1EK8A

Crystal structure of the ribosome recycling factor (rrf) from escherichia coli
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
185
Chain Sequence
MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ribosome recycling factor from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
molecule keywords RIBOSOME RECYCLING FACTOR
total genus 60
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2000-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1ek8A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1ek8A02
4GFQA 1DD5A 3LHPS 4KB2A 2XCQA 3BUEA 3L4KA 4KC6A 3CAGA 5JSBB 4KAWX 2RGRA 1WQGA 2P5MA 1ISEA 4KDDA 5JSNB 3FOEA 1WQFA 3OEPA 1EH1A 3OPFA 1EK8A 3OREA 4DDQA 3L4JA 3QX3A 2KWAA 4G0VA 5CJ9A 4J3NA 1WIHA 1WQHA 2Y3PA 3ERED 4G0WA 3LAJA 1B4AA 3FOFA 3NUHA 3MMLB 4G0UA 1AB4A 3LPXA 4OYDB 1BGWA 5MLC9 4JLRC 1Y698 1GE9A 1F9NA 2PHCB 1XXAA 4FM9A 1ZVUA 4KB4A 2XCOA 3V4GA 3FHZA 1BJTA 3VA7A 2ZFZA 1XXBA 2XCRB 1XXCA 1IS1A 3LAPA 1B4BA 4L8IA 5JVOA 3LF9A
chains in the Genus database with same CATH superfamily
1USMA 1YX2A 2E2HC 3HKZL 1F7UA 4BY7K 4A3DK 1IE0A 4Y7NK 5JSBB 3KYLA 3RZDC 4OIRA 2NVQC 1IL2A 2JA7A 4F3EA 2FQOA 1HI9A 3OEPA 3MAQA 4G0VA 4WJ3M 2WAQA 1R49A 3DXJA 3GTGC 3K5LA 1EJ9A 1ZYRD 5HL8A 5IP7C 2R4GA 1TWGC 3MMLB 1Y1VA 4GT9A 3GEHA 2V6UA 5C3EC 3PO3C 1SC7A 2ZFZA 2PMZL 3S1MK 1NH3A 3HOZC 2R7ZK 2A6HA 4JK1A 4G7OA 3K7AK 3LHPS 3IAYA 3K5NA 1YNND 4BBSK 1I3QA 2GSUA 4KN7A 2D6FC 4XLNA 1TWHC 3HOUK 1R9TC 3M4OK 4D3YA 4DDQA 4NOMA 2Y3PA 1XPPA 4AYBL 2Y0SD 1I50C 5IOSA 1L0WA 2JA5A 1TWAK 2E2HK 1J6VA 1ZVUA 2BE5A 1WOOA 4GTDA 4A3DC 2NVXC 3RZDK 2NVQK 3GTPK 2XCRB 2A68D 3SZYA 2R93C 3DU5A 3GTMK 4BXXC 1O2AA 3GTKK 3GDZA 2RGRA 4C3HC 2A6HD 3GTKA 1TWFC 3PO3K 4LK1A 1A35A 4O2DA 3AQOA 4WJ4A 5C44K 4BY1K 3K7AC 4RMFA 3GTJC 3GTQC 1JQWA 3FKIK 4AHCA 2R92A 1WOSA 1R9TK 1IQ0A 1Y1WK 1A31A 4G7HA 2CFAA 2JA6K 1VRQC 2JH3A 3I4NK 1TWAC 5JSNB 5E68A 4A3IC 1XZQB 2E2JC 1O2BA 4ILDA 1WORA 3TFIA 5EGHA 4GTEA 4ZH4A 4G0UA 3GTKC 4AYBD 4A3FC 3GTOC 1I50A 4FM9A 2JA5C 3V4GA 2V6TA 3GEEA 2R7ZA 3HOXK 3K57A 4GZYA 1XXCA 4A3GK 4P5AA 3CQZC 3L4KA 1WSRA 4XSXA 1ZXOA 3HOYC 1R9TA 5C44C 1RRJA 4LQYA 3BP8C 4GTBA 2JA6A 1SFOK 3PO2K 4KMUA 1I6HC 4O26A 1PJ6A 1IW7A 2KWAA 2A69A 3S16C 1K4TA 2NVYC 1G51A 3FKIC 4BBRC 3S14K 2JA7K 1XZQA 5MLC9 1BS2A 3S15C 3P9AA 4M1XA 4OIOA 5IP9K 2GSOA 4A3MK 2E2IK 5TJ3A 1DCOA 1I3QK 4GTLA 4A3IK 4QJVA 4A3KC 5JVOA 2E2JK 1WCMK 3H0GK 4FXDA 2PMZD 4X6AK 1O2FB 3GTOK 5D4DA 1WCMA 3GEIA 4A93C 5TMCA 3OREA 2A6ED 4YG2A 4XLPA 3S2DK 5M5YK 1SFOA 5C4XC 1EI6A 3WVOA 3GTGA 2JA8C 4GTFA 5C4JK 3S0XA 1Y1VC 3T00A 4Y7NC 3H3VD 2O5JD 3HOYK 5IYBK 2B9SB 2Y0SA 1B4BA 4GTAA 3AD9C 1WSVA 5CHPA 2P8TA 2A6EA 3TFHA 1ZQ1C 5IP7K 3M3YK 1UV7A 1SMYA 4NOIA 5C3EK 1WQFA 2B63A 3GTJA 3GTQA 3ERED 1F93A 2YU9C 2WB1A 3HOZK 3ADAC 5FLMK 2WAQL 3S1QK 4JLRC 1F9NA 1YNJD 3FHZA 4KM8A 3H0GC 4P5BA 2VUMA 4PAAA 5IYDK 3HKZA 1VJEA 4IP8A 4H3TA 4D3ZA 1TWGA 4KAWX 4OINA 3N3YA 4KMDA 3TTGA 4C3JC 4KMAA 1TL8A 1Y1VK 3L4JA 2GSNA 3GTPC 1RR8C 4Q5VA 2O5JA 4OIQA 2R93K 1SEUA 3GTMC 4KN4A 4BXXK 4C2MA 1AB4A 3LPXA 3CQZA 4YFKA 3RZOK 1TWCA 4LLGA 3M3YC 1O26A 3K5MA 4A3CK 4Q5SA 2RH6A 4L8IA 4YFXA 2XCQA 3GTOA 3EQLA 3G4AA 3I4MC 1XZPB 1K83C 4XCHA 1WQGA 4BY1C 4LOWA 3GSIA 1EH1A 1EK8A 4A3EK 5IYCK 4OIPA 1WQHA 4G0WA 5IYDC 4QIWL 3FOFA 1ZBSA 2NVTK 1Y698 2WAQD 4KB4A 2JA6C 1PJ5A 3G4CA 4PABA 5L46A 3SZZA 3N0CA 2WB1D 4C3JK 3H0GA 1V5VA 3K5OA 3LAPA 3IPJA 5IOQA 3S17C 4KASA 4KC6A 4Q5GA 1RU0A 3N0BA 4A3LC 4A3FK 2P5MA 3RZOC 4KDDA 1YCLA 1VLOA 3A8KA 2JA5K 3WODA 2YU9A 5M5XK 4A3CC 2A68A 1DCPA 4A3GC 2VUMK 2PHCB 2F4QA 1J6XA 1PJ7A 1BJTA 1USOA 3VA7A 3K59A 1K83K 1IS1A 2B63C 1SFOC 3PO2C 1I6HK 3HOWC 4A3EC 4Q4ZA 4KB2A 3K58A 5IYCC 1O29A 3S14C 3CAGA 3S1RC 2NVTC 2W7VA 1HQMA 2GAGC 4G7ZA 5IP9C 4BY7C 4A3MC 2E2IC 4KMHA 1I3QC 3HXAA 4A3JC 5IOTA 2R92K 1INNA 2XCOA 4BKWA 4BLAA 2ZUEA 4X6AC 3S2HK 1XZPA 1O28A 3H3VL 1HQMD 4QJVB 4MEYA 3TFJA 3S2DC 4EJ3A 5M3MK 3GTMA 3FKIA 4C45A 4KARA 5C4XK 1A36A 1EQRA 2JA8K 1R5ZA 3FOEA 1VGXA 5C4JC 2VUMC 1TGOA 1TWHA 2V6SA 5IYBC 4LR2A 1SMYD 2B63K 4LMOA 1I6VA 4AH6A 4OYDB 3HKZD 5C9HA 1GE9A 4LK0A 3JSTA 3AD8C 3BP3A 1YNNA 3S1RK 1Q8IA 3Q3QA 4C2MK 1TWCK 1KQ4A 4GFQA 4QIWA 4A3BK 3GIRA 2ZUFA 2NVXK 2YU9K 4BLBA 5FLMC 4A3JK 1ISEA 3S1QC 4C3IK 2R92C 2CFAB 1LPQA 4NOLA 4Y52K 5EGEA 2E2HA 4FGUA 3S2HC 1B4AA 4C3HK 4QCLA 5TMFA 1V9MA 1BGWA 1TWFK 4YFNA 1F7VA 3S1NC 1IW7D 1JVIA 5M5WK 2PPBA 1XXBA 1WOPA 1MIUA 2BE5D 2PA8L 3GTJK 3GTQK 3A8IA 4AN8A 3OPFA 1Y1WC 3DU6A 3AH5A 4MEXA 4WILA 5CJ9A 1VH2A 1IBAA 1T8IA 4C2MC 2PMZA 3M4AA 1JOEA 3NUHA 1TWCC 1J6WA 3GTLC 3I4NC 4GTCA 1O24A 4FZBA 4A3BC 1XXAA 4QIWD 3SJRA 3I4MK 3AQPA 1TWFA 5IORA 4C3IC 3HOVC 2FQTA 2CW0D 2WB1L 1DD5A 4Y52C 3BUEA 4IP9A 1K83A 3GTPA 3HOXC 1ZYRA 2EBBA 3S1NK 1K4SA 2PA8D 1WIHA 3CQZK 3T01A 3LAJA 2NVYA 2GAHC 3S17K 1Y1WA 2Y0SL 4P9SA 3A8JA 1X31C 3GTGK 1DCHA 5FJ8K 3S16K 4A3LK 1TWAA 2NVYK 4BBRK 3T02A 1TWGK 3GTLA 2NVXA 1O25A 2JA7C 5JFEA 3LF9A 1YNJA 3QX3A 4XSZA 3S15K 2A69D 5M3FK 4KM9A 3GTLK 1O27A 3S1MC 4AYBA 1C0AA 4NOKA 3AD7C 2R7ZC 4A3KK 4MQ9A 1WCMC 4J3NA 2O5IA 4KATA 4LJZA 1BDFA 4BBSC 3HOVK 5CQGA 1J98A 2E2IA 3HOWK 1TWHK 2CW0A 3HOUC 4A93K 3M4OC 1EFWA 2R93A 1I6VD 4FYDA 1I50K
chains in the Genus database with same CATH topology
4GFQA 4QIWA 2XCQA 3GTOA 4P5AA 3L4KA 3G4AA 1ZXOA 5JSBB 3KYLA 1R9TA 4BLBA 1RRJA 1WQGA 1ISEA 4LQYA 2JA7A 4F3EA 4GTBA 2JA6A 3OEPA 3MAQA 1EH1A 1LPQA 1EK8A 2CFAB 4O26A 4G0VA 2WAQA 4NOLA 1R49A 2KWAA 5EGEA 1WQHA 3K5LA 1EJ9A 1ZYRD 4FGUA 1K4TA 2E2HA 4G0WA 2R4GA 1B4AA 3FOFA 1ZBSA 1Y1VA 3MMLB 4GT9A 4QCLA 1V9MA 5MLC9 1BGWA 1Y698 1IW7D 3P9AA 4KB4A 4M1XA 3G4CA 1SC7A 2GSOA 2ZFZA 3N0CA 1XXBA 5TJ3A 3H0GA 4GTLA 1MIUA 3K5OA 1NH3A 3LAPA 5JVOA 2BE5D 5IOQA 3LHPS 4KASA 3IAYA 3K5NA 1YNND 4KC6A 4Q5GA 3N0BA 1I3QA 2GSUA 4FXDA 2P5MA 4KDDA 4AN8A 1WCMA 3OPFA 2YU9A 4D3YA 2A6ED 3OREA 4DDQA 3DU6A 3AH5A 5CJ9A 4NOMA 1T8IA 2Y3PA 4C2MC 1SFOA 2PMZA 3M4AA 3NUHA 5IOSA 3WVOA 3GTGA 2JA5A 4GTCA 4GTFA 1O24A 4FZBA 2PHCB 2F4QA 1XXAA 3SJRA 1ZVUA 4GTDA 3S0XA 1BJTA 3VA7A 2O5JD 3K59A 3AQPA 2B9SB 2Y0SA 1TWFA 2XCRB 2A68D 5IORA 4C3IC 1IS1A 3DU5A 1B4BA 4GTAA 1O2AA 5CHPA 2CW0D 1DD5A 4KB2A 3K58A 3BUEA 1O29A 4IP9A 1K83A 3GTPA 3CAGA 2RGRA 4C3HC 2A6HD 3GTKA 1WQFA 2B63A 1K4SA 3GTJA 1A35A 3GTQA 1WIHA 3ERED 4KMHA 3LAJA 2WB1A 3AQOA 2NVYA 4JLRC 1F9NA 5IOTA 1YNJD 1Y1WA 2XCOA 3FHZA 4BKWA 4BLAA 4KM8A 4P5BA 1TWAA 2VUMA 4AHCA 3GTLA 2NVXA 1O28A 1O25A 3HKZA 2R92A 1HQMD 5JFEA 3LF9A 3QX3A 1A31A 4IP8A 2CFAA 2A69D 4EJ3A 3GTMA 4H3TA 4KM9A 3FKIA 1TWGA 4KAWX 4D3ZA 2JH3A 3N3YA 4KARA 1A36A 4KMDA 1O27A 4C3JC 1R5ZA 5JSNB 4AYBA 4KMAA 4NOKA 3FOEA 1TL8A 1TGOA 1TWHA 3L4JA 2GSNA 4J3NA 1RR8C 4Q5VA 1O2BA 4ILDA 4LR2A 4KATA 5EGHA 1SMYD 1SEUA 4GTEA 4LMOA 4G0UA 5CQGA 4C2MA 2E2IA 1AB4A 3LPXA 3CQZA 4OYDB 1TWCA 1I50A 5C9HA 1GE9A 4FM9A 3V4GA 2R7ZA 3K57A 2R93A 1O26A 3K5MA 1I6VD 1Q8IA 4FYDA 1XXCA 2RH6A 3Q3QA 1KQ4A 4L8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GFQ A;  1DD5 A;  3LHP S;  4KB2 A;  2XCQ A;  3BUE A;  3L4K A;  4KC6 A;  3CAG A;  5JSB B;  4KAW X;  2RGR A;  1WQG A;  2P5M A;  1ISE A;  4KDD A;  5JSN B;  3FOE A;  1WQF A;  3OEP A;  1EH1 A;  3OPF A;  1EK8 A;  3ORE A;  4DDQ A;  3L4J A;  3QX3 A;  2KWA A;  4G0V A;  5CJ9 A;  4J3N A;  1WIH A;  1WQH A;  2Y3P A;  3ERE D;  4G0W A;  3LAJ A;  1B4A A;  3FOF A;  3NUH A;  3MML B;  4G0U A;  1AB4 A;  3LPX A;  4OYD B;  1BGW A;  5MLC 9;  4JLR C;  1Y69 8;  1GE9 A;  1F9N A;  2PHC B;  1XXA A;  4FM9 A;  1ZVU A;  4KB4 A;  2XCO A;  3V4G A;  3FHZ A;  1BJT A;  3VA7 A;  2ZFZ A;  1XXB A;  2XCR B;  1XXC A;  1IS1 A;  3LAP A;  1B4B A;  4L8I A;  5JVO A;  3LF9 A; 
#chains in the Genus database with same CATH topology
 1USM A;  1YX2 A;  2E2H C;  3HKZ L;  1F7U A;  4BY7 K;  4A3D K;  1IE0 A;  4Y7N K;  5JSB B;  3KYL A;  3RZD C;  4OIR A;  2NVQ C;  1IL2 A;  2JA7 A;  4F3E A;  2FQO A;  1HI9 A;  3OEP A;  3MAQ A;  4G0V A;  4WJ3 M;  2WAQ A;  1R49 A;  3DXJ A;  3GTG C;  3K5L A;  1EJ9 A;  1ZYR D;  5HL8 A;  5IP7 C;  2R4G A;  1TWG C;  3MML B;  1Y1V A;  4GT9 A;  3GEH A;  2V6U A;  5C3E C;  3PO3 C;  1SC7 A;  2ZFZ A;  2PMZ L;  3S1M K;  1NH3 A;  3HOZ C;  2R7Z K;  2A6H A;  4JK1 A;  4G7O A;  3K7A K;  3LHP S;  3IAY A;  3K5N A;  1YNN D;  4BBS K;  1I3Q A;  2GSU A;  4KN7 A;  2D6F C;  4XLN A;  1TWH C;  3HOU K;  1R9T C;  3M4O K;  4D3Y A;  4DDQ A;  4NOM A;  2Y3P A;  1XPP A;  4AYB L;  2Y0S D;  1I50 C;  5IOS A;  1L0W A;  2JA5 A;  1TWA K;  2E2H K;  1J6V A;  1ZVU A;  2BE5 A;  1WOO A;  4GTD A;  4A3D C;  2NVX C;  3RZD K;  2NVQ K;  3GTP K;  2XCR B;  2A68 D;  3SZY A;  2R93 C;  3DU5 A;  3GTM K;  4BXX C;  1O2A A;  3GTK K;  3GDZ A;  2RGR A;  4C3H C;  2A6H D;  3GTK A;  1TWF C;  3PO3 K;  4LK1 A;  1A35 A;  4O2D A;  3AQO A;  4WJ4 A;  5C44 K;  4BY1 K;  3K7A C;  4RMF A;  3GTJ C;  3GTQ C;  1JQW A;  3FKI K;  4AHC A;  2R92 A;  1WOS A;  1R9T K;  1IQ0 A;  1Y1W K;  1A31 A;  4G7H A;  2CFA A;  2JA6 K;  1VRQ C;  2JH3 A;  3I4N K;  1TWA C;  5JSN B;  5E68 A;  4A3I C;  1XZQ B;  2E2J C;  1O2B A;  4ILD A;  1WOR A;  3TFI A;  5EGH A;  4GTE A;  4ZH4 A;  4G0U A;  3GTK C;  4AYB D;  4A3F C;  3GTO C;  1I50 A;  4FM9 A;  2JA5 C;  3V4G A;  2V6T A;  3GEE A;  2R7Z A;  3HOX K;  3K57 A;  4GZY A;  1XXC A;  4A3G K;  4P5A A;  3CQZ C;  3L4K A;  1WSR A;  4XSX A;  1ZXO A;  3HOY C;  1R9T A;  5C44 C;  1RRJ A;  4LQY A;  3BP8 C;  4GTB A;  2JA6 A;  1SFO K;  3PO2 K;  4KMU A;  1I6H C;  4O26 A;  1PJ6 A;  1IW7 A;  2KWA A;  2A69 A;  3S16 C;  1K4T A;  2NVY C;  1G51 A;  3FKI C;  4BBR C;  3S14 K;  2JA7 K;  1XZQ A;  5MLC 9;  1BS2 A;  3S15 C;  3P9A A;  4M1X A;  4OIO A;  5IP9 K;  2GSO A;  4A3M K;  2E2I K;  5TJ3 A;  1DCO A;  1I3Q K;  4GTL A;  4A3I K;  4QJV A;  4A3K C;  5JVO A;  2E2J K;  1WCM K;  3H0G K;  4FXD A;  2PMZ D;  4X6A K;  1O2F B;  3GTO K;  5D4D A;  1WCM A;  3GEI A;  4A93 C;  5TMC A;  3ORE A;  2A6E D;  4YG2 A;  4XLP A;  3S2D K;  5M5Y K;  1SFO A;  5C4X C;  1EI6 A;  3WVO A;  3GTG A;  2JA8 C;  4GTF A;  5C4J K;  3S0X A;  1Y1V C;  3T00 A;  4Y7N C;  3H3V D;  2O5J D;  3HOY K;  5IYB K;  2B9S B;  2Y0S A;  1B4B A;  4GTA A;  3AD9 C;  1WSV A;  5CHP A;  2P8T A;  2A6E A;  3TFH A;  1ZQ1 C;  5IP7 K;  3M3Y K;  1UV7 A;  1SMY A;  4NOI A;  5C3E K;  1WQF A;  2B63 A;  3GTJ A;  3GTQ A;  3ERE D;  1F93 A;  2YU9 C;  2WB1 A;  3HOZ K;  3ADA C;  5FLM K;  2WAQ L;  3S1Q K;  4JLR C;  1F9N A;  1YNJ D;  3FHZ A;  4KM8 A;  3H0G C;  4P5B A;  2VUM A;  4PAA A;  5IYD K;  3HKZ A;  1VJE A;  4IP8 A;  4H3T A;  4D3Z A;  1TWG A;  4KAW X;  4OIN A;  3N3Y A;  4KMD A;  3TTG A;  4C3J C;  4KMA A;  1TL8 A;  1Y1V K;  3L4J A;  2GSN A;  3GTP C;  1RR8 C;  4Q5V A;  2O5J A;  4OIQ A;  2R93 K;  1SEU A;  3GTM C;  4KN4 A;  4BXX K;  4C2M A;  1AB4 A;  3LPX A;  3CQZ A;  4YFK A;  3RZO K;  1TWC A;  4LLG A;  3M3Y C;  1O26 A;  3K5M A;  4A3C K;  4Q5S A;  2RH6 A;  4L8I A;  4YFX A;  2XCQ A;  3GTO A;  3EQL A;  3G4A A;  3I4M C;  1XZP B;  1K83 C;  4XCH A;  1WQG A;  4BY1 C;  4LOW A;  3GSI A;  1EH1 A;  1EK8 A;  4A3E K;  5IYC K;  4OIP A;  1WQH A;  4G0W A;  5IYD C;  4QIW L;  3FOF A;  1ZBS A;  2NVT K;  1Y69 8;  2WAQ D;  4KB4 A;  2JA6 C;  1PJ5 A;  3G4C A;  4PAB A;  5L46 A;  3SZZ A;  3N0C A;  2WB1 D;  4C3J K;  3H0G A;  1V5V A;  3K5O A;  3LAP A;  3IPJ A;  5IOQ A;  3S17 C;  4KAS A;  4KC6 A;  4Q5G A;  1RU0 A;  3N0B A;  4A3L C;  4A3F K;  2P5M A;  3RZO C;  4KDD A;  1YCL A;  1VLO A;  3A8K A;  2JA5 K;  3WOD A;  2YU9 A;  5M5X K;  4A3C C;  2A68 A;  1DCP A;  4A3G C;  2VUM K;  2PHC B;  2F4Q A;  1J6X A;  1PJ7 A;  1BJT A;  1USO A;  3VA7 A;  3K59 A;  1K83 K;  1IS1 A;  2B63 C;  1SFO C;  3PO2 C;  1I6H K;  3HOW C;  4A3E C;  4Q4Z A;  4KB2 A;  3K58 A;  5IYC C;  1O29 A;  3S14 C;  3CAG A;  3S1R C;  2NVT C;  2W7V A;  1HQM A;  2GAG C;  4G7Z A;  5IP9 C;  4BY7 C;  4A3M C;  2E2I C;  4KMH A;  1I3Q C;  3HXA A;  4A3J C;  5IOT A;  2R92 K;  1INN A;  2XCO A;  4BKW A;  4BLA A;  2ZUE A;  4X6A C;  3S2H K;  1XZP A;  1O28 A;  3H3V L;  1HQM D;  4QJV B;  4MEY A;  3TFJ A;  3S2D C;  4EJ3 A;  5M3M K;  3GTM A;  3FKI A;  4C45 A;  4KAR A;  5C4X K;  1A36 A;  1EQR A;  2JA8 K;  1R5Z A;  3FOE A;  1VGX A;  5C4J C;  2VUM C;  1TGO A;  1TWH A;  2V6S A;  5IYB C;  4LR2 A;  1SMY D;  2B63 K;  4LMO A;  1I6V A;  4AH6 A;  4OYD B;  3HKZ D;  5C9H A;  1GE9 A;  4LK0 A;  3JST A;  3AD8 C;  3BP3 A;  1YNN A;  3S1R K;  1Q8I A;  3Q3Q A;  4C2M K;  1TWC K;  1KQ4 A;  4GFQ A;  4QIW A;  4A3B K;  3GIR A;  2ZUF A;  2NVX K;  2YU9 K;  4BLB A;  5FLM C;  4A3J K;  1ISE A;  3S1Q C;  4C3I K;  2R92 C;  2CFA B;  1LPQ A;  4NOL A;  4Y52 K;  5EGE A;  2E2H A;  4FGU A;  3S2H C;  1B4A A;  4C3H K;  4QCL A;  5TMF A;  1V9M A;  1BGW A;  1TWF K;  4YFN A;  1F7V A;  3S1N C;  1IW7 D;  1JVI A;  5M5W K;  2PPB A;  1XXB A;  1WOP A;  1MIU A;  2BE5 D;  2PA8 L;  3GTJ K;  3GTQ K;  3A8I A;  4AN8 A;  3OPF A;  1Y1W C;  3DU6 A;  3AH5 A;  4MEX A;  4WIL A;  5CJ9 A;  1VH2 A;  1IBA A;  1T8I A;  4C2M C;  2PMZ A;  3M4A A;  1JOE A;  3NUH A;  1TWC C;  1J6W A;  3GTL C;  3I4N C;  4GTC A;  1O24 A;  4FZB A;  4A3B C;  1XXA A;  4QIW D;  3SJR A;  3I4M K;  3AQP A;  1TWF A;  5IOR A;  4C3I C;  3HOV C;  2FQT A;  2CW0 D;  2WB1 L;  1DD5 A;  4Y52 C;  3BUE A;  4IP9 A;  1K83 A;  3GTP A;  3HOX C;  1ZYR A;  2EBB A;  3S1N K;  1K4S A;  2PA8 D;  1WIH A;  3CQZ K;  3T01 A;  3LAJ A;  2NVY A;  2GAH C;  3S17 K;  1Y1W A;  2Y0S L;  4P9S A;  3A8J A;  1X31 C;  3GTG K;  1DCH A;  5FJ8 K;  3S16 K;  4A3L K;  1TWA A;  2NVY K;  4BBR K;  3T02 A;  1TWG K;  3GTL A;  2NVX A;  1O25 A;  2JA7 C;  5JFE A;  3LF9 A;  1YNJ A;  3QX3 A;  4XSZ A;  3S15 K;  2A69 D;  5M3F K;  4KM9 A;  3GTL K;  1O27 A;  3S1M C;  4AYB A;  1C0A A;  4NOK A;  3AD7 C;  2R7Z C;  4A3K K;  4MQ9 A;  1WCM C;  4J3N A;  2O5I A;  4KAT A;  4LJZ A;  1BDF A;  4BBS C;  3HOV K;  5CQG A;  1J98 A;  2E2I A;  3HOW K;  1TWH K;  2CW0 A;  3HOU C;  4A93 K;  3M4O C;  1EFW A;  2R93 A;  1I6V D;  4FYD A;  1I50 K; 
#chains in the Genus database with same CATH homology
 4GFQ A;  4QIW A;  2XCQ A;  3GTO A;  4P5A A;  3L4K A;  3G4A A;  1ZXO A;  5JSB B;  3KYL A;  1R9T A;  4BLB A;  1RRJ A;  1WQG A;  1ISE A;  4LQY A;  2JA7 A;  4F3E A;  4GTB A;  2JA6 A;  3OEP A;  3MAQ A;  1EH1 A;  1LPQ A;  1EK8 A;  2CFA B;  4O26 A;  4G0V A;  2WAQ A;  4NOL A;  1R49 A;  2KWA A;  5EGE A;  1WQH A;  3K5L A;  1EJ9 A;  1ZYR D;  4FGU A;  1K4T A;  2E2H A;  4G0W A;  2R4G A;  1B4A A;  3FOF A;  1ZBS A;  1Y1V A;  3MML B;  4GT9 A;  4QCL A;  1V9M A;  5MLC 9;  1BGW A;  1Y69 8;  1IW7 D;  3P9A A;  4KB4 A;  4M1X A;  3G4C A;  1SC7 A;  2GSO A;  2ZFZ A;  3N0C A;  1XXB A;  5TJ3 A;  3H0G A;  4GTL A;  1MIU A;  3K5O A;  1NH3 A;  3LAP A;  5JVO A;  2BE5 D;  5IOQ A;  3LHP S;  4KAS A;  3IAY A;  3K5N A;  1YNN D;  4KC6 A;  4Q5G A;  3N0B A;  1I3Q A;  2GSU A;  4FXD A;  2P5M A;  4KDD A;  4AN8 A;  1WCM A;  3OPF A;  2YU9 A;  4D3Y A;  2A6E D;  3ORE A;  4DDQ A;  3DU6 A;  3AH5 A;  5CJ9 A;  4NOM A;  1T8I A;  2Y3P A;  4C2M C;  1SFO A;  2PMZ A;  3M4A A;  3NUH A;  5IOS A;  3WVO A;  3GTG A;  2JA5 A;  4GTC A;  4GTF A;  1O24 A;  4FZB A;  2PHC B;  2F4Q A;  1XXA A;  3SJR A;  1ZVU A;  4GTD A;  3S0X A;  1BJT A;  3VA7 A;  2O5J D;  3K59 A;  3AQP A;  2B9S B;  2Y0S A;  1TWF A;  2XCR B;  2A68 D;  5IOR A;  4C3I C;  1IS1 A;  3DU5 A;  1B4B A;  4GTA A;  1O2A A;  5CHP A;  2CW0 D;  1DD5 A;  4KB2 A;  3K58 A;  3BUE A;  1O29 A;  4IP9 A;  1K83 A;  3GTP A;  3CAG A;  2RGR A;  4C3H C;  2A6H D;  3GTK A;  1WQF A;  2B63 A;  1K4S A;  3GTJ A;  1A35 A;  3GTQ A;  1WIH A;  3ERE D;  4KMH A;  3LAJ A;  2WB1 A;  3AQO A;  2NVY A;  4JLR C;  1F9N A;  5IOT A;  1YNJ D;  1Y1W A;  2XCO A;  3FHZ A;  4BKW A;  4BLA A;  4KM8 A;  4P5B A;  1TWA A;  2VUM A;  4AHC A;  3GTL A;  2NVX A;  1O28 A;  1O25 A;  3HKZ A;  2R92 A;  1HQM D;  5JFE A;  3LF9 A;  3QX3 A;  1A31 A;  4IP8 A;  2CFA A;  2A69 D;  4EJ3 A;  3GTM A;  4H3T A;  4KM9 A;  3FKI A;  1TWG A;  4KAW X;  4D3Z A;  2JH3 A;  3N3Y A;  4KAR A;  1A36 A;  4KMD A;  1O27 A;  4C3J C;  1R5Z A;  5JSN B;  4AYB A;  4KMA A;  4NOK A;  3FOE A;  1TL8 A;  1TGO A;  1TWH A;  3L4J A;  2GSN A;  4J3N A;  1RR8 C;  4Q5V A;  1O2B A;  4ILD A;  4LR2 A;  4KAT A;  5EGH A;  1SMY D;  1SEU A;  4GTE A;  4LMO A;  4G0U A;  5CQG A;  4C2M A;  2E2I A;  1AB4 A;  3LPX A;  3CQZ A;  4OYD B;  1TWC A;  1I50 A;  5C9H A;  1GE9 A;  4FM9 A;  3V4G A;  2R7Z A;  3K57 A;  2R93 A;  1O26 A;  3K5M A;  1I6V D;  1Q8I A;  4FYD A;  1XXC A;  2RH6 A;  3Q3Q A;  1KQ4 A;  4L8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...