK 2Y0SL 3K58A 3PO2K 2Y0SA 4KMUA 4G0VA 5M5XK 3AQOA 1BS2A 2FQTA 4A3MC 1WQGA 1YCLA 4LLGA 3S16C 3CQZC 4AYBD 5FLMK 3T00A 1PJ7A 3M4OC 3N3YA 4LQYA 2E2IA 2CW0A 3N0CA 3QX3A 3T02A 4KM9A 4FXDA 1G51A 1USMA 4AHCA 1I50C 4WJ3M 3GEHA 3SZZA 4J3NA 4Y7NK 2ZUFA 2FQOA 2O5IA 1R5ZA 1WSRA 4YFXA 3S15C 3S17C 4KC6A 3H3VD 1HQMA 1WOSA 3A8IA 5IYDK 4WILA 4C3JK 4Y52C 2A6EA 1O2AA 4OIPA 3SJRA 2CFAA 3S14K 3PO3K 3GTOA 2B63A 1J6VA 3GIRA 2E2IC 2R92C 2WB1L 1HI9A 3AD9C 3OREA 4A3MK 4KAWX 3S16K 3CQZK 5IOSA 5IYBK 3K59A 2A69D 4KDDA 3S1RC 5E68A 3M4OK 1I3QA 2NVXK 4QJVA 5M5YK 3AD8C 3L4JA 4G7HA 1BJTA 2W7VA 2ZUEA 4KMAA 4A3BC 4XSZA 1I50K 4YFNA 1Y698 3HOYK 1IW7D 1YNNA 4A3LK 5IOTA 2GAGC 3TFIA 1TWAC 3S17K 3KYLA 1SC7A 1RR8C 3GTLA 3GTOC 2B63C 4MQ9A 3HXAA 3M3YC 1DCHA 1Y1WA 3IAYA 5M3FK 4BLAA 4Y52K 4QCLA 4G0UA 4BLBA 3GTPK 1I3QC 2E2IK 1K4SA 4GTDA 4KARA 1X31C 5IYCC 2R92K 5IP7C 1O24A 3RZOC 5IP9C 1HQMD 5EGEA 4IP9A 3G4AA 1PJ6A 4X6AC 3S1RK 4C2MK 3S1MC 1C0AA 2A6ED 1IBAA 2JA6A 3M4AA 3WODA 3GTLC 1I6VD 5C4XK 1J98A 1Y1WC 4EJ3A 4A3EC 2O5JD 2WB1D 4WJ4A 1TWAK 4D3ZA 1XZPA 3TFHA 3GTOK 2JA5K 1IQ0A 4C45A 3FOFA 4OIOA 1WQHA 4PABA 4NOIA 1IS1A 4KN7A 5C3EK 3GDZA 3AD7C 1VRQC 5M5WK 3H0GA 1BGWA 4Q5GA 2JA6C 5C9HA 1I3QK 4YG2A 4D3YA 1YNND 3MAQA 2NVXA 4QIWL 5M3MK 4FYDA 4QIWA 1KQ4A 3RZOK 3N0BA 5IP9K 5IYDC 3I4NC 3GTKC 4C3JC 2CFAB 4X6AK 3HOZK 3TFJA 1MIUA 3HKZL 3S1MK 5C44K 3S14C 3HKZA 2JA8C 3GTLK 3G4CA 2XCRB 1Y1WK 4A3EK 1XXBA 1B4AA 5IYBC 4KMHA 2PHCB 4P9SA 4RMFA 3P9AA 3GTPA 2GSNA 3H0GC 4QJVB 2NVTK 1ZVUA 1J6WA 2NVXC 2R92A 3FKIK 4KASA 2PPBA 3GTQK 4BY7C 1USOA 4A3DK 5FJ8K 2WAQA 3HOYC 5JSBB 1F9NA 1VLOA 3Q3QA 4C2MA 4A3LC 4G0WA 2JA6K 3OPFA 4A3JC 3S1NC 1XXAA 4FGUA 1RRJA 1TWCK 2BE5A 2E2JK 1EQRA 4BXXK 1INNA 5JVOA 4XLPA 2JA7A 3HOXK 3I4NK 3GTKK 4IP8A 4A3IC 3AH5A 3ERED 2JH3A 4KB2A 3IPJA 1TWAA 2JA8K 3GTPC 1ZYRD 4NOMA 4YFKA 2JA5A 4LK0A 3GEIA 1GE9A 2ZFZA 4KN4A 2R93A 1XZQB 1O27A 4QIWD 1Y1VC 4C2MC 3H0GK 3SZYA 4A3KK 4BKWA 3K57A 3LAPA 3HOUK 1O26A 3HOWK 4BBRC 3CAGA 2R4GA 5C4XC 1EFWA 2A68A 4BY7K 1TGOA 2JA7C 3DXJA 4LJZA 1EK8A 2Y0SD 4OYDB 1L0WA 1K83A 2GAHC 4Q5SA 3GSIA 1XZPB 4GT9A 3DU5A 4GTLA 4A3JK 3S1NK 2JA5C 1O25A 2R93C 1WORA 2E2HA 1SMYA 4A3IK 2CW0D 2NVYA 5C3EC 4A3CC 3BP8C 3GTMK 4XSXA 3ADAC 4O26A 3FKIA 2XCOA 4JK1A 3GTQA 1J6XA 1XZQA 3A8KA 4A93C 5IOQA 1WSVA 1K83C 3HOZC 1ZXOA 1Y1VK 5C44C 2RH6A 3S2HK 2A6HA 4NOLA 4BBRK 3RZDC 1TWCA 3V4GA 5D4DA 1A31A 2JA7K 5IORA 3GTKA 2E2HC 1SFOC 2XCQA 2NVYC 4LK1A 3FOEA 2VUMK 1JVIA 3LPXA 4AYBA 5MLC9 2NVTC 1SEUA 5EGHA 2R93K 2R7ZA 3FKIC 3GTQC 3AQPA 1Q8IA 4A3DC 4A3CK 4F3EA 1RU0A 2E2JC 1VH2A 1TWCC 5TJ3A 1VGXA 3GTJA 4KB4A 1UV7A 3FHZA 4BXXC 3HOXC 1O29A 5C4JK 4KMDA 4A93K 4ZH4A 1K83K 1EH1A 1YNJA 4XCHA 2Y3PA 1SMYD 3A8JA 2YU9K 3T01A 3RZDK 1K4TA 2R7ZC 2B9SB 1AB4A 2E2HK 2V6UA 1SFOK 1F93A 2NVYK 1WIHA 1XXCA 3GTMA 3VA7A 2V6TA 3K7AC 4M1XA 4A3KC 2A69A 1TWFC 3HOUC 4KATA 3HOWC 3K5NA 1A36A 3GTJC 2WAQL 1TL8A 1NH3A 3LHPS 1WCMC 3GTGK 4OIQA 1A35A 1Y1VA 4PAAA 1B4BA 1PJ5A 3WVOA 1T8IA 1IW7A 3TTGA 4OIRA 4GTFA 2NVQK 4C3IC 3EQLA 5TMCA 3K5LA 3S2DC 4NOKA 1IL2A 4A3GC 4AH6A 3GTMC 2VUMA 1O2FB 1ZBSA 4LOWA 4O2DA 2R7ZK 4H3TA 1O28A 1R9TC 3DU6A 3JSTA 1XPPA 1O2BA 3K7AK 2PMZL 3S2HC 1TWFK 2PMZA 4A3FC 2PA8L 1YNJD 3HOVK 4BY1K 4G7OA 3HKZD 2F4QA 4LR2A 3GTJK 1F7UA 4BBSC 1BDFA 1WCMK 1I6VA 1DCPA 2RGRA 3LF9A 4Q4ZA 1TWHA 1JOEA 2VUMC 2YU9A 1V9MA 2O5JA 4FM9A 2WB1A 4C3IK 4JLRC 4OINA 3S2DK 1SFOA 4GFQA 2P8TA 4A3GK 1DD5A 1V5VA 5JFEA 1JQWA 4GTAA 4KM8A 1WOPA 2WAQD 3NUHA 3K5OA 4DDQA 1YX2A 5JSNB 1TWGA 1R9TK 2BE5D 1WQFA 3GTGA 4P5AA 5C4JC 3S15K 1I6HC 2GSUA 1TWHC 5CJ9A 3OEPA 3GEEA 3S1QC 4A3FK 5L46A 2YU9C 5CQGA 1F7VA 4GTCA 4C3HC 1EI6A 4BBSK 4Q5VA
chains in the Genus database with same CATH topology
5JSBB 1F9NA 4FZBA 1EH1A 3Q3QA 4C2MA 2Y3PA 4G0WA 1SMYD 1I3QA 3OPFA 1XXAA 4FGUA 1RRJA 3L4JA 1BJTA 4ILDA 5JVOA 2JA7A 4KMAA 3LAJA 1K4TA 2B9SB 1AB4A 4IP8A 1Y698 1IW7D 3VA7A 3AH5A 3ERED 2JH3A 1WIHA 4KB2A 1XXCA 2P5MA 5IOTA 3GTMA 3KYLA 1TWAA 4P5BA 2A68D 1SC7A 1RR8C 3GTLA 3K5MA 1ZYRD 4M1XA 4NOMA 2JA5A 3MMLB 1TWFA 1GE9A 2ZFZA 4KATA 2R93A 1Y1WA 2GSOA 3IAYA 3K5NA 1A36A 4LMOA 1O27A 4QCLA 4BLAA 1TL8A 1LPQA 1NH3A 3BUEA 4G0UA 3LHPS 4BLBA 1WCMA 3L4KA 4GTEA 4GTBA 1A35A 1Y1VA 4C2MC 4BKWA 1B4BA 2KWAA 3K57A 3LAPA 1O26A 3WVOA 1T8IA 1K4SA 4GTDA 4KARA 5CHPA 4GTFA 3CAGA 2R4GA 4C3IC 1O24A 1TGOA 3CQZA 1EK8A 1HQMD 3K59A 5EGEA 4IP9A 1ISEA 3K5LA 1EJ9A 3G4AA 4OYDB 4NOKA 1K83A 2A6ED 4AN8A 4L8IA 3DU5A 2JA6A 3M4AA 2VUMA 1R49A 4GTLA 4GT9A 1ZBSA 1I6VD 1O25A 3S0XA 4EJ3A 1I50A 4H3TA 1O28A 2E2HA 2A6HD 2CW0D 2NVYA 3DU6A 1R9TA 2O5JD 1O2BA 3K58A 4D3ZA 2Y0SA 4G0VA 3FOFA 2PMZA 1WQHA 3AQOA 4O26A 1YNJD 3FKIA 1IS1A 2XCOA 2F4QA 1WQGA 3GTQA 4LR2A 5IOQA 2RGRA 3LF9A 1ZXOA 1TWHA 3H0GA 1BGWA 3N3YA 4Q5GA 2RH6A 4LQYA 5C9HA 2E2IA 4D3YA 1YNND 4NOLA 3MAQA 2YU9A 1V9MA 2NVXA 3N0CA 3QX3A 4FM9A 1TWCA 2WB1A 4KM9A 3V4GA 4FXDA 4FYDA 4QIWA 1KQ4A 4JLRC 1A31A 3N0BA 4AHCA 5IORA 4C3JC 2CFAB 3GTKA 4J3NA 2XCQA 1SFOA 1MIUA 4GFQA 1DD5A 1R5ZA 3FOEA 3HKZA 5JFEA 4GTAA 4KM8A 4KC6A 3LPXA 4AYBA 3NUHA 5MLC9 3G4CA 2XCRB 3K5OA 4DDQA 1SEUA 5EGHA 5JSNB 2R7ZA 1TWGA 1XXBA 1B4AA 1O2AA 3AQPA 1Q8IA 3SJRA 2BE5D 2CFAA 1WQFA 3GTGA 4KMHA 4F3EA 2PHCB 4P5AA 2GSUA 3P9AA 3GTPA 3GTOA 2B63A 2GSNA 3OEPA 5CJ9A 1ZVUA 2R92A 5CQGA 4GTCA 5TJ3A 4C3HC 4KASA 3OREA 3GTJA 4KB4A 3FHZA 4KAWX 5IOSA 2WAQA 1O29A 2A69D 4Q5VA 4KMDA 4KDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4K A;  4GFQ A;  5JSB B;  1DD5 A;  1F9N A;  1EH1 A;  3FOE A;  2Y3P A;  4KC6 A;  4G0W A;  1B4B A;  2KWA A;  3LPX A;  3LAP A;  3OPF A;  4G0V A;  3NUH A;  1XXA A;  3FOF A;  5MLC 9;  2XCR B;  1WQH A;  4DDQ A;  3L4J A;  2XCQ A;  1BJT A;  3CAG A;  2XCO A;  1IS1 A;  5JVO A;  5JSN B;  3LAJ A;  1WQG A;  1EK8 A;  4G0U A;  1AB4 A;  1Y69 8;  1B4A A;  1ISE A;  1XXB A;  4OYD B;  3ERE D;  2RGR A;  1WQF A;  1WIH A;  4KB2 A;  1XXC A;  3LF9 A;  2P5M A;  2PHC B;  1BGW A;  3VA7 A;  4L8I A;  5CJ9 A;  3OEP A;  1ZVU A;  3MML B;  3QX3 A;  1GE9 A;  4FM9 A;  2ZFZ A;  3V4G A;  3ORE A;  3FHZ A;  4KB4 A;  3LHP S;  4JLR C;  4KAW X;  3BUE A;  4J3N A;  4KDD A; 
#chains in the Genus database with same CATH topology
 4FZB A;  1WOO A;  4AYB L;  2V6S A;  1VJE A;  4ILD A;  3LAJ A;  1IE0 A;  1TWG C;  2PMZ D;  2P5M A;  3GTG C;  2PA8 D;  3I4M C;  4P5B A;  2A68 D;  5HL8 A;  3K5M A;  3PO2 C;  5TMF A;  3MML B;  2EBB A;  1TWF A;  4A3B K;  2GSO A;  2NVQ C;  4LMO A;  3H3V L;  4MEX A;  1LPQ A;  3BUE A;  4GZY A;  5FLM C;  1WCM A;  3L4K A;  1I6H K;  4GTE A;  4GTB A;  1TWH K;  2B63 K;  1ZQ1 C;  4MEY A;  2KWA A;  4G7Z A;  1DCO A;  3M3Y K;  5CHP A;  3S1Q K;  4C3H K;  1ZYR A;  3CQZ A;  1ISE A;  4Y7N C;  1EJ9 A;  3BP3 A;  4XLN A;  4AN8 A;  4L8I A;  1R49 A;  5IYC K;  5IP7 K;  2D6F C;  3S0X A;  1I50 A;  1TWG K;  4BY1 C;  3HOV C;  2A6H D;  1R9T A;  3PO3 C;  3I4M K;  2Y0S L;  3K58 A;  3PO2 K;  2Y0S A;  4KMU A;  4G0V A;  5M5X K;  3AQO A;  1BS2 A;  2FQT A;  4A3M C;  1WQG A;  1YCL A;  4LLG A;  3S16 C;  3CQZ C;  4AYB D;  5FLM K;  3T00 A;  1PJ7 A;  3M4O C;  3N3Y A;  4LQY A;  2E2I A;  2CW0 A;  3N0C A;  3QX3 A;  3T02 A;  4KM9 A;  4FXD A;  1G51 A;  1USM A;  4AHC A;  1I50 C;  4WJ3 M;  3GEH A;  3SZZ A;  4J3N A;  4Y7N K;  2ZUF A;  2FQO A;  2O5I A;  1R5Z A;  1WSR A;  4YFX A;  3S15 C;  3S17 C;  4KC6 A;  3H3V D;  1HQM A;  1WOS A;  3A8I A;  5IYD K;  4WIL A;  4C3J K;  4Y52 C;  2A6E A;  1O2A A;  4OIP A;  3SJR A;  2CFA A;  3S14 K;  3PO3 K;  3GTO A;  2B63 A;  1J6V A;  3GIR A;  2E2I C;  2R92 C;  2WB1 L;  1HI9 A;  3AD9 C;  3ORE A;  4A3M K;  4KAW X;  3S16 K;  3CQZ K;  5IOS A;  5IYB K;  3K59 A;  2A69 D;  4KDD A;  3S1R C;  5E68 A;  3M4O K;  1I3Q A;  2NVX K;  4QJV A;  5M5Y K;  3AD8 C;  3L4J A;  4G7H A;  1BJT A;  2W7V A;  2ZUE A;  4KMA A;  4A3B C;  4XSZ A;  1I50 K;  4YFN A;  1Y69 8;  3HOY K;  1IW7 D;  1YNN A;  4A3L K;  5IOT A;  2GAG C;  3TFI A;  1TWA C;  3S17 K;  3KYL A;  1SC7 A;  1RR8 C;  3GTL A;  3GTO C;  2B63 C;  4MQ9 A;  3HXA A;  3M3Y C;  1DCH A;  1Y1W A;  3IAY A;  5M3F K;  4BLA A;  4Y52 K;  4QCL A;  4G0U A;  4BLB A;  3GTP K;  1I3Q C;  2E2I K;  1K4S A;  4GTD A;  4KAR A;  1X31 C;  5IYC C;  2R92 K;  5IP7 C;  1O24 A;  3RZO C;  5IP9 C;  1HQM D;  5EGE A;  4IP9 A;  3G4A A;  1PJ6 A;  4X6A C;  3S1R K;  4C2M K;  3S1M C;  1C0A A;  2A6E D;  1IBA A;  2JA6 A;  3M4A A;  3WOD A;  3GTL C;  1I6V D;  5C4X K;  1J98 A;  1Y1W C;  4EJ3 A;  4A3E C;  2O5J D;  2WB1 D;  4WJ4 A;  1TWA K;  4D3Z A;  1XZP A;  3TFH A;  3GTO K;  2JA5 K;  1IQ0 A;  4C45 A;  3FOF A;  4OIO A;  1WQH A;  4PAB A;  4NOI A;  1IS1 A;  4KN7 A;  5C3E K;  3GDZ A;  3AD7 C;  1VRQ C;  5M5W K;  3H0G A;  1BGW A;  4Q5G A;  2JA6 C;  5C9H A;  1I3Q K;  4YG2 A;  4D3Y A;  1YNN D;  3MAQ A;  2NVX A;  4QIW L;  5M3M K;  4FYD A;  4QIW A;  1KQ4 A;  3RZO K;  3N0B A;  5IP9 K;  5IYD C;  3I4N C;  3GTK C;  4C3J C;  2CFA B;  4X6A K;  3HOZ K;  3TFJ A;  1MIU A;  3HKZ L;  3S1M K;  5C44 K;  3S14 C;  3HKZ A;  2JA8 C;  3GTL K;  3G4C A;  2XCR B;  1Y1W K;  4A3E K;  1XXB A;  1B4A A;  5IYB C;  4KMH A;  2PHC B;  4P9S A;  4RMF A;  3P9A A;  3GTP A;  2GSN A;  3H0G C;  4QJV B;  2NVT K;  1ZVU A;  1J6W A;  2NVX C;  2R92 A;  3FKI K;  4KAS A;  2PPB A;  3GTQ K;  4BY7 C;  1USO A;  4A3D K;  5FJ8 K;  2WAQ A;  3HOY C;  5JSB B;  1F9N A;  1VLO A;  3Q3Q A;  4C2M A;  4A3L C;  4G0W A;  2JA6 K;  3OPF A;  4A3J C;  3S1N C;  1XXA A;  4FGU A;  1RRJ A;  1TWC K;  2BE5 A;  2E2J K;  1EQR A;  4BXX K;  1INN A;  5JVO A;  4XLP A;  2JA7 A;  3HOX K;  3I4N K;  3GTK K;  4IP8 A;  4A3I C;  3AH5 A;  3ERE D;  2JH3 A;  4KB2 A;  3IPJ A;  1TWA A;  2JA8 K;  3GTP C;  1ZYR D;  4NOM A;  4YFK A;  2JA5 A;  4LK0 A;  3GEI A;  1GE9 A;  2ZFZ A;  4KN4 A;  2R93 A;  1XZQ B;  1O27 A;  4QIW D;  1Y1V C;  4C2M C;  3H0G K;  3SZY A;  4A3K K;  4BKW A;  3K57 A;  3LAP A;  3HOU K;  1O26 A;  3HOW K;  4BBR C;  3CAG A;  2R4G A;  5C4X C;  1EFW A;  2A68 A;  4BY7 K;  1TGO A;  2JA7 C;  3DXJ A;  4LJZ A;  1EK8 A;  2Y0S D;  4OYD B;  1L0W A;  1K83 A;  2GAH C;  4Q5S A;  3GSI A;  1XZP B;  4GT9 A;  3DU5 A;  4GTL A;  4A3J K;  3S1N K;  2JA5 C;  1O25 A;  2R93 C;  1WOR A;  2E2H A;  1SMY A;  4A3I K;  2CW0 D;  2NVY A;  5C3E C;  4A3C C;  3BP8 C;  3GTM K;  4XSX A;  3ADA C;  4O26 A;  3FKI A;  2XCO A;  4JK1 A;  3GTQ A;  1J6X A;  1XZQ A;  3A8K A;  4A93 C;  5IOQ A;  1WSV A;  1K83 C;  3HOZ C;  1ZXO A;  1Y1V K;  5C44 C;  2RH6 A;  3S2H K;  2A6H A;  4NOL A;  4BBR K;  3RZD C;  1TWC A;  3V4G A;  5D4D A;  1A31 A;  2JA7 K;  5IOR A;  3GTK A;  2E2H C;  1SFO C;  2XCQ A;  2NVY C;  4LK1 A;  3FOE A;  2VUM K;  1JVI A;  3LPX A;  4AYB A;  5MLC 9;  2NVT C;  1SEU A;  5EGH A;  2R93 K;  2R7Z A;  3FKI C;  3GTQ C;  3AQP A;  1Q8I A;  4A3D C;  4A3C K;  4F3E A;  1RU0 A;  2E2J C;  1VH2 A;  1TWC C;  5TJ3 A;  1VGX A;  3GTJ A;  4KB4 A;  1UV7 A;  3FHZ A;  4BXX C;  3HOX C;  1O29 A;  5C4J K;  4KMD A;  4A93 K;  4ZH4 A;  1K83 K;  1EH1 A;  1YNJ A;  4XCH A;  2Y3P A;  1SMY D;  3A8J A;  2YU9 K;  3T01 A;  3RZD K;  1K4T A;  2R7Z C;  2B9S B;  1AB4 A;  2E2H K;  2V6U A;  1SFO K;  1F93 A;  2NVY K;  1WIH A;  1XXC A;  3GTM A;  3VA7 A;  2V6T A;  3K7A C;  4M1X A;  4A3K C;  2A69 A;  1TWF C;  3HOU C;  4KAT A;  3HOW C;  3K5N A;  1A36 A;  3GTJ C;  2WAQ L;  1TL8 A;  1NH3 A;  3LHP S;  1WCM C;  3GTG K;  4OIQ A;  1A35 A;  1Y1V A;  4PAA A;  1B4B A;  1PJ5 A;  3WVO A;  1T8I A;  1IW7 A;  3TTG A;  4OIR A;  4GTF A;  2NVQ K;  4C3I C;  3EQL A;  5TMC A;  3K5L A;  3S2D C;  4NOK A;  1IL2 A;  4A3G C;  4AH6 A;  3GTM C;  2VUM A;  1O2F B;  1ZBS A;  4LOW A;  4O2D A;  2R7Z K;  4H3T A;  1O28 A;  1R9T C;  3DU6 A;  3JST A;  1XPP A;  1O2B A;  3K7A K;  2PMZ L;  3S2H C;  1TWF K;  2PMZ A;  4A3F C;  2PA8 L;  1YNJ D;  3HOV K;  4BY1 K;  4G7O A;  3HKZ D;  2F4Q A;  4LR2 A;  3GTJ K;  1F7U A;  4BBS C;  1BDF A;  1WCM K;  1I6V A;  1DCP A;  2RGR A;  3LF9 A;  4Q4Z A;  1TWH A;  1JOE A;  2VUM C;  2YU9 A;  1V9M A;  2O5J A;  4FM9 A;  2WB1 A;  4C3I K;  4JLR C;  4OIN A;  3S2D K;  1SFO A;  4GFQ A;  2P8T A;  4A3G K;  1DD5 A;  1V5V A;  5JFE A;  1JQW A;  4GTA A;  4KM8 A;  1WOP A;  2WAQ D;  3NUH A;  3K5O A;  4DDQ A;  1YX2 A;  5JSN B;  1TWG A;  1R9T K;  2BE5 D;  1WQF A;  3GTG A;  4P5A A;  5C4J C;  3S15 K;  1I6H C;  2GSU A;  1TWH C;  5CJ9 A;  3OEP A;  3GEE A;  3S1Q C;  4A3F K;  5L46 A;  2YU9 C;  5CQG A;  1F7V A;  4GTC A;  4C3H C;  1EI6 A;  4BBS K;  4Q5V A; 
#chains in the Genus database with same CATH homology
 5JSB B;  1F9N A;  4FZB A;  1EH1 A;  3Q3Q A;  4C2M A;  2Y3P A;  4G0W A;  1SMY D;  1I3Q A;  3OPF A;  1XXA A;  4FGU A;  1RRJ A;  3L4J A;  1BJT A;  4ILD A;  5JVO A;  2JA7 A;  4KMA A;  3LAJ A;  1K4T A;  2B9S B;  1AB4 A;  4IP8 A;  1Y69 8;  1IW7 D;  3VA7 A;  3AH5 A;  3ERE D;  2JH3 A;  1WIH A;  4KB2 A;  1XXC A;  2P5M A;  5IOT A;  3GTM A;  3KYL A;  1TWA A;  4P5B A;  2A68 D;  1SC7 A;  1RR8 C;  3GTL A;  3K5M A;  1ZYR D;  4M1X A;  4NOM A;  2JA5 A;  3MML B;  1TWF A;  1GE9 A;  2ZFZ A;  4KAT A;  2R93 A;  1Y1W A;  2GSO A;  3IAY A;  3K5N A;  1A36 A;  4LMO A;  1O27 A;  4QCL A;  4BLA A;  1TL8 A;  1LPQ A;  1NH3 A;  3BUE A;  4G0U A;  3LHP S;  4BLB A;  1WCM A;  3L4K A;  4GTE A;  4GTB A;  1A35 A;  1Y1V A;  4C2M C;  4BKW A;  1B4B A;  2KWA A;  3K57 A;  3LAP A;  1O26 A;  3WVO A;  1T8I A;  1K4S A;  4GTD A;  4KAR A;  5CHP A;  4GTF A;  3CAG A;  2R4G A;  4C3I C;  1O24 A;  1TGO A;  3CQZ A;  1EK8 A;  1HQM D;  3K59 A;  5EGE A;  4IP9 A;  1ISE A;  3K5L A;  1EJ9 A;  3G4A A;  4OYD B;  4NOK A;  1K83 A;  2A6E D;  4AN8 A;  4L8I A;  3DU5 A;  2JA6 A;  3M4A A;  2VUM A;  1R49 A;  4GTL A;  4GT9 A;  1ZBS A;  1I6V D;  1O25 A;  3S0X A;  4EJ3 A;  1I50 A;  4H3T A;  1O28 A;  2E2H A;  2A6H D;  2CW0 D;  2NVY A;  3DU6 A;  1R9T A;  2O5J D;  1O2B A;  3K58 A;  4D3Z A;  2Y0S A;  4G0V A;  3FOF A;  2PMZ A;  1WQH A;  3AQO A;  4O26 A;  1YNJ D;  3FKI A;  1IS1 A;  2XCO A;  2F4Q A;  1WQG A;  3GTQ A;  4LR2 A;  5IOQ A;  2RGR A;  3LF9 A;  1ZXO A;  1TWH A;  3H0G A;  1BGW A;  3N3Y A;  4Q5G A;  2RH6 A;  4LQY A;  5C9H A;  2E2I A;  4D3Y A;  1YNN D;  4NOL A;  3MAQ A;  2YU9 A;  1V9M A;  2NVX A;  3N0C A;  3QX3 A;  4FM9 A;  1TWC A;  2WB1 A;  4KM9 A;  3V4G A;  4FXD A;  4FYD A;  4QIW A;  1KQ4 A;  4JLR C;  1A31 A;  3N0B A;  4AHC A;  5IOR A;  4C3J C;  2CFA B;  3GTK A;  4J3N A;  2XCQ A;  1SFO A;  1MIU A;  4GFQ A;  1DD5 A;  1R5Z A;  3FOE A;  3HKZ A;  5JFE A;  4GTA A;  4KM8 A;  4KC6 A;  3LPX A;  4AYB A;  3NUH A;  5MLC 9;  3G4C A;  2XCR B;  3K5O A;  4DDQ A;  1SEU A;  5EGH A;  5JSN B;  2R7Z A;  1TWG A;  1XXB A;  1B4A A;  1O2A A;  3AQP A;  1Q8I A;  3SJR A;  2BE5 D;  2CFA A;  1WQF A;  3GTG A;  4KMH A;  4F3E A;  2PHC B;  4P5A A;  2GSU A;  3P9A A;  3GTP A;  3GTO A;  2B63 A;  2GSN A;  3OEP A;  5CJ9 A;  1ZVU A;  2R92 A;  5CQG A;  4GTC A;  5TJ3 A;  4C3H C;  4KAS A;  3ORE A;  3GTJ A;  4KB4 A;  3FHZ A;  4KAW X;  5IOS A;  2WAQ A;  1O29 A;  2A69 D;  4Q5V A;  4KMD A;  4KDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...