1EK8A

Crystal structure of the ribosome recycling factor (rrf) from escherichia coli
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
185
Chain Sequence
b'MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME RECYCLING FACTOR
publication title Crystal structure of the ribosome recycling factor from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
total genus 60
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2000-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1ek8A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1ek8A02
2KWAA 1Y698 4KC6A 4OYDB 4KAWX 5MLC9 5JSBB 3LHPS 1BJTA 1XXAA 4L8IA 3LF9A 1WQHA 1GE9A 1XXCA 3NUHA 5CJ9A 4G0UA 1EH1A 4G0WA 4GFQA 3FOEA 1DD5A 1F9NA 3MMLB 3L4KA 2RGRA 3OREA 3FOFA 1B4AA 4DDQA 3LAJA 1WQGA 2ZFZA 3BUEA 4FM9A 3LAPA 1IS1A 4KB2A 1EK8A 2XCQA 1XXBA 1WQFA 4KB4A 1ZVUA 3LPXA 3ERED 2PHCB 3FHZA 1B4BA 3L4JA 4G0VA 3OPFA 5JVOA 3QX3A 4J3NA 3V4GA 4JLRC 2XCOA 2Y3PA 3CAGA 3OEPA 2XCRB 1AB4A 4KDDA 1BGWA 2P5MA 1WIHA 3VA7A 5JSNB 1ISEA
chains in the Genus database with same CATH superfamily
4NOMA 2ZUEA 4A3DC 3N0BA 2A6ED 3NUHA 2JA6A 2JA5A 4MEYA 1ZYRA 5HL8A 4G0WA 4A3CC 1O25A 4GFQA 1Y1VC 2JA6K 1YNJD 5CQGA 4A3MC 4G7OA 2R92K 2WAQA 5IYDK 1TWCA 4H3TA 5JVOA 3RZDC 4A93C 3H3VL 5C9HA 3GDZA 3SZZA 3S2DK 1USOA 3M3YK 3Q3QA 2PMZL 3HOWK 3FKIA 3GTQC 4PABA 3PO3K 4L8IA 1O27A 4GTFA 1K83A 4WILA 2CW0A 3S0XA 4QIWL 3AD9C 1K83K 3FOFA 1IE0A 4A3FK 3CQZA 2FQOA 4FM9A 1Y1VK 5IOTA 1EFWA 3CQZK 4KMAA 4BBRK 4Y7NC 4G0VA 3HOZK 2R7ZC 1BS2A 4A3KC 3G4CA 3N3YA 2WB1A 4J3NA 1HQMD 2VUMA 3JSTA 4BLAA 4KDDA 1O24A 3MAQA 5C44K 4MEXA 3S2HC 2KWAA 3BP8C 1VRQC 2E2IC 1R9TK 1ZQ1C 3I4NC 4YFKA 4KASA 1IBAA 1BDFA 2RGRA 2RH6A 3I4MC 4PAAA 3M4OK 2NVXA 3GTMC 2NVXK 1TL8A 1I6VD 3P9AA 3S1QC 3QX3A 4OIOA 1TWGA 1L0WA 2O5JA 1AB4A 1Y1WC 5IP7K 3IPJA 1IQ0A 4KN4A 3GTKC 3S14C 5IYBC 3GTOC 4Q5SA 1EQRA 1XXCA 2GSNA 4D3ZA 1EJ9A 1A31A 4ILDA 4GTCA 3HKZD 1O28A 1DD5A 2ZUFA 4XLPA 2JA8C 2B63A 2ZFZA 2B63K 4KB4A 4A3EC 5FJ8K 3M4AA 3IAYA 1SMYA 1WSVA 4C3IK 5E68A 4FXDA 4GZYA 2NVYA 4IP9A 4OINA 3GTMK 4GTDA 1YNND 1VJEA 5C4XK 1F93A 4Q5GA 2PA8L 3GSIA 4OYDB 1TWHA 1IL2A 1A36A 1VGXA 3H0GA 4KMUA 1SFOA 2Y0SL 3H0GK 2JA6C 1I6HK 4C3HK 3S14K 1SFOK 5EGHA 4YG2A 4BY7C 2R92C 5IYDC 1DCHA 4DDQA 2GSUA 1K4SA 3LAPA 1EK8A 2XCQA 4P9SA 2E2HK 2EBBA 3OPFA 3S2DC 3GTLA 4QIWD 5TMFA 4KN7A 1T8IA 3GTJA 3GEHA 3HOWC 3S1RK 3HKZL 3GTJK 3PO3C 3T00A 1KQ4A 4AHCA 3A8KA 4XSZA 1K83C 2A69A 1RR8C 4A3FC 1JVIA 3AH5A 3CQZC 2JA5K 4C2MA 4BBRC 3HOZC 3HOVC 4KM8A 3S17K 2YU9A 1ZBSA 4GT9A 4BY7K 3LPXA 2PHCB 3KYLA 2V6UA 4FYDA 2W7VA 3T02A 2YU9K 4FZBA 1TWCK 5C44C 3RZOK 4NOKA 2P5MA 1R9TC 1IW7D 3HOYK 1Y698 2CW0D 3TFJA 3LF9A 4LJZA 3FKIK 3GIRA 1F9NA 2A6EA 3M4OC 4O26A 2NVXC 1PJ7A 1V9MA 1DCPA 3K5NA 1I50A 1JOEA 3HOVK 1Q8IA 3DXJA 2JA7A 1I50K 3V4GA 5IP7C 1K4TA 2R93A 2P8TA 2JA7K 2XCRB 3AD7C 3K5OA 2E2JK 2R93K 5JSNB 3GTGA 4BLBA 4Y52K 4GTBA 2WAQL 2VUMK 3GTGK 3LHPS 1XXAA 4LMOA 1R5ZA 1WQHA 1GE9A 5CJ9A 4LK1A 1EH1A 2A6HA 4A3IK 2F4QA 2PA8D 2B63C 4A3BC 4BY1K 4A3GK 3LAJA 1O29A 5IYCK 1XZPB 4KATA 4C3JK 4C3IC 3ERED 3FHZA 2Y0SD 2B9SB 1UV7A 1B4BA 4P5BA 5C4XC 4Q5VA 4BKWA 3WODA 4KMDA 1TWGK 3H0GC 1I6HC 3DU5A 3AQOA 4C3HC 1SFOC 1TWAA 1EI6A 2BE5D 3GTPA 4LR2A 3K7AC 1TWAK 3MMLB 1MIUA 1SMYD 1INNA 2E2HC 4KB2A 2GSOA 2V6SA 3A8JA 4A3BK 5D4DA 4AYBA 4IP8A 3G4AA 4JLRC 5C4JK 1I6VA 3GTJC 3S1RC 2XCOA 2NVYK 3HXAA 4O2DA 4KMHA 2E2IA 5IP9K 1F7VA 1TWHK 5JFEA 2JA5C 1I3QA 3ADAC 3BP3A 3K59A 1F7UA 3FOEA 3S17C 5IOSA 3L4KA 1I3QK 1WOOA 5M3FK 2YU9C 3K7AK 4G7HA 1XZPA 3S16C 4KM9A 4ZH4A 1WOSA 1TWCC 4XLNA 3RZOC 5M5YK 5IOQA 4JK1A 4WJ3M 5CHPA 5TMCA 3GTLK 1XZQB 3HOYC 3GEIA 1VH2A 4XCHA 4A3LK 4D3YA 4BBSK 3GTKA 4KC6A 4MQ9A 5EGEA 2GAHC 3FKIC 5M5XK 1ZYRD 4Q4ZA 3SJRA 1WORA 1WSRA 3K5MA 1ZXOA 2WAQD 4GTLA 4A3JC 1TGOA 3AD8C 2PMZA 4C2MK 5FLMK 1I50C 2V6TA 1WCMA 1LPQA 1PJ5A 1DCOA 1TWFA 1YX2A 2JA7C 3S16K 2E2JC 5M3MK 2R93C 1J6VA 2A68A 4LOWA 4Y52C 4AH6A 3S1NK 2VUMC 4QIWA 3GTGC 1WIHA 4GTAA 4KAWX 4A3IC 4XSXA 1BJTA 1RU0A 4KARA 5TJ3A 3TFHA 4BY1C 4A3GC 2CFAA 5IYCC 2R92A 2PPBA 3S1MK 4C3JC 4YFNA 3PO2K 3S15K 2NVTK 4X6AK 1X31C 1XXBA 1ZVUA 3K57A 1YNJA 2WB1D 1VLOA 4A3JK 5L46A 3HOXK 1O2BA 1TWGC 1XZQA 1O2FB 2NVQK 3DU6A 4GTEA 4YFXA 4LQYA 1SC7A 3HOUK 1JQWA 2A6HD 1YCLA 4OIRA 1TWAC 1IW7A 3GTPC 3WVOA 4A3DK 1USMA 1J98A 4LK0A 1Y1VA 4A3CK 1A35A 1J6WA 4NOIA 2R4GA 4A3MK 5C4JC 2O5JD 2NVYC 2Y3PA 3RZDK 3OEPA 4A93K 1O26A 1BGWA 4QJVB 5IP9C 4NOLA 3N0CA 1R9TA 1HQMA 1ISEA 3A8IA 1TWHC 3GTQA 4BXXC 1I3QC 4G0UA 4F3EA 2WB1L 3GTQK 3GTPK 1WQGA 4AYBD 1J6XA 1XPPA 4EJ3A 3GEEA 3GTLC 1G51A 2R7ZA 2Y0SA 1V5VA 4A3LC 4Y7NK 4RMFA 2R7ZK 1PJ6A 4A3KK 3CAGA 4BBSC 4LLGA 5C3EC 3TTGA 5MLC9 3S2HK 1SEUA 2E2IK 3K58A 3EQLA 3OREA 2BE5A 3I4NK 2CFAB 4BXXK 4C2MC 5FLMC 3BUEA 4P5AA 3HKZA 3I4MK 5M5WK 1WCMC 2JH3A 4C45A 3L4JA 3GTMA 1TWFC 3S1NC 3AQPA 3T01A 3SZYA 1NH3A 1R49A 4FGUA 4QJVA 3S1QK 1Y1WA 2GAGC 1HI9A 2A69D 1YNNA 1Y1WK 3H3VD 5JSBB 4M1XA 3GTOA 4AYBL 4WJ4A 5C3EK 3GTKK 4OIPA 3S1MC 5IYBK 3GTOK 3PO2C 3S15C 2NVTC 4X6AC 2PMZD 3K5LA 4G7ZA 1B4AA 2O5IA 1RRJA 2E2HA 1IS1A 4QCLA 1WOPA 5IORA 1WQFA 2JA8K 2A68D 3HOXC 2D6FC 2NVQC 4A3EK 3M3YC 2FQTA 1C0AA 1O2AA 1WCMK 1TWFK 3HOUC 3VA7A 4AN8A 4OIQA 3TFIA
chains in the Genus database with same CATH topology
1SC7A 4OYDB 1TWHA 3DU5A 1A36A 2A6HD 3AQOA 3H0GA 4C3HC 4NOMA 1TWAA 1SFOA 2A6ED 3N0BA 2BE5D 3GTPA 2JA6A 2JA5A 3NUHA 4LR2A 4G0WA 1O25A 5EGHA 4GFQA 3WVOA 3MMLB 1MIUA 1SMYD 1YNJD 1Y1VA 3ERED 4DDQA 5CQGA 1A35A 1K4SA 2GSUA 3LAPA 1EK8A 4KB2A 2GSOA 2XCQA 2WAQA 1TWCA 2R4GA 4H3TA 3OPFA 5JVOA 4AYBA 3GTLA 4IP8A 3G4AA 2O5JD 5C9HA 4JLRC 2XCOA 2Y3PA 1T8IA 3GTJA 3OEPA 1O26A 1BGWA 4NOLA 3N0CA 1R9TA 3Q3QA 1ISEA 4KMHA 1KQ4A 4AHCA 2E2IA 3FKIA 3GTQA 4L8IA 4G0UA 5JFEA 1O27A 4F3EA 1I3QA 1RR8C 1K83A 4GTFA 3K59A 3S0XA 3FOEA 5IOSA 3L4KA 3FOFA 3AH5A 4C2MA 1WQGA 3CQZA 4FM9A 4KM8A 4KM9A 2YU9A 1ZBSA 4GT9A 5IOTA 3LPXA 4KMAA 2PHCB 3KYLA 4FYDA 4EJ3A 4G0VA 4FZBA 3G4CA 2R7ZA 5IOQA 3N3YA 2Y0SA 2WB1A 4J3NA 1HQMD 5CHPA 2VUMA 3CAGA 4NOKA 4BLAA 4KDDA 2P5MA 1O24A 3MAQA 4D3YA 1IW7D 2KWAA 1Y698 4KC6A 3GTKA 5EGEA 5MLC9 2CW0D 1ZYRD 1SEUA 3LF9A 4KASA 3K58A 1F9NA 3SJRA 2RGRA 2RH6A 3OREA 3K5MA 1ZXOA 2CFAB 4O26A 4GTLA 4C2MC 1TGOA 3BUEA 4P5AA 3HKZA 2NVXA 2PMZA 1V9MA 2JH3A 3L4JA 1WCMA 3K5NA 1TL8A 1LPQA 1I50A 1I6VD 3GTMA 1TWFA 1Q8IA 3P9AA 3AQPA 3QX3A 2JA7A 3V4GA 1TWGA 1NH3A 1R49A 1K4TA 2R93A 4FGUA 4QIWA 2XCRB 1AB4A 3K5OA 1WIHA 5JSNB 3GTGA 1Y1WA 4BLBA 4GTBA 4GTAA 2A69D 4KAWX 5JSBB 4M1XA 3LHPS 3GTOA 1BJTA 1XXAA 5TJ3A 4KARA 4LMOA 1R5ZA 1WQHA 1GE9A 1XXCA 2GSNA 4D3ZA 1EJ9A 1A31A 1EH1A 4ILDA 5CJ9A 2F4QA 4GTCA 1O28A 1DD5A 2CFAA 2R92A 3K5LA 4C3JC 1B4AA 2B63A 3LAJA 1RRJA 1O29A 2ZFZA 2E2HA 1IS1A 4QCLA 1XXBA 1WQFA 4KB4A 1ZVUA 4KATA 4C3IC 3K57A 5IORA 3FHZA 3M4AA 2A68D 2B9SB 3IAYA 1B4BA 4P5BA 4FXDA 4Q5VA 1O2BA 2NVYA 4IP9A 1O2AA 4BKWA 4GTDA 1YNND 3VA7A 4AN8A 3DU6A 4KMDA 4Q5GA 4GTEA 4LQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWA A;  1Y69 8;  4KC6 A;  4OYD B;  4KAW X;  5MLC 9;  5JSB B;  3LHP S;  1BJT A;  1XXA A;  4L8I A;  3LF9 A;  1WQH A;  1GE9 A;  1XXC A;  3NUH A;  5CJ9 A;  4G0U A;  1EH1 A;  4G0W A;  4GFQ A;  3FOE A;  1DD5 A;  1F9N A;  3MML B;  3L4K A;  2RGR A;  3ORE A;  3FOF A;  1B4A A;  4DDQ A;  3LAJ A;  1WQG A;  2ZFZ A;  3BUE A;  4FM9 A;  3LAP A;  1IS1 A;  4KB2 A;  1EK8 A;  2XCQ A;  1XXB A;  1WQF A;  4KB4 A;  1ZVU A;  3LPX A;  3ERE D;  2PHC B;  3FHZ A;  1B4B A;  3L4J A;  4G0V A;  3OPF A;  5JVO A;  3QX3 A;  4J3N A;  3V4G A;  4JLR C;  2XCO A;  2Y3P A;  3CAG A;  3OEP A;  2XCR B;  1AB4 A;  4KDD A;  1BGW A;  2P5M A;  1WIH A;  3VA7 A;  5JSN B;  1ISE A; 
#chains in the Genus database with same CATH topology
 4NOM A;  2ZUE A;  4A3D C;  3N0B A;  2A6E D;  3NUH A;  2JA6 A;  2JA5 A;  4MEY A;  1ZYR A;  5HL8 A;  4G0W A;  4A3C C;  1O25 A;  4GFQ A;  1Y1V C;  2JA6 K;  1YNJ D;  5CQG A;  4A3M C;  4G7O A;  2R92 K;  2WAQ A;  5IYD K;  1TWC A;  4H3T A;  5JVO A;  3RZD C;  4A93 C;  3H3V L;  5C9H A;  3GDZ A;  3SZZ A;  3S2D K;  1USO A;  3M3Y K;  3Q3Q A;  2PMZ L;  3HOW K;  3FKI A;  3GTQ C;  4PAB A;  3PO3 K;  4L8I A;  1O27 A;  4GTF A;  1K83 A;  4WIL A;  2CW0 A;  3S0X A;  4QIW L;  3AD9 C;  1K83 K;  3FOF A;  1IE0 A;  4A3F K;  3CQZ A;  2FQO A;  4FM9 A;  1Y1V K;  5IOT A;  1EFW A;  3CQZ K;  4KMA A;  4BBR K;  4Y7N C;  4G0V A;  3HOZ K;  2R7Z C;  1BS2 A;  4A3K C;  3G4C A;  3N3Y A;  2WB1 A;  4J3N A;  1HQM D;  2VUM A;  3JST A;  4BLA A;  4KDD A;  1O24 A;  3MAQ A;  5C44 K;  4MEX A;  3S2H C;  2KWA A;  3BP8 C;  1VRQ C;  2E2I C;  1R9T K;  1ZQ1 C;  3I4N C;  4YFK A;  4KAS A;  1IBA A;  1BDF A;  2RGR A;  2RH6 A;  3I4M C;  4PAA A;  3M4O K;  2NVX A;  3GTM C;  2NVX K;  1TL8 A;  1I6V D;  3P9A A;  3S1Q C;  3QX3 A;  4OIO A;  1TWG A;  1L0W A;  2O5J A;  1AB4 A;  1Y1W C;  5IP7 K;  3IPJ A;  1IQ0 A;  4KN4 A;  3GTK C;  3S14 C;  5IYB C;  3GTO C;  4Q5S A;  1EQR A;  1XXC A;  2GSN A;  4D3Z A;  1EJ9 A;  1A31 A;  4ILD A;  4GTC A;  3HKZ D;  1O28 A;  1DD5 A;  2ZUF A;  4XLP A;  2JA8 C;  2B63 A;  2ZFZ A;  2B63 K;  4KB4 A;  4A3E C;  5FJ8 K;  3M4A A;  3IAY A;  1SMY A;  1WSV A;  4C3I K;  5E68 A;  4FXD A;  4GZY A;  2NVY A;  4IP9 A;  4OIN A;  3GTM K;  4GTD A;  1YNN D;  1VJE A;  5C4X K;  1F93 A;  4Q5G A;  2PA8 L;  3GSI A;  4OYD B;  1TWH A;  1IL2 A;  1A36 A;  1VGX A;  3H0G A;  4KMU A;  1SFO A;  2Y0S L;  3H0G K;  2JA6 C;  1I6H K;  4C3H K;  3S14 K;  1SFO K;  5EGH A;  4YG2 A;  4BY7 C;  2R92 C;  5IYD C;  1DCH A;  4DDQ A;  2GSU A;  1K4S A;  3LAP A;  1EK8 A;  2XCQ A;  4P9S A;  2E2H K;  2EBB A;  3OPF A;  3S2D C;  3GTL A;  4QIW D;  5TMF A;  4KN7 A;  1T8I A;  3GTJ A;  3GEH A;  3HOW C;  3S1R K;  3HKZ L;  3GTJ K;  3PO3 C;  3T00 A;  1KQ4 A;  4AHC A;  3A8K A;  4XSZ A;  1K83 C;  2A69 A;  1RR8 C;  4A3F C;  1JVI A;  3AH5 A;  3CQZ C;  2JA5 K;  4C2M A;  4BBR C;  3HOZ C;  3HOV C;  4KM8 A;  3S17 K;  2YU9 A;  1ZBS A;  4GT9 A;  4BY7 K;  3LPX A;  2PHC B;  3KYL A;  2V6U A;  4FYD A;  2W7V A;  3T02 A;  2YU9 K;  4FZB A;  1TWC K;  5C44 C;  3RZO K;  4NOK A;  2P5M A;  1R9T C;  1IW7 D;  3HOY K;  1Y69 8;  2CW0 D;  3TFJ A;  3LF9 A;  4LJZ A;  3FKI K;  3GIR A;  1F9N A;  2A6E A;  3M4O C;  4O26 A;  2NVX C;  1PJ7 A;  1V9M A;  1DCP A;  3K5N A;  1I50 A;  1JOE A;  3HOV K;  1Q8I A;  3DXJ A;  2JA7 A;  1I50 K;  3V4G A;  5IP7 C;  1K4T A;  2R93 A;  2P8T A;  2JA7 K;  2XCR B;  3AD7 C;  3K5O A;  2E2J K;  2R93 K;  5JSN B;  3GTG A;  4BLB A;  4Y52 K;  4GTB A;  2WAQ L;  2VUM K;  3GTG K;  3LHP S;  1XXA A;  4LMO A;  1R5Z A;  1WQH A;  1GE9 A;  5CJ9 A;  4LK1 A;  1EH1 A;  2A6H A;  4A3I K;  2F4Q A;  2PA8 D;  2B63 C;  4A3B C;  4BY1 K;  4A3G K;  3LAJ A;  1O29 A;  5IYC K;  1XZP B;  4KAT A;  4C3J K;  4C3I C;  3ERE D;  3FHZ A;  2Y0S D;  2B9S B;  1UV7 A;  1B4B A;  4P5B A;  5C4X C;  4Q5V A;  4BKW A;  3WOD A;  4KMD A;  1TWG K;  3H0G C;  1I6H C;  3DU5 A;  3AQO A;  4C3H C;  1SFO C;  1TWA A;  1EI6 A;  2BE5 D;  3GTP A;  4LR2 A;  3K7A C;  1TWA K;  3MML B;  1MIU A;  1SMY D;  1INN A;  2E2H C;  4KB2 A;  2GSO A;  2V6S A;  3A8J A;  4A3B K;  5D4D A;  4AYB A;  4IP8 A;  3G4A A;  4JLR C;  5C4J K;  1I6V A;  3GTJ C;  3S1R C;  2XCO A;  2NVY K;  3HXA A;  4O2D A;  4KMH A;  2E2I A;  5IP9 K;  1F7V A;  1TWH K;  5JFE A;  2JA5 C;  1I3Q A;  3ADA C;  3BP3 A;  3K59 A;  1F7U A;  3FOE A;  3S17 C;  5IOS A;  3L4K A;  1I3Q K;  1WOO A;  5M3F K;  2YU9 C;  3K7A K;  4G7H A;  1XZP A;  3S16 C;  4KM9 A;  4ZH4 A;  1WOS A;  1TWC C;  4XLN A;  3RZO C;  5M5Y K;  5IOQ A;  4JK1 A;  4WJ3 M;  5CHP A;  5TMC A;  3GTL K;  1XZQ B;  3HOY C;  3GEI A;  1VH2 A;  4XCH A;  4A3L K;  4D3Y A;  4BBS K;  3GTK A;  4KC6 A;  4MQ9 A;  5EGE A;  2GAH C;  3FKI C;  5M5X K;  1ZYR D;  4Q4Z A;  3SJR A;  1WOR A;  1WSR A;  3K5M A;  1ZXO A;  2WAQ D;  4GTL A;  4A3J C;  1TGO A;  3AD8 C;  2PMZ A;  4C2M K;  5FLM K;  1I50 C;  2V6T A;  1WCM A;  1LPQ A;  1PJ5 A;  1DCO A;  1TWF A;  1YX2 A;  2JA7 C;  3S16 K;  2E2J C;  5M3M K;  2R93 C;  1J6V A;  2A68 A;  4LOW A;  4Y52 C;  4AH6 A;  3S1N K;  2VUM C;  4QIW A;  3GTG C;  1WIH A;  4GTA A;  4KAW X;  4A3I C;  4XSX A;  1BJT A;  1RU0 A;  4KAR A;  5TJ3 A;  3TFH A;  4BY1 C;  4A3G C;  2CFA A;  5IYC C;  2R92 A;  2PPB A;  3S1M K;  4C3J C;  4YFN A;  3PO2 K;  3S15 K;  2NVT K;  4X6A K;  1X31 C;  1XXB A;  1ZVU A;  3K57 A;  1YNJ A;  2WB1 D;  1VLO A;  4A3J K;  5L46 A;  3HOX K;  1O2B A;  1TWG C;  1XZQ A;  1O2F B;  2NVQ K;  3DU6 A;  4GTE A;  4YFX A;  4LQY A;  1SC7 A;  3HOU K;  1JQW A;  2A6H D;  1YCL A;  4OIR A;  1TWA C;  1IW7 A;  3GTP C;  3WVO A;  4A3D K;  1USM A;  1J98 A;  4LK0 A;  1Y1V A;  4A3C K;  1A35 A;  1J6W A;  4NOI A;  2R4G A;  4A3M K;  5C4J C;  2O5J D;  2NVY C;  2Y3P A;  3RZD K;  3OEP A;  4A93 K;  1O26 A;  1BGW A;  4QJV B;  5IP9 C;  4NOL A;  3N0C A;  1R9T A;  1HQM A;  1ISE A;  3A8I A;  1TWH C;  3GTQ A;  4BXX C;  1I3Q C;  4G0U A;  4F3E A;  2WB1 L;  3GTQ K;  3GTP K;  1WQG A;  4AYB D;  1J6X A;  1XPP A;  4EJ3 A;  3GEE A;  3GTL C;  1G51 A;  2R7Z A;  2Y0S A;  1V5V A;  4A3L C;  4Y7N K;  4RMF A;  2R7Z K;  1PJ6 A;  4A3K K;  3CAG A;  4BBS C;  4LLG A;  5C3E C;  3TTG A;  5MLC 9;  3S2H K;  1SEU A;  2E2I K;  3K58 A;  3EQL A;  3ORE A;  2BE5 A;  3I4N K;  2CFA B;  4BXX K;  4C2M C;  5FLM C;  3BUE A;  4P5A A;  3HKZ A;  3I4M K;  5M5W K;  1WCM C;  2JH3 A;  4C45 A;  3L4J A;  3GTM A;  1TWF C;  3S1N C;  3AQP A;  3T01 A;  3SZY A;  1NH3 A;  1R49 A;  4FGU A;  4QJV A;  3S1Q K;  1Y1W A;  2GAG C;  1HI9 A;  2A69 D;  1YNN A;  1Y1W K;  3H3V D;  5JSB B;  4M1X A;  3GTO A;  4AYB L;  4WJ4 A;  5C3E K;  3GTK K;  4OIP A;  3S1M C;  5IYB K;  3GTO K;  3PO2 C;  3S15 C;  2NVT C;  4X6A C;  2PMZ D;  3K5L A;  4G7Z A;  1B4A A;  2O5I A;  1RRJ A;  2E2H A;  1IS1 A;  4QCL A;  1WOP A;  5IOR A;  1WQF A;  2JA8 K;  2A68 D;  3HOX C;  2D6F C;  2NVQ C;  4A3E K;  3M3Y C;  2FQT A;  1C0A A;  1O2A A;  1WCM K;  1TWF K;  3HOU C;  3VA7 A;  4AN8 A;  4OIQ A;  3TFI A; 
#chains in the Genus database with same CATH homology
 1SC7 A;  4OYD B;  1TWH A;  3DU5 A;  1A36 A;  2A6H D;  3AQO A;  3H0G A;  4C3H C;  4NOM A;  1TWA A;  1SFO A;  2A6E D;  3N0B A;  2BE5 D;  3GTP A;  2JA6 A;  2JA5 A;  3NUH A;  4LR2 A;  4G0W A;  1O25 A;  5EGH A;  4GFQ A;  3WVO A;  3MML B;  1MIU A;  1SMY D;  1YNJ D;  1Y1V A;  3ERE D;  4DDQ A;  5CQG A;  1A35 A;  1K4S A;  2GSU A;  3LAP A;  1EK8 A;  4KB2 A;  2GSO A;  2XCQ A;  2WAQ A;  1TWC A;  2R4G A;  4H3T A;  3OPF A;  5JVO A;  4AYB A;  3GTL A;  4IP8 A;  3G4A A;  2O5J D;  5C9H A;  4JLR C;  2XCO A;  2Y3P A;  1T8I A;  3GTJ A;  3OEP A;  1O26 A;  1BGW A;  4NOL A;  3N0C A;  1R9T A;  3Q3Q A;  1ISE A;  4KMH A;  1KQ4 A;  4AHC A;  2E2I A;  3FKI A;  3GTQ A;  4L8I A;  4G0U A;  5JFE A;  1O27 A;  4F3E A;  1I3Q A;  1RR8 C;  1K83 A;  4GTF A;  3K59 A;  3S0X A;  3FOE A;  5IOS A;  3L4K A;  3FOF A;  3AH5 A;  4C2M A;  1WQG A;  3CQZ A;  4FM9 A;  4KM8 A;  4KM9 A;  2YU9 A;  1ZBS A;  4GT9 A;  5IOT A;  3LPX A;  4KMA A;  2PHC B;  3KYL A;  4FYD A;  4EJ3 A;  4G0V A;  4FZB A;  3G4C A;  2R7Z A;  5IOQ A;  3N3Y A;  2Y0S A;  2WB1 A;  4J3N A;  1HQM D;  5CHP A;  2VUM A;  3CAG A;  4NOK A;  4BLA A;  4KDD A;  2P5M A;  1O24 A;  3MAQ A;  4D3Y A;  1IW7 D;  2KWA A;  1Y69 8;  4KC6 A;  3GTK A;  5EGE A;  5MLC 9;  2CW0 D;  1ZYR D;  1SEU A;  3LF9 A;  4KAS A;  3K58 A;  1F9N A;  3SJR A;  2RGR A;  2RH6 A;  3ORE A;  3K5M A;  1ZXO A;  2CFA B;  4O26 A;  4GTL A;  4C2M C;  1TGO A;  3BUE A;  4P5A A;  3HKZ A;  2NVX A;  2PMZ A;  1V9M A;  2JH3 A;  3L4J A;  1WCM A;  3K5N A;  1TL8 A;  1LPQ A;  1I50 A;  1I6V D;  3GTM A;  1TWF A;  1Q8I A;  3P9A A;  3AQP A;  3QX3 A;  2JA7 A;  3V4G A;  1TWG A;  1NH3 A;  1R49 A;  1K4T A;  2R93 A;  4FGU A;  4QIW A;  2XCR B;  1AB4 A;  3K5O A;  1WIH A;  5JSN B;  3GTG A;  1Y1W A;  4BLB A;  4GTB A;  4GTA A;  2A69 D;  4KAW X;  5JSB B;  4M1X A;  3LHP S;  3GTO A;  1BJT A;  1XXA A;  5TJ3 A;  4KAR A;  4LMO A;  1R5Z A;  1WQH A;  1GE9 A;  1XXC A;  2GSN A;  4D3Z A;  1EJ9 A;  1A31 A;  1EH1 A;  4ILD A;  5CJ9 A;  2F4Q A;  4GTC A;  1O28 A;  1DD5 A;  2CFA A;  2R92 A;  3K5L A;  4C3J C;  1B4A A;  2B63 A;  3LAJ A;  1RRJ A;  1O29 A;  2ZFZ A;  2E2H A;  1IS1 A;  4QCL A;  1XXB A;  1WQF A;  4KB4 A;  1ZVU A;  4KAT A;  4C3I C;  3K57 A;  5IOR A;  3FHZ A;  3M4A A;  2A68 D;  2B9S B;  3IAY A;  1B4B A;  4P5B A;  4FXD A;  4Q5V A;  1O2B A;  2NVY A;  4IP9 A;  1O2A A;  4BKW A;  4GTD A;  1YNN D;  3VA7 A;  4AN8 A;  3DU6 A;  4KMD A;  4Q5G A;  4GTE A;  4LQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...