1EK8A

Crystal structure of the ribosome recycling factor (rrf) from escherichia coli
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
185
Chain Sequence
MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME RECYCLING FACTOR
publication title Crystal structure of the ribosome recycling factor from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
total genus 60
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2000-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1ek8A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1ek8A02
4G0UA 1XXCA 5JVOA 1WQHA 3NUHA 1XXAA 5JSBB 2KWAA 3FHZA 1ZVUA 1WIHA 1BGWA 3OEPA 4OYDB 1IS1A 3QX3A 3LF9A 3LHPS 1F9NA 2XCRB 2Y3PA 3FOEA 2XCQA 3MMLB 3V4GA 4KB2A 2P5MA 3VA7A 1Y698 1B4BA 1XXBA 3FOFA 4GFQA 3L4JA 5MLC9 3LPXA 4KC6A 4KDDA 3CAGA 3OPFA 3L4KA 1EK8A 2PHCB 2XCOA 3LAJA 3ERED 1GE9A 1ISEA 1WQGA 4JLRC 2ZFZA 4DDQA 1WQFA 1DD5A 5JSNB 1AB4A 4J3NA 4KAWX 4L8IA 4FM9A 2RGRA 4G0WA 5CJ9A 1EH1A 4KB4A 3BUEA 1B4AA 1BJTA 3LAPA 4G0VA 3OREA
chains in the Genus database with same CATH superfamily
4XSZA 4BBSC 4A3BC 4A3JC 5IYCK 4GTDA 4KN7A 2R7ZC 1DCOA 1EQRA 5C4XK 2R92C 2B63K 4GFQA 3L4JA 1USMA 1EK8A 2F4QA 1T8IA 4F3EA 3BUEA 4MEXA 3S15K 4BY7K 3HOWC 3K59A 3N0BA 3M3YC 4C2MK 3NUHA 2Y0SD 2O5JD 2KWAA 2JA7C 2WB1D 4LK1A 3GTOK 3FOEA 1HQMD 1Y1WC 3V4GA 1XXBA 3I4MC 2V6UA 4C2MA 4KMDA 2NVYK 5IP7C 1HI9A 4KAWX 3GTLK 3GTOA 4KMHA 4KASA 4A3LC 1K83K 2V6SA 1J6XA 1XZPB 4QIWD 4YFKA 3HOXC 3I4NC 3S1MK 5JSBB 1XZPA 2E2IK 4C3HK 2NVYA 4X6AK 2R4GA 1YX2A 3GTLA 3P9AA 3HOUC 4A3IC 2R93A 5MLC9 3LPXA 3PO3K 3CQZK 1I6VA 1O2BA 4Q5VA 4FZBA 2FQTA 2ZUEA 1B4AA 1TWCC 3KYLA 4G0UA 1WQHA 3S1QK 4BXXC 4Y7NC 3HOZK 2RH6A 3CQZA 4NOMA 2JA5C 3HOVK 3LF9A 4AN8A 3BP3A 3HOVC 4A3GC 1LPQA 3GTQC 4BBSK 4G7ZA 1C0AA 4Y52K 4A3JK 1TWFA 4KC6A 1RU0A 2R7ZK 2O5IA 3GTMC 1NH3A 2W7VA 2R92K 4NOLA 5EGEA 2VUMK 2P8TA 1O2FB 3TFJA 2RGRA 4G7OA 2FQOA 4G0VA 2PMZL 3S16C 3HKZA 1IBAA 3EQLA 3PO2K 2V6TA 4EJ3A 2R7ZA 2GSNA 1I6VD 1XPPA 2NVQK 1UV7A 1VLOA 2R92A 2A68A 2VUMA 1TWHK 1YNJA 4ILDA 2JA7K 3GEEA 4A3FC 3S17K 4Q4ZA 4C3JC 1Y1WK 5CQGA 3ERED 1SFOC 1YNNA 4IP8A 4G0WA 3I4MK 2Y0SL 5IP7K 1TWHA 3AH5A 4KM8A 2WB1L 3GTPC 4H3TA 4M1XA 3GIRA 4A3LK 2A6HA 3AD8C 2E2JC 4KMUA 3I4NK 2CW0A 3GEHA 4YG2A 3HKZD 1I3QK 1J6WA 3N3YA 1TL8A 1I50C 4Q5GA 1V5VA 2NVXK 1BS2A 4LOWA 3RZDC 3GTGK 3H3VD 1I6HK 4A3IK 1TWAK 5E68A 4JLRC 5JVOA 4QIWL 2A68D 2JA6C 1YNJD 4LMOA 5IYBC 3M4OC 1I3QA 2B63A 4A3DC 4OIRA 2NVXA 1TWCK 3GTGA 2PA8L 4D3YA 1TWAA 1YNND 5M3MK 5C3EC 1TGOA 1YCLA 2XCRB 2Y3PA 4Y7NK 1JVIA 4GTFA 4GTAA 3VA7A 1R9TC 4C3IK 4A3EC 4BLAA 1O28A 4A3GK 2A6HD 1TWCA 3T00A 3AQOA 3DU5A 1WSVA 1VGXA 4WJ3M 1Q8IA 1Y1VC 4A3CC 2B9SB 3S0XA 1O25A 3S16K 1O29A 3T02A 1BDFA 1IS1A 3A8KA 1O24A 2YU9K 3S1NC 3H0GC 4OIPA 1X31C 3K57A 1K83A 1WCMK 5D4DA 2ZUFA 2XCOA 3FKIC 3K5NA 2E2IA 4FM9A 4GTEA 2YU9A 4A3FK 1K4SA 4KN4A 4C3JK 1EH1A 3N0CA 1BJTA 1IE0A 3Q3QA 3S2HK 5FJ8K 3HXAA 3RZOC 3GTJK 4MEYA 4FXDA 1WCMA 1G51A 5C4JC 3GTKC 1J6VA 3OEPA 1R49A 2JA8K 3BP8C 5M5WK 2BE5A 1XZQB 4LJZA 3LHPS 3GTPK 4AYBL 3S1RC 4WJ4A 2XCQA 4KB2A 1EJ9A 1B4BA 2E2JK 3HOYC 1O27A 4A3BK 1EI6A 3GEIA 4C45A 3OPFA 1J98A 3AQPA 3GTJA 4BY7C 4KM9A 1USOA 4C2MC 4L8IA 1I50K 3RZDK 5C44C 3GTOC 1A36A 3S14C 1XXCA 4PABA 1ZXOA 4A93C 1ZVUA 4LK0A 1WIHA 2GSUA 5IYBK 1TWGC 3G4AA 2E2HC 3HOWK 4A3KC 3M3YK 4A3DK 2P5MA 1PJ7A 3TFIA 2A69A 5C3EK 1MIUA 4KDDA 3CAGA 1INNA 2PMZA 2R93C 4IP9A 3JSTA 1R9TK 2GAHC 2BE5D 3TTGA 4A3EK 3SJRA 1PJ6A 3S1MC 4C3HC 4O2DA 3LAPA 4Q5SA 4GZYA 5IOSA 4BBRC 1EFWA 4PAAA 1JQWA 2JA7A 1RRJA 4QJVB 1O26A 4OYDB 1Y1WA 1R9TA 1F9NA 1JOEA 3HOXK 4BY1C 1KQ4A 3SZYA 4A3MC 1DCPA 2D6FC 1WSRA 3S1NK 3GSIA 3H0GK 4RMFA 2WAQA 2PHCB 3GDZA 1TWFC 1ISEA 3HOUK 3WVOA 4J3NA 4ZH4A 3DU6A 5M5XK 3HOZC 4LR2A 3FKIK 2A6EA 3SZZA 3K5MA 3K7AC 5TMFA 2A69D 1ZBSA 4AHCA 1PJ5A 2PMZD 3H0GA 4Y52C 3A8JA 4P5BA 3QX3A 4MQ9A 3RZOK 5IOQA 5C4JK 3GTKK 3K58A 4BXXK 4QIWA 3FOFA 2VUMC 3FKIA 2JA5K 4FYDA 2PPBA 3S1RK 4FGUA 1WOPA 4GT9A 3PO2C 3K5OA 1VH2A 2ZFZA 3GTQK 3HOYK 1AB4A 1F93A 4KMAA 4NOIA 2CW0D 2NVQC 5M3FK 3GTKA 4YFNA 3GTMK 3S2DC 2NVTC 1TWHC 2JA5A 1XXAA 2WAQD 5IYDC 3FHZA 1BGWA 5C44K 1V9MA 4LQYA 3S17C 3S14K 5C9HA 3GTQA 5FLMC 4A93K 3MMLB 2GAGC 2A6ED 5IP9C 5EGHA 4NOKA 1TWGK 4G7HA 5JFEA 2E2HK 3GTMA 3A8IA 1L0WA 5M5YK 3M4AA 4A3KK 4P9SA 3AD9C 1VRQC 1GE9A 1WQGA 4DDQA 5JSNB 5IOTA 4XSXA 3ADAC 1ZYRA 2R93K 3IPJA 5IYCC 1TWGA 1SFOK 4XCHA 2E2HA 4D3ZA 1SEUA 4YFXA 1I3QC 5C4XC 5TMCA 2B63C 4BBRK 2NVXC 3GTGC 4QCLA 5IORA 1I6HC 1TWAC 2PA8D 4OINA 1Y698 1XZQA 5HL8A 1WOSA 1IL2A 1A31A 4BY1K 4A3MK 1R5ZA 1SFOA 4OIOA 3S15C 4LLGA 4KARA 4XLNA 4AH6A 4BKWA 4KB4A 5TJ3A 3GTPA 1IW7A 1SMYA 1TWFK 4KATA 4AYBA 1F7VA 2JA6K 4GTLA 2EBBA 3IAYA 3K7AK 4GTBA 4O26A 4C3IC 1WORA 3HKZL 3M4OK 1ZQ1C 1ZYRD 3TFHA 1RR8C 3MAQA 1I50A 2NVYC 3H3VL 5L46A 4JK1A 3GTLC 3T01A 3LAJA 2JA6A 1K83C 1K4TA 1DD5A 2JH3A 2GSOA 1SC7A 3G4CA 5CJ9A 2E2IC 2YU9C 1VJEA 4OIQA 3OREA 1O2AA 4X6AC 4GTCA 1WOOA 5CHPA 1F7UA 2CFAB 1IQ0A 4XLPA 2CFAA 3S2DK 1A35A 1Y1VK 1WCMC 4QJVA 2NVTK 3PO3C 4A3CK 3CQZC 5IYDK 3WODA 1IW7D 1SMYD 4P5AA 3K5LA 4AYBD 4BLBA 2Y0SA 3L4KA 2O5JA 4WILA 5FLMK 3S2HC 5IP9K 1WQFA 2WB1A 3GTJC 1Y1VA 3S1QC 2WAQL 3AD7C 1HQMA 2JA8C 1DCHA 3DXJA
chains in the Genus database with same CATH topology
4EJ3A 2JA5A 1XXAA 3FHZA 4FXDA 1WCMA 2R7ZA 1BGWA 2GSNA 1I6VD 1V9MA 3OEPA 1R49A 4LQYA 2R92A 5C9HA 3GTQA 4GTDA 3LHPS 2VUMA 2XCQA 3MMLB 4ILDA 2A6ED 4KB2A 5EGHA 1EJ9A 1B4BA 4NOKA 4GFQA 1O27A 5JFEA 3L4JA 3GTMA 3M4AA 3OPFA 4C3JC 3AQPA 5EGEA 1EK8A 2F4QA 3GTJA 5CQGA 3ERED 1T8IA 1GE9A 4KM9A 1WQGA 4DDQA 5JSNB 4C2MC 4IP8A 5IOTA 4L8IA 4G0WA 4F3EA 3BUEA 1TWHA 3AH5A 4KM8A 1A36A 3K59A 1XXCA 3N0BA 1TWGA 4H3TA 3NUHA 4M1XA 2E2HA 2O5JD 4D3ZA 1SEUA 1ZXOA 2KWAA 1ZVUA 1WIHA 2GSUA 3G4AA 4QCLA 5IORA 3FOEA 1HQMD 3V4GA 2P5MA 1Y698 1XXBA 3N3YA 1TL8A 4Q5GA 1MIUA 4KDDA 1A31A 3CAGA 1R5ZA 4C2MA 1SFOA 2PMZA 4KMDA 4IP9A 4JLRC 5JVOA 2BE5D 4KARA 2A68D 4KAWX 3SJRA 4BKWA 4C3HC 3GTOA 4KB4A 5TJ3A 1YNJD 4LMOA 3LAPA 4KMHA 3GTPA 4KASA 5IOSA 4KATA 1I3QA 4AYBA 2JA7A 1RRJA 2B63A 5JSBB 4GTLA 2NVXA 3GTGA 3IAYA 1O26A 2NVYA 4OYDB 4D3YA 4O26A 1TWAA 1YNND 4GTBA 2R4GA 1R9TA 1Y1WA 1F9NA 1TGOA 2XCRB 3GTLA 1ZYRD 1KQ4A 2Y3PA 1RR8C 3P9AA 1I50A 3MAQA 4GTFA 4GTAA 3VA7A 2R93A 4BLAA 5MLC9 1O28A 3LPXA 3GTKA 2WAQA 2PHCB 3LAJA 2JA6A 2A6HD 1TWCA 1O2BA 1ISEA 4Q5VA 1K4TA 1DD5A 3WVOA 2JH3A 3AQOA 3DU5A 4J3NA 2GSOA 1SC7A 3DU6A 3G4CA 4FZBA 5CJ9A 4LR2A 1B4AA 1Q8IA 4C3IC 3KYLA 3K5MA 3OREA 1O2AA 2A69D 4GTCA 4G0UA 1ZBSA 1WQHA 4AHCA 5CHPA 2B9SB 2CFAB 3S0XA 1O25A 3H0GA 2RH6A 3CQZA 1O29A 4NOMA 1IS1A 1O24A 2CFAA 1A35A 4P5BA 3QX3A 3LF9A 4AN8A 5IOQA 1LPQA 3K58A 1IW7D 1SMYD 4QIWA 4P5AA 3FOFA 3FKIA 3K5LA 4FYDA 1TWFA 4KC6A 3K57A 2Y0SA 1K83A 4BLBA 3L4KA 4FGUA 2XCOA 4GT9A 1NH3A 4NOLA 3K5OA 3K5NA 2E2IA 1WQFA 2WB1A 2YU9A 1AB4A 2ZFZA 4GTEA 4FM9A 2RGRA 1Y1VA 1K4SA 4KMAA 1EH1A 3N0CA 2CW0D 1BJTA 4G0VA 3Q3QA 3HKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G0U A;  1XXC A;  5JVO A;  1WQH A;  3NUH A;  1XXA A;  5JSB B;  2KWA A;  3FHZ A;  1ZVU A;  1WIH A;  1BGW A;  3OEP A;  4OYD B;  1IS1 A;  3QX3 A;  3LF9 A;  3LHP S;  1F9N A;  2XCR B;  2Y3P A;  3FOE A;  2XCQ A;  3MML B;  3V4G A;  4KB2 A;  2P5M A;  3VA7 A;  1Y69 8;  1B4B A;  1XXB A;  3FOF A;  4GFQ A;  3L4J A;  5MLC 9;  3LPX A;  4KC6 A;  4KDD A;  3CAG A;  3OPF A;  3L4K A;  1EK8 A;  2PHC B;  2XCO A;  3LAJ A;  3ERE D;  1GE9 A;  1ISE A;  1WQG A;  4JLR C;  2ZFZ A;  4DDQ A;  1WQF A;  1DD5 A;  5JSN B;  1AB4 A;  4J3N A;  4KAW X;  4L8I A;  4FM9 A;  2RGR A;  4G0W A;  5CJ9 A;  1EH1 A;  4KB4 A;  3BUE A;  1B4A A;  1BJT A;  3LAP A;  4G0V A;  3ORE A; 
#chains in the Genus database with same CATH topology
 4XSZ A;  4BBS C;  4A3B C;  4A3J C;  5IYC K;  4GTD A;  4KN7 A;  2R7Z C;  1DCO A;  1EQR A;  5C4X K;  2R92 C;  2B63 K;  4GFQ A;  3L4J A;  1USM A;  1EK8 A;  2F4Q A;  1T8I A;  4F3E A;  3BUE A;  4MEX A;  3S15 K;  4BY7 K;  3HOW C;  3K59 A;  3N0B A;  3M3Y C;  4C2M K;  3NUH A;  2Y0S D;  2O5J D;  2KWA A;  2JA7 C;  2WB1 D;  4LK1 A;  3GTO K;  3FOE A;  1HQM D;  1Y1W C;  3V4G A;  1XXB A;  3I4M C;  2V6U A;  4C2M A;  4KMD A;  2NVY K;  5IP7 C;  1HI9 A;  4KAW X;  3GTL K;  3GTO A;  4KMH A;  4KAS A;  4A3L C;  1K83 K;  2V6S A;  1J6X A;  1XZP B;  4QIW D;  4YFK A;  3HOX C;  3I4N C;  3S1M K;  5JSB B;  1XZP A;  2E2I K;  4C3H K;  2NVY A;  4X6A K;  2R4G A;  1YX2 A;  3GTL A;  3P9A A;  3HOU C;  4A3I C;  2R93 A;  5MLC 9;  3LPX A;  3PO3 K;  3CQZ K;  1I6V A;  1O2B A;  4Q5V A;  4FZB A;  2FQT A;  2ZUE A;  1B4A A;  1TWC C;  3KYL A;  4G0U A;  1WQH A;  3S1Q K;  4BXX C;  4Y7N C;  3HOZ K;  2RH6 A;  3CQZ A;  4NOM A;  2JA5 C;  3HOV K;  3LF9 A;  4AN8 A;  3BP3 A;  3HOV C;  4A3G C;  1LPQ A;  3GTQ C;  4BBS K;  4G7Z A;  1C0A A;  4Y52 K;  4A3J K;  1TWF A;  4KC6 A;  1RU0 A;  2R7Z K;  2O5I A;  3GTM C;  1NH3 A;  2W7V A;  2R92 K;  4NOL A;  5EGE A;  2VUM K;  2P8T A;  1O2F B;  3TFJ A;  2RGR A;  4G7O A;  2FQO A;  4G0V A;  2PMZ L;  3S16 C;  3HKZ A;  1IBA A;  3EQL A;  3PO2 K;  2V6T A;  4EJ3 A;  2R7Z A;  2GSN A;  1I6V D;  1XPP A;  2NVQ K;  1UV7 A;  1VLO A;  2R92 A;  2A68 A;  2VUM A;  1TWH K;  1YNJ A;  4ILD A;  2JA7 K;  3GEE A;  4A3F C;  3S17 K;  4Q4Z A;  4C3J C;  1Y1W K;  5CQG A;  3ERE D;  1SFO C;  1YNN A;  4IP8 A;  4G0W A;  3I4M K;  2Y0S L;  5IP7 K;  1TWH A;  3AH5 A;  4KM8 A;  2WB1 L;  3GTP C;  4H3T A;  4M1X A;  3GIR A;  4A3L K;  2A6H A;  3AD8 C;  2E2J C;  4KMU A;  3I4N K;  2CW0 A;  3GEH A;  4YG2 A;  3HKZ D;  1I3Q K;  1J6W A;  3N3Y A;  1TL8 A;  1I50 C;  4Q5G A;  1V5V A;  2NVX K;  1BS2 A;  4LOW A;  3RZD C;  3GTG K;  3H3V D;  1I6H K;  4A3I K;  1TWA K;  5E68 A;  4JLR C;  5JVO A;  4QIW L;  2A68 D;  2JA6 C;  1YNJ D;  4LMO A;  5IYB C;  3M4O C;  1I3Q A;  2B63 A;  4A3D C;  4OIR A;  2NVX A;  1TWC K;  3GTG A;  2PA8 L;  4D3Y A;  1TWA A;  1YNN D;  5M3M K;  5C3E C;  1TGO A;  1YCL A;  2XCR B;  2Y3P A;  4Y7N K;  1JVI A;  4GTF A;  4GTA A;  3VA7 A;  1R9T C;  4C3I K;  4A3E C;  4BLA A;  1O28 A;  4A3G K;  2A6H D;  1TWC A;  3T00 A;  3AQO A;  3DU5 A;  1WSV A;  1VGX A;  4WJ3 M;  1Q8I A;  1Y1V C;  4A3C C;  2B9S B;  3S0X A;  1O25 A;  3S16 K;  1O29 A;  3T02 A;  1BDF A;  1IS1 A;  3A8K A;  1O24 A;  2YU9 K;  3S1N C;  3H0G C;  4OIP A;  1X31 C;  3K57 A;  1K83 A;  1WCM K;  5D4D A;  2ZUF A;  2XCO A;  3FKI C;  3K5N A;  2E2I A;  4FM9 A;  4GTE A;  2YU9 A;  4A3F K;  1K4S A;  4KN4 A;  4C3J K;  1EH1 A;  3N0C A;  1BJT A;  1IE0 A;  3Q3Q A;  3S2H K;  5FJ8 K;  3HXA A;  3RZO C;  3GTJ K;  4MEY A;  4FXD A;  1WCM A;  1G51 A;  5C4J C;  3GTK C;  1J6V A;  3OEP A;  1R49 A;  2JA8 K;  3BP8 C;  5M5W K;  2BE5 A;  1XZQ B;  4LJZ A;  3LHP S;  3GTP K;  4AYB L;  3S1R C;  4WJ4 A;  2XCQ A;  4KB2 A;  1EJ9 A;  1B4B A;  2E2J K;  3HOY C;  1O27 A;  4A3B K;  1EI6 A;  3GEI A;  4C45 A;  3OPF A;  1J98 A;  3AQP A;  3GTJ A;  4BY7 C;  4KM9 A;  1USO A;  4C2M C;  4L8I A;  1I50 K;  3RZD K;  5C44 C;  3GTO C;  1A36 A;  3S14 C;  1XXC A;  4PAB A;  1ZXO A;  4A93 C;  1ZVU A;  4LK0 A;  1WIH A;  2GSU A;  5IYB K;  1TWG C;  3G4A A;  2E2H C;  3HOW K;  4A3K C;  3M3Y K;  4A3D K;  2P5M A;  1PJ7 A;  3TFI A;  2A69 A;  5C3E K;  1MIU A;  4KDD A;  3CAG A;  1INN A;  2PMZ A;  2R93 C;  4IP9 A;  3JST A;  1R9T K;  2GAH C;  2BE5 D;  3TTG A;  4A3E K;  3SJR A;  1PJ6 A;  3S1M C;  4C3H C;  4O2D A;  3LAP A;  4Q5S A;  4GZY A;  5IOS A;  4BBR C;  1EFW A;  4PAA A;  1JQW A;  2JA7 A;  1RRJ A;  4QJV B;  1O26 A;  4OYD B;  1Y1W A;  1R9T A;  1F9N A;  1JOE A;  3HOX K;  4BY1 C;  1KQ4 A;  3SZY A;  4A3M C;  1DCP A;  2D6F C;  1WSR A;  3S1N K;  3GSI A;  3H0G K;  4RMF A;  2WAQ A;  2PHC B;  3GDZ A;  1TWF C;  1ISE A;  3HOU K;  3WVO A;  4J3N A;  4ZH4 A;  3DU6 A;  5M5X K;  3HOZ C;  4LR2 A;  3FKI K;  2A6E A;  3SZZ A;  3K5M A;  3K7A C;  5TMF A;  2A69 D;  1ZBS A;  4AHC A;  1PJ5 A;  2PMZ D;  3H0G A;  4Y52 C;  3A8J A;  4P5B A;  3QX3 A;  4MQ9 A;  3RZO K;  5IOQ A;  5C4J K;  3GTK K;  3K58 A;  4BXX K;  4QIW A;  3FOF A;  2VUM C;  3FKI A;  2JA5 K;  4FYD A;  2PPB A;  3S1R K;  4FGU A;  1WOP A;  4GT9 A;  3PO2 C;  3K5O A;  1VH2 A;  2ZFZ A;  3GTQ K;  3HOY K;  1AB4 A;  1F93 A;  4KMA A;  4NOI A;  2CW0 D;  2NVQ C;  5M3F K;  3GTK A;  4YFN A;  3GTM K;  3S2D C;  2NVT C;  1TWH C;  2JA5 A;  1XXA A;  2WAQ D;  5IYD C;  3FHZ A;  1BGW A;  5C44 K;  1V9M A;  4LQY A;  3S17 C;  3S14 K;  5C9H A;  3GTQ A;  5FLM C;  4A93 K;  3MML B;  2GAG C;  2A6E D;  5IP9 C;  5EGH A;  4NOK A;  1TWG K;  4G7H A;  5JFE A;  2E2H K;  3GTM A;  3A8I A;  1L0W A;  5M5Y K;  3M4A A;  4A3K K;  4P9S A;  3AD9 C;  1VRQ C;  1GE9 A;  1WQG A;  4DDQ A;  5JSN B;  5IOT A;  4XSX A;  3ADA C;  1ZYR A;  2R93 K;  3IPJ A;  5IYC C;  1TWG A;  1SFO K;  4XCH A;  2E2H A;  4D3Z A;  1SEU A;  4YFX A;  1I3Q C;  5C4X C;  5TMC A;  2B63 C;  4BBR K;  2NVX C;  3GTG C;  4QCL A;  5IOR A;  1I6H C;  1TWA C;  2PA8 D;  4OIN A;  1Y69 8;  1XZQ A;  5HL8 A;  1WOS A;  1IL2 A;  1A31 A;  4BY1 K;  4A3M K;  1R5Z A;  1SFO A;  4OIO A;  3S15 C;  4LLG A;  4KAR A;  4XLN A;  4AH6 A;  4BKW A;  4KB4 A;  5TJ3 A;  3GTP A;  1IW7 A;  1SMY A;  1TWF K;  4KAT A;  4AYB A;  1F7V A;  2JA6 K;  4GTL A;  2EBB A;  3IAY A;  3K7A K;  4GTB A;  4O26 A;  4C3I C;  1WOR A;  3HKZ L;  3M4O K;  1ZQ1 C;  1ZYR D;  3TFH A;  1RR8 C;  3MAQ A;  1I50 A;  2NVY C;  3H3V L;  5L46 A;  4JK1 A;  3GTL C;  3T01 A;  3LAJ A;  2JA6 A;  1K83 C;  1K4T A;  1DD5 A;  2JH3 A;  2GSO A;  1SC7 A;  3G4C A;  5CJ9 A;  2E2I C;  2YU9 C;  1VJE A;  4OIQ A;  3ORE A;  1O2A A;  4X6A C;  4GTC A;  1WOO A;  5CHP A;  1F7U A;  2CFA B;  1IQ0 A;  4XLP A;  2CFA A;  3S2D K;  1A35 A;  1Y1V K;  1WCM C;  4QJV A;  2NVT K;  3PO3 C;  4A3C K;  3CQZ C;  5IYD K;  3WOD A;  1IW7 D;  1SMY D;  4P5A A;  3K5L A;  4AYB D;  4BLB A;  2Y0S A;  3L4K A;  2O5J A;  4WIL A;  5FLM K;  3S2H C;  5IP9 K;  1WQF A;  2WB1 A;  3GTJ C;  1Y1V A;  3S1Q C;  2WAQ L;  3AD7 C;  1HQM A;  2JA8 C;  1DCH A;  3DXJ A; 
#chains in the Genus database with same CATH homology
 4EJ3 A;  2JA5 A;  1XXA A;  3FHZ A;  4FXD A;  1WCM A;  2R7Z A;  1BGW A;  2GSN A;  1I6V D;  1V9M A;  3OEP A;  1R49 A;  4LQY A;  2R92 A;  5C9H A;  3GTQ A;  4GTD A;  3LHP S;  2VUM A;  2XCQ A;  3MML B;  4ILD A;  2A6E D;  4KB2 A;  5EGH A;  1EJ9 A;  1B4B A;  4NOK A;  4GFQ A;  1O27 A;  5JFE A;  3L4J A;  3GTM A;  3M4A A;  3OPF A;  4C3J C;  3AQP A;  5EGE A;  1EK8 A;  2F4Q A;  3GTJ A;  5CQG A;  3ERE D;  1T8I A;  1GE9 A;  4KM9 A;  1WQG A;  4DDQ A;  5JSN B;  4C2M C;  4IP8 A;  5IOT A;  4L8I A;  4G0W A;  4F3E A;  3BUE A;  1TWH A;  3AH5 A;  4KM8 A;  1A36 A;  3K59 A;  1XXC A;  3N0B A;  1TWG A;  4H3T A;  3NUH A;  4M1X A;  2E2H A;  2O5J D;  4D3Z A;  1SEU A;  1ZXO A;  2KWA A;  1ZVU A;  1WIH A;  2GSU A;  3G4A A;  4QCL A;  5IOR A;  3FOE A;  1HQM D;  3V4G A;  2P5M A;  1Y69 8;  1XXB A;  3N3Y A;  1TL8 A;  4Q5G A;  1MIU A;  4KDD A;  1A31 A;  3CAG A;  1R5Z A;  4C2M A;  1SFO A;  2PMZ A;  4KMD A;  4IP9 A;  4JLR C;  5JVO A;  2BE5 D;  4KAR A;  2A68 D;  4KAW X;  3SJR A;  4BKW A;  4C3H C;  3GTO A;  4KB4 A;  5TJ3 A;  1YNJ D;  4LMO A;  3LAP A;  4KMH A;  3GTP A;  4KAS A;  5IOS A;  4KAT A;  1I3Q A;  4AYB A;  2JA7 A;  1RRJ A;  2B63 A;  5JSB B;  4GTL A;  2NVX A;  3GTG A;  3IAY A;  1O26 A;  2NVY A;  4OYD B;  4D3Y A;  4O26 A;  1TWA A;  1YNN D;  4GTB A;  2R4G A;  1R9T A;  1Y1W A;  1F9N A;  1TGO A;  2XCR B;  3GTL A;  1ZYR D;  1KQ4 A;  2Y3P A;  1RR8 C;  3P9A A;  1I50 A;  3MAQ A;  4GTF A;  4GTA A;  3VA7 A;  2R93 A;  4BLA A;  5MLC 9;  1O28 A;  3LPX A;  3GTK A;  2WAQ A;  2PHC B;  3LAJ A;  2JA6 A;  2A6H D;  1TWC A;  1O2B A;  1ISE A;  4Q5V A;  1K4T A;  1DD5 A;  3WVO A;  2JH3 A;  3AQO A;  3DU5 A;  4J3N A;  2GSO A;  1SC7 A;  3DU6 A;  3G4C A;  4FZB A;  5CJ9 A;  4LR2 A;  1B4A A;  1Q8I A;  4C3I C;  3KYL A;  3K5M A;  3ORE A;  1O2A A;  2A69 D;  4GTC A;  4G0U A;  1ZBS A;  1WQH A;  4AHC A;  5CHP A;  2B9S B;  2CFA B;  3S0X A;  1O25 A;  3H0G A;  2RH6 A;  3CQZ A;  1O29 A;  4NOM A;  1IS1 A;  1O24 A;  2CFA A;  1A35 A;  4P5B A;  3QX3 A;  3LF9 A;  4AN8 A;  5IOQ A;  1LPQ A;  3K58 A;  1IW7 D;  1SMY D;  4QIW A;  4P5A A;  3FOF A;  3FKI A;  3K5L A;  4FYD A;  1TWF A;  4KC6 A;  3K57 A;  2Y0S A;  1K83 A;  4BLB A;  3L4K A;  4FGU A;  2XCO A;  4GT9 A;  1NH3 A;  4NOL A;  3K5O A;  3K5N A;  2E2I A;  1WQF A;  2WB1 A;  2YU9 A;  1AB4 A;  2ZFZ A;  4GTE A;  4FM9 A;  2RGR A;  1Y1V A;  1K4S A;  4KMA A;  1EH1 A;  3N0C A;  2CW0 D;  1BJT A;  4G0V A;  3Q3Q A;  3HKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...