2R4GA

The high resolution structure of the rna-binding domain of telomerase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
261
structure length
250
Chain Sequence
b'KVIQEKLKPDHPQTIIKKTLLKEYQSKNFSCQEERDLFLEFTEKIVQNFHNINFNYLLKKFCKLPENYQSLKSQVKQIVQSENKANQQSCENLFNSLYDTEISYKQITNFLRQIIQNCVPNQLLGKKNFKVFLEKLYEFVQMKRFENQKVLDYICFMDVFDVEWFVDLKNQKFTQKRKYISDKRKILGDLIVFIINKIVIPVLRYNFYITEKHKEGSQIFYYRKPIWKLVSKLTIVKLEEENLEKVEEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase reverse transcriptase
publication title Structure of the RNA-Binding Domain of Telomerase: Implications for RNA Recognition and Binding.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase
total genus 89
structure length 250
sequence length 261
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1970 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2r4gA02
1.10.132.70 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 2r4gA01
5C9HA 2R4GA 4LMOA 5CQGA 3DU5A 4O26A 3DU6A 3KYLA
chains in the Genus database with same CATH superfamily
4C9YA 2QCOA 1QPMA 4IHXA 4BL0B 1YTYA 1T39A 3GTQJ 5DDGA 4RB3C 2KJBA 5F08A 3GTMJ 3I59A 1UZCA 2R92A 2MC3A 4AYBA 2AXLA 3TDZC 2X0LA 1OYIA 4EJWA 2EINH 4X6AJ 5L3BA 3JAMZ 5E1WA 1OLTA 5D5XB 3LSMA 4HYEA 2DMUA 3ZN0A 3BP8A 2MC4A 3KFWX 2QM3A 1R71A 3OYEA 2EFWA 2VKEA 3IRQA 2ZJ2A 5K7HA 1I6XA 4XIDA 1I39A 3GVAA 4FGUA 2FOWA 4A5MA 2K5CA 2MH9A 3GTJA 2CO5A 2ZMEB 1Y8QB 2VONA 3CMMA 2CQQA 1HW2A 3BZCA 4EV0A 4MFEA 2LTPA 2BGCA 3F72A 1A04A 3BG9A 4NDLA 2IW5A 3MQ0A 2CUEA 2NOJB 4G8XA 2OTJI 4E7LA 3SJRA 3I4PA 3QPSA 4FTHA 4A3MJ 2R5YB 3OYLA 2P0WA 3CLQA 4UUTA 2UXNA 2M1BA 5FO5A 3F0CA 5J6XA 2Y0MA 1N25A 5H6QA 4OINF 1VQMI 3QP5A 3MCZA 3KZZA 2HTJA 1KGSA 2E5NA 4AU7A 3LSRA 2CSOA 2ECCA 4E7KA 2DT6A 2XF6A 3K5NA 1G3YA 1W4MA 2L4MA 3E5QA 3LA7A 3S2HJ 1G2HA 2FBIA 2YUSA 1STZA 1WH5A 4Y33A 1CQTA 3W6VA 2R7ZJ 1L0OC 3J7ZI 5BPDA 1ZG5A 4U0VA 1K4TA 5HLHA 3QYEA 4M6YA 1YO5C 2M3AA 4XRSA 3I55I 2FF4A 1TNTA 3KIOA 4KIFA 1WGXA 4L9TA 3BG3A 2DT5A 4N9IA 3WU0A 4BKXA 1UG2A 1JXSA 4RM2A 1EK8A 3H36A 3K4BA 1TQMA 4BUPA 4ZJZA 1IXCA 3COAC 1DGRM 2ZNZA 3GTOJ 3FXKA 3J81Z 2XRNA 1T98A 3MKLA 2NNYA 1XD7A 3IKTA 2XGCA 2XPVA 4HW0A 4EVIA 4M71A 1W7PB 3OL3A 3R6SA 5E3NA 3V4GA 3K58A 2LBFA 5HLGA 1IS1A 4ZC3A 2TRTA 2B0LA 1GHCA 1S8NA 1FWZA 1KU7A 3QYFA 2MFZA 3O8HA 3SZGA 4E70A 2XKPA 2MYSA 2UUZA 1QPIA 3GFIA 4C2TA 1ETXA 1KA8A 5B66C 4F55A 4LB6B 2EA4A 4UUVA 1T6SA 5J8CA 1GV2A 1ACIA 1EH1A 5ICGA 3OYBA 2E60A 4XN3A 2LC2A 3HGYA 4YFKF 4BGDA 5FLMJ 1HCRA 2M45A 2CW7A 4DYQA 1ERDA 1SAXA 1TWCJ 2R7XA 4R1HA 4M3EA 4LIVA 3CP2A 2F4QA 5FFZA 2IBDA 1VTNC 1MMDA 2H1LA 4A6EA 5HDNA 3B6CA 5EGOA 1Y6IA 3PFYA 5ILUA 2XV4S 1ZLJA 4BQNA 1ZQ3P 3H9JA 4G6DA 3ZQGA 1MSFC 4HDVA 4ESJA 1N77A 3CF2A 1LVAA 2OZUA 4IZZA 4HRIA 1NK2P 1MBGA 4C2MA 3EUHC 2I5UA 3S3MA 4PSWA 3GTJJ 5HDGA 1NG7A 1OR7A 3TEDA 2Q8KA 4Z2YA 3J80Z 3D5LA 3WTTC 5F1RA 2HDWA 4O6JA 2H6CA 3PSFA 1IN4A 3ASOH 5DUKA 2WY7Q 5LLQA 4GRIA 4RGXA 1MIUA 2F5DA 4HX8A 4UB6C 1MNMC 4PSXA 3H35A 4PFOA 4AWXB 4R79A 2PMZA 3DTEA 1VQKI 3WVOA 3HSRA 5E18F 4PGHA 5B1AH 3MEXA 5J1RA 4C3HJ 1LDJA 3GFMA 4XLAA 4RS8A 3CCYA 5HLIA 5M5WJ 5K1YA 3K5OA 4ZDLA 2L3DA 1JUMA 1S7EA 2OU2A 4CYCA 1JT0A 4FYDA 5IT3A 3DPTA 3CMEI 3I71A 3FWEA 3QYBA 4CCMA 2NVXA 2MH2A 4XKBA 2XROA 1ZG1A 2NRAC 1QBJA 3CJNA 1TLHB 2MW8A 4HSTA 2VUMJ 4R8HA 2E5ZA 3PO3J 1AA7A 4XKWA 2E36A 5K7ZA 2WAQA 1GLNA 2L54A 4QCLA 3VDXA 2YX7A 2L7KA 1KQ9A 2BW3A 2YU3A 1T08B 1LFPA 1ZELA 5DYMA 1RNLA 4FETA 4XKVA 2ZJQF 3PUBA 2V4JC 5GPCA 5F27A 3DEUA 4ZYGA 2KRCA 3E6MA 1G3SA 4M72A 2ADUA 2QYOA 1WFXA 1WPKA 2LR8A 2R4GA 2CV1A 2M2EA 2JPCA 3L00A 1GUUA 2A69F 3QPTA 4UHTA 4B48A 2LYCA 5LGUA 1R9TA 4IRIA 3MAQA 2DFIA 3JREA 4F3QA 3S1NJ 1VQOI 4I02A 1NHAA 3FKIA 3K4NA 3BQYA 4GCVA 3C2BA 1IW7F 3K9TA 4PJLA 1D1BA 1RIOH 3DBHB 3OYHA 2FBKA 1XPXA 1EKEA 3M3YJ 3EUKL 4IHTA 2NOGA 5C4JJ 1HSJA 4PGGA 4AM3A 2X48A 5DV5A 2H8RA 2BBYA 2QF7A 2DI3A 2IRFG 1SMYD 1TWFA 3JRFA 1T95A 2PQ8A 3B6AA 3Q3SA 4CA0A 3F6OA 2L2OA 4RLFA 4HX4A 4BU2A 4QLCU 5BNGA 2IGMA 3W3CA 3OYGA 1XMAA 3BT9A 4OYDB 2LY1A 2HS5A 2RQQA 1U8BA 4LOCA 1TT0A 4CZZA 3W6KB 2V9VA 3K7AJ 4OMZA 4N0BA 4D7MA 4OIPF 3GW2A 3CTAA 3F8MA 2HZTA 3PNTA 2O5RA 4NB5A 4XRMA 4HLYA 1O4XA 5D4RA 3BPVA 4I2OA 1IRGA 2IJLA 3WGGA 2R7QA 4CCOA 2JMWA 4A12A 1ZR2A 3U21A 1Z1DA 5FFXA 3W6JB 2H94A 2VOOA 1VQ7I 5GAEJ 1XX5A 3TBIA 3OOUA 5EZHA 4MQ9F 1ORKA 3KEQA 1K78A 2AS5F 1AHDP 3MWMA 2OTLI 1B1BA 2CFOA 5KHDA 2EFQA 3BG7A 3IP4B 5GPAA 4ZYHA 2PJRB 3RQ4A 4HF1A 4OAYA 2EFOA 5M5YJ 1TL8A 4ETSA 3K5MA 2OQRA 4RDUA 1VQ5I 4HX7A 5DCMB 3QAHA 2HOAA 3DLLF 4PCQA 2VPRA 3E1SA 1D1CA 2QBYB 4ZTFA 3H9GA 2M30A 2F5CA 2OZ6A 2VBWA 3V8JA 1O3TA 3C2GA 2A07F 2XAJA 4Q48A 4AN8A 1YJ9I 4BJ5C 1OCTC 3V7RA 1Z7LA 2R93A 1JGSA 1J75A 5H2FC 2O5JD 3JRBA 1R23A 3FM3A 2VODA 2A5YB 3HC7A 4UVBA 3RJPA 3C18A 2QGUA 1ONVA 2E2JJ 1ETQA 3OS1A 1OMIA 1WQ2A 4M6XA 3ABMH 5J47A 2OF7A 1C0WA 3CDLA 4IOAF 2Y69H 2HEOA 3I9V2 4Q5GA 1JTYA 2F5FA 2VJ5A 1TP4A 3PM1A 3DEWA 3HOVJ 1M1EB 3OWTA 1BOAA 2L9RA 3LWFA 3DBLB 1I1SA 1U3EM 3PSIA 2ZFUA 3F8FA 3RSNA 4BXFA 2EZKA 2MBFA 3G73A 4BE1A 4KMUX 1TC3C 3MZ8A 2LNBA 1PDNC 1T56A 3K2ZA 2KIQA 1NG6A 2MLKA 5KVRA 3KLNA 4V2GA 2ZO4A 4XLNF 3OY9A 3H0GJ 3A02A 3BJOA 5J1YA 1YW7A 3KX2A 3OYJA 4KFCA 5DEQA 1O3RA 4Y15A 2VT3A 1Y8RB 3PL8A 2O9LA 3W2VA 2X9DA 3PUFA 2FQ4A 1Y1VJ 4RB1A 5F6FA 3TL4X 1X3UA 1FMWA 1MMGA 2IXSA 1ETKA 1VFCA 3FMQA 2YU9J 4J19A 4EJUA 5KCMA 3FKJA 4KAWX 2QSGX 4IHYA 1YITI 4IPAA 4JX4A 4CH7A 4D5FA 2V7FA 3BC8A 5FROA 4YFNF 4Y17A 4HNUA 3U9GA 4BS9A 1Y1WJ 2CW0D 1WJCA 3F22A 1FIPA 2NNNA 1TWFJ 2VBZA 1Z9CA 2EV6A 4NOLA 2GOXB 2RV8A 1D0ZA 3BTCA 3SDGA 2LVSA 3H5RA 3RDIA 1RC9A 2TCTA 1BJZA 2E35A 3R61A 2P81A 4KT5C 1D1AA 4UY8I 2HQRA 1WZ2A 3I4NJ 2HQNA 1X1CA 2HOSA 2BV6A 2WY8Q 1ZYRF 1FMVA 1VZ0A 3K1NA 1I27A 3JSOA 1R5ZA 1TWHA 3HM5A 2DLLA 3ERED 5ICCA 2OCCH 1DU0A 4CCNA 2IA0A 4QPOA 3M8FA 2VJ4A 2EA2A 2XKOA 3DQVC 5K5RA 3LA3A 1HC8A 1TWAJ 2PN6A 3OSFA 3K69A 1T0FA 3DEEA 5EEGA 1SVLA 5DM6F 4II3A 2GLOA 4G9YA 4ZYAA 1VQ9I 3K0LA 1WJFA 3AG1H 2DTRA 2UWMA 3S15J 5TJJA 3BY6A 3IAS2 4G6TB 3UR3C 3OIOA 4LLNA 1OJLA 1TQIA 1WKMA 2X6OA 3Q0VA 2ZXWH 3I4MJ 3HDDA 3C1DA 4QIWN 1X1BA 4LITA 4GFBA 3H5AA 2PLYA 2UV1A 3FXMA 1SFXA 3IWZA 1FOXA 4L5JA 4RAFA 1S29A 3DWLE 3RI4A 2CWEA 3K70C 1I50J 3KEYA 4FASD 1J2XA 3L2VA 2DMPA 3UNGC 3FK7A 5JLXA 1O7LA 3RQIA 1HBXG 2R7TA 2ACJA 3GFLA 3CCMI 3LHPS 3PQKA 1FBSA 3K2AA 4FQGA 4M9ZA 5TISC 2LLKA 1V55H 3WTWC 2F2EA 2VE8A 4Z6YA 4ON0A 1ZKGA 5IP9J 4J00A 2LREA 1R6RA 2CV0A 2P4WA 3DKYA 4YELA 1ZARA 2NS7A 4B47A 2CGPA 3IRRA 4LG0A 2W48A 4DBRA 4KDPA 3K70D 1UJ8A 2HXOA 1K83A 3S3OA 3ZQHA 3H3UA 2DAOA 3C7JA 2OQGA 2VJJA 5FLXK 4RAYA 1HQCA 3ESWB 3S3NA 1S7AA 2F5VA 2DO7A 1R1VA 2Y9YA 3RPUD 2GM4A 5E8GA 3HOSA 3JRCA 1YFHA 2L9VA 1SFEA 1PYVA 4IP8A 4IXAA 1XMKA 3ABKH 3UKGA 1D3YA 3BQZA 4XONA 2DFFA 4LGWA 1H0MA 4CO8A 1DP7P 2BE5D 3GWZA 1WSUA 2COBA 1YG2A 5EGOB 4KIGA 1KONA 3NQOA 1UHWA 1MMNA 4CCLA 1JKOC 2M5WA 2H09A 1AKHA 3E6CC 1N75A 2FD5A 4LLGF 4D0PA 5TRDA 1IZ1A 2FQ3A 1X3ZB 3OR1C 5ED4A 2HQAA 2A6HD 2F4MB 5IP7J 3BDDA 2CYYA 3AAFA 2G0EA 1MH4A 2FMYA 1V5EA 1DDNA 4F52A 2M8GX 4FHTA 2BVMA 4RB2C 4HEA2 1FOWA 4IJAA 3DCFA 5HS9A 3REOA 2JRMA 3QOEA 4ZYDA 4HQEA 1UHMA 4YIIA 2DK5A 1XB4A 2QLZA 4KB2A 3JW4A 1Y39A 2JA6J 1BW6A 1KQ8A 2MD0A 2GBYA 2JJ7A 3M1EA 4L9VA 5JSNB 1TWHJ 4M3BA 4Q5VA 4ZH4F 3FBIB 2DK8A 2M7BA 2V1UA 1QNTA 2ZMEC 2A6ED 2P7CB 4HBLA 1Y698 2DA2A 2XSJC 4FT8A 3SZPA 4Q47A 3P9AA 4CYCB 4QTRA 3JRGA 1IUYA 2E2IJ 2K02A 4BQAA 3ZXSA 1Z0XA 2EBIA 4A0YA 3AFHA 3DU6A 1F5TA 3DKXA 1ZN2A 3MMYB 4XLEA 1LNWA 3IWFA 4KN4X 3H9QA 2VQGA 4GGGA 2PI0A 2D5VA 3S16J 2DYSH 3RYRA 2R0QC 1Y0UA 4FXDA 3E6DA 2E7WA 4FE4A 4DBQA 2EZIA 2R3SA 2BW3B 4B3XA 5DD4A 4KITB 4EM1A 3HYIA 4O3MA 3OL4A 4N4OB 2X85A 5FKMA 5F0FA 3LF9A 2OA4A 3QPHA 1W0UA 1RETA 4JLRC 3M7GA 2OUMA 2O0YA 4GYIA 5LD2C 3DXJF 5A2QK 1A36A 2P6TA 1YNND 1WJDA 2K3FA 1OCPA 2WADA 2FNPA 3ECOA 3WTSC 1J59A 2RKHA 5K7FA 2ESHA 2FE3A 3KYLA 3HOXJ 3CQZA 2HWVA 4I01A 3RKQA 4A3GJ 2JK3A 5F04A 4AC0A 2A6TA 3BR1A 1USTA 2XGDA 1X58A 4A3LJ 2Y30A 1Z6RA 2ETHA 3JRHA 4A3EJ 2HU9A 3BLYA 4CCKA 2KP6A 3Q9VA 3TOAA 1EH8A 1SMTA 2JUGA 5HODA 2WB1N 5IP6A 4MQVA 1HQMD 3SDBA 1FIAA 3K5LA 3CF5F 3BZ6A 5FD6A 1OYYA 2RNGA 5CYVA 1SEUA 4MEYF 3ULQB 4WCGA 4RA2A 2IPQX 2Q0OA 4C2UA 1W7PD 3RIRA 1MD0A 4UVCA 1UB9A 3ZMSA 5M3MJ 2E2HJ 1ODDA 3S1RJ 5BOXA 4CUGA 1ON2A 3CO6C 2DT7B 4NQWA 1JUSA 2Y0SN 2Z99A 1I3QA 5EEHA 2LRDA 3K1PA 4I76A 3I53A 2C6YA 1Z05A 4BJTA 1DGWY 4BAYA 2OAZA 1O57A 3OYCA 2K4BA 4XRFA 3GUDA 1RUOA 2XIGA 1JHFA 2K9QA 3F8NA 3OIQA 3V7SA 3JRAA 2W82A 3HKZN 1SFOA 4HPQA 4BACA 4ZDPA 4Y3OA 4H4KC 2NXNB 4LMYA 4JYKA 3ZMTA 5D4SA 4U7DA 1K78B 2HPMA 3RZOJ 5H6RA 3FISA 2V6EA 2RDPA 1MMSA 3M4AA 2AHQA 2GWRA 4DZJA 3IUOA 5EZGA 3HTUA 4D9JA 3G6EI 3EQLF 1B72A 3DKWA 4AVZA 2CMPA 5HNFA 4LB5A 2FRHA 3FHZA 3E6BA 1ZLKA 2IGOA 1V54H 1BW5A 1F4KA 1ZRCA 5L3EA 1IUFA 4HV5A 1K79A 1PVEA 3MZHA 4CDGA 2QVOA 2P6SA 1E3HA 2ME0A 4ENNA 2IS1A 1FT9A 2DW4A 4UUSB 3I0TA 4OU0A 1G3TA 2NS0A 3A0HC 1GV5A 4BDZA 2KHMA 5CKTA 2DXIA 2NVYA 4IRHA 3S2WA 2FX0A 1U5TA 3LFKA 5BMZA 2HXIA 5IT9K 1BM9A 2L01A 3BTLA 3VYTB 3OYAA 3JTGA 4WX9A 1XSDA 2IS6A 5J40A 2DQRA 4NHJA 2JWTA 2R92J 5CVUA 2K7LA 1OQYA 2W57A 1HSTA 2O8KA 1LE8A 2BY2A 2ID6A 3LOCA 4BEHB 4IP9A 3FXLA 2GA1A 4CGZA 1Z3YA 2X1CA 4CYDA 3LFUA 2WA0A 1VNDA 2HI3A 5AIQA 3IHUA 3CC4I 1EH6A 1EH7A 1UFMA 1XC5A 3P9CA 4PJMA 2CH0A 1Q8IA 1T38A 2HQ5A 3H0DA 1IF1A 1FLIA 3NEUA 3AG3H 4G12A 3HXLA 3ZRGA 5E3LA 1WWXA 2OBPA 1P92A 3PJRA 3ERMA 1ZHFA 5CVVA 3L2UA 4A2UA 1IJWC 2HPIA 3BTJA 1MH3A 5JFRA 2B9SA 5E8IA 4M3DA 3K6GA 1HXDA 2E34A 3TGNA 1IXRC 2LY9A 2Z3YA 1QA6A 2H6BA 1ITYA 1B4AA 2CUJA 1TWGA 1BI2A 3E5XA 3H3ZA 3CJQB 4OIOF 2LF7A 2O6GE 5L3DA 1MBHA 1XCBA 2LFBA 3ZQQA 1TTYA 4V19K 3VPRA 3A4CA 3HPGA 2HOEA 4L0YB 4E7IA 1WJBA 3GEZA 4JX6A 2JSCA 3GF2A 1VF9A 3F3XA 3IH4A 4UXNA 3BR2A 5FGMA 2GXAA 2LSOA 2Y31A 4HOBA 1VQ4I 4ZDOA 4WF2A 2QSHX 2G7UA 1JUPA 4QSHA 3M4OJ 1FEXA 2RQPA 2W4SA 4XMYA 2R7RA 4LLLA 4AYBN 3CC7I 3I3LA 4F92B 3MN2A 2YR2A 2BY1A 5MLC9 2JA7A 3W2WA 1U8RA 2FBHA 4I99C 2FSWA 4NNJA 3GTLA 1MJ9A 5LGNA 1XDUA 1R1TA 1GVJA 3TO6A 3GXOA 4ENJA 3OYNA 3VOEA 1DD5A 4OIRF 4KYWA 3SYTA 2IVMA 1MBEA 3SEZA 2GAUA 5EDNA 3D5RC 2Z16A 1HDDC 1APLC 1B8IA 3K4MA 3BCAA 4Y7NJ 5AONA 4HQMA 4E7JA 4PDKA 4MTEA 1E17A 4C30A 1H8AC 1FOKA 2EILH 3P9KA 1JGGA 3NRVA 2X1DA 4O5VA 2A68D 3TP3A 2R7FA 3WTVC 2KFDA 5JLWA 1LEBA 1IRXA 2M34A 4Y4RA 2R7OA 4A5NA 4XICA 3HOYJ 4WK8F 5D6EA 3MKYB 1NH3A 1IN6A 1WH7A 2COMA 2EK5A 3ZQFA 2QZ8A 4ABZA 3ONQA 4B43A 3AG4H 4MNUA 1TNSA 1KU2A 1USSA 3CESA 4LMOA 4D3YA 2X6XA 4IL6C 1BR4A 4KT6A 3ZR8X 4F93B 2KRHA 1I6VD 2VXDA 2XVCA 2NVUB 3IAM2 1A35A 4EJVA 3KYCB 3VB2A 1MBKA 2GA2A 2QSFX 2VBYA 1FY7A 3ZMZA 2JA2A 1X2MA 2LOOA 2DCEA 3MFKA 3HTSB 1HKTA 2HVSA 4RGRA 4I0BA 4DJAA 3H1CA 4IHSA 4LK1F 2EJRA 3HIFA 4LG0B 2FMLA 3GZ6A 3Q9SA 9ANTA 4YIRX 5D5UB 1IXSB 3WTUC 3J7AO 2ELJA 1AU7A 2FOKA 4GO1A 3K1MA 4GYGA 4P55A 3QPLA 4XK4A 3TKYA 5EEAA 2EFPA 2QKLB 4I7HA 1W0TA 3ECHA 5DS9A 5LHGA 1KYWA 3CUQA 5CQEA 4DYCA 3FK6A 3SEQA 2KJCA 3E7LA 2ICWG 3GTPA 1JJ8C 1LKXA 1IDZA 1FTTA 1SD6A 2LDUA 1UG0A 1BR2A 3KCCA 4A0ZA 1YS7A 2KIMA 1PP8F 3HHGA 5JVGF 4C2MJ 3ZQLA 1J09A 2B63A 2DFEA 1HLVA 1D5YA 5CVIA 3G71I 5LRRA 2CG4A 3IV5A 4EEFG 4G6QA 4I0AA 2ZCWA 3BR3A 5CLSA 4A3BJ 2VJIA 1R5GA 1AKHB 4DYRA 3P7NA 2BOLA 4B1RA 4ESFA 2ISYA 4K2EA 5FKOA 3S93A 5IPAA 3L1PA 4RMNA 1Z67A 2D45A 5J4VA 1P4WA 4KN7X 3SFZA 2V79A 5HVQC 3A2KA 1TT5B 3GMEA 3VSLA 2EIKH 2LMDA 3HSEA 3WGHA 1FYKA 2WTEA 1DPUA 4EATA 1X19A 5DCFA 4M9XA 1O3SA 4UUSA 2VKHA 2XGEA 2ZBKA 4IVNA 4W97A 4X0GA 3H3VK 4RM3A 4XBFA 1CGPA 3WE2A 3U2RA 3CCVI 3HOUJ 1YW8A 1YYVA 5LRSA 2NYXA 3LL7A 2NVXJ 1K6YA 2ZXIA 4XKCA 2XF5A 4BHCA 3LAJA 3TQNA 2KZGA 3O2PE 1Y0NA 3OYMA 5GTIC 4RLQA 3I58A 3CO7C 2EIMH 3RKYA 1BBYA 1P7JA 2DDBA 4BJ6C 3BCBA 3FDYA 4BEHA 4GXOA 2QWWA 1ZR4A 4BY1J 2Y9ZA 2JT1A 2V26A 3GTGA 1JKPC 1OCOH 2KPMA 4RGUA 2VPLA 1R00A 3CMYA 3HG9A 1TQPA 1SFKA 1HKQA 3I64A 1WI9A 2DPUA 4XNFA 3V8LA 4C3IJ 3HBLA 4KDDA 4EGYA 5CQGA 2RVCA 1X1AA 3RTRA 4XSZF 1Z3XA 3WGIA 2F48A 1FZPB 2AXTC 2R7UA 3OR2C 4JQFA 5TGTA 1R9TJ 2LKXA 1H9TA 2PBIA 3GFJA 4IQJA 2PMZN 4DOZA 5HNHA 4O26A 4W1UA 2MLGA 1W5SA 1R1UA 2LF8A 2ZXJA 1FBUA 1ISEA 1V9MA 5IYDJ 3FKIJ 5FJ8J 1ZRDA 1Z77A 2WV0A 5CVJA 3HUGA 1U6GA 2JSPA 4BHPA 4A93J 4A3KJ 3FBNB 1QRYA 2A3SA 1W5TA 2E1NA 4EM2A 3QU3A 3JTHA 3PNYA 4AD9A 4LK0F 3KYDB 3KLOA 2CQ7A 2VLAA 1PUEE 3T5XA 1QZEA 1B6AA 4NC6A 3RKXA 2Z33A 2AQFA 4KIBA 4AIHA 1E2XA 1EJ9A 4YG2F 2ISZA 1WQGA 2WAQN 1IRZA 2ID3A 2IS4A 1F43A 2JA5A 2IA1A 4JK1X 4LFUA 2V6CA 1QVTA 2K4JA 3L2CA 3PIPF 4BE0A 3NWTA 3I56I 5M5XJ 4EJ3A 2R7VA 4DNCA 5L3CA 1U9OA 5JSBB 2DA6A 1D0XA 1RKWA 2BEOA 2RGVA 2MABA 3JAMK 3WTYC 1QU3A 1IAWA 4FE7A 3BTIA 1R36A 4IOCF 2X4HA 1FYLA 3RYPA 3E97A 5ILSA 3BR6A 3ZN1A 2OPTA 1MNEA 2BE5F 3B73A 2L5QA 1HW1A 3ZQ7A 4KNYA 2CU7A 2QQ9A 3PO2J 3HOZJ 2V9PA 2XB0X 3U1DA 4NQWB 2DFHA 5JHFA 4X1EA 1T8IA 4A69C 2DTZA 2X6YA 2ZNYA 1XSXA 3EPZA 1BR1A 2EQRA 3WHBA 2IA2A 2OJED 1IN5A 3Q0UA 3LSTA 5C3EJ 1Z6TA 2LKSA 1MKMA 1HDPA 2DMNA 3EUHA 3CCQI 3FXJA 4S05A 4PK4A 1MDMA 3JSPA 2JN6A 3ZP5A 1MBFA 2A6HF 3CCSI 5EG0A 3JRDA 1VQ8I 3T8RA 5E3MA 4M73A 2F5EA 2EZLA 2P7VB 2WB1A 1ZTRA 3T0YA 4KC6A 4MTDA 5ICEA 3J7YJ 3JCUC 3CCEI 1B72B 3GTQA 3GTMA 2PMHA 2R93J 4KISA 2XPUA 2KISA 2W00A 3WHCA 3LA2A 4HDUA 1W36C 4M3FA 4A3DJ 5K5OA 1JHHA 1SFUA 1OR7C 5IYBJ 3Q5FA 1RR8C 1VQLI 2CV2A 2E19A 2M7AA 1VQNI 1IV6A 2L9NA 4IHVA 1WCMA 2XHKA 2A05A 1L3LA 3S32A 4ANJA 3N4MA 2M87A 2A6EF 2W85A 1R49A 3WE3A 2FA5A 2FEZA 1ETVA 1U5TB 2Y0SA 4CZCA 4MGRA 2O8XA 5E79C 3CLOA 1YHQI 3L2WA 2HYJA 2R7WA 4BH9A 1W36D 3KP4A 1V4RA 2DA5A 3HKZA 1LE8B 2WC2A 3J81K 3TW6A 4YIFA 5BS6A 5B3SH 1YIOA 3OIPA 4B3AA 2W7NA 1LQ1A 3GLLA 2VKDA 1KU9A 2H1KA 1XDSA 3HHHA 3O3KA 2I10A 3PIOF 4U0WA 3AL0C 3A0BC 5CJ9A 1U9NA 3H92A 4S0HB 2MGQA 4IEJA 2EB7A 4D5CA 5HOOA 2OC6A 3DF8A 1Z21A 4G7ZF 2EZHA 2VQLA 3A1YA 4P9UA 4XQFA 2HDCA 4PFPA 2IGNA 4NOMA 4FCYA 2B9SB 5LBQA 3ZOBA 3TDUC 1A31A 2Y75A 2R7ZA 3V7CA 1YX3A 3LSPA 2WBMA 1QO0D 2ZB9A 2CQKA 3WU2C 4RBOA 4P96A 2XB5A 3ZCOA 1VI0A 5HDKA 2XAQA 1TW2A 2NS8A 2XPWA 4A3FJ 1FYMA 1Y56A 3CC2I 3OYKA 2K9LA 3KP2A 4KB4A 3OS0A 2DYRH 4XLCA 3RZDJ 1BC8C 3RCOA 1JI8A 2IEKA 2F4IA 2GIVA 3FHNA 3TMOA 5F1JA 4XRSG 4Y52J 1PUFA 4OOIA 2YX4A 2WWYA 2LD5A 1LJ9A 3GTOA 3L2RA 4I98B 1XS9A 1B9NA 2VBXA 3GX4X 5GAHJ 4XOPA 3S17J 3JR9A 5FKLA 1JE8A 1YLFA 2LY2A 2IAIA 2DMQA 2V9KA 2G7HA 4GDFA 3AG2H 1XGNA 3QRFF 2RC4A 2IS2A 3SHFA 4E7ZA 3E0JB 1BA5A 3SZTA 1HOMA 1YOVB 3KP6A 4EJOA 1LDKB 2M0MA 3ZMVA 2KDZA 4GFQA 3N97A 2W25A 3VYRB 5IOYA 1ZK8A 2VN2A 3D5SC 3S1MJ 1SAUA 2L02A 3J80K 1ON1A 3MAJA 4XLFA 1B8IB 1X4PA 3LQRA 3KE2A 3TW7A 4E6KG 1MSEC 4YRVA 1N78A 2M0CA 1OFCX 3FXOA 1ZRFA 1UAAA 2GOMA 2JPBA 3KZYA 2X51A 3LSKA 5GADJ 4BXUA 1DUXC 3T8TA 3DPLC 3DPUA 2B7EA 3BR0A 4JP0A 1TWCA 4G7HF 3HRUA 2K85A 1D0YA 4ZZLA 2DJNA 2EH3A 4ZYEA 1B9MA 5ICFA 4IO9F 4E4HA 1VQPI 2L7FP 3CJRB 2O03A 1YNJD 1G3WA 2DDAA 2HZDA 2Q1ZB 4II2A 2E1MB 2IGKA 2XASA 5C44J 1WRJA 3LNQA 1WCMJ 4L0ZB 1FSHA 1ZG3A 3D1NI 2K40A 3ABTA 3TOBA 1K83J 6PAXA 2M4GA 3P9IA 2XAHA 1XMXA 5E3OA 4G94A 3S8PA 2MA3A 3SFIA 3OV8A 2L7ZA 4I6ZA 4IRGA 3HOTA 1S72I 5ILVA 2EV0A 3GLXA 3SXYA 3HZJA 1EA3A 1U78A 3DLAA 3L9FA 2HFHA 1TBXA 1RRJA 4M74A 5FRNA 4CHUA 1NTCA 1DQUA 3EETA 5J3LA 4FX0A 3PNVA 2HKOA 2K9NA 1R4MB 4HF0A 1MZBA 3BWGA 3CUQB 2Q2EA 1HW5A 2Z9OA 3P5JA 2P5VA 2XF7A 4YEJA 3F6VA 4PZJA 2DODA 4BE2A 2BYVE 5LHHA 2KL4A 3BROA 2QEXI 4ENMA 1SD7A 5L3GA 1S6LA 2EWNA 1CF7A 4XLHA 1F9NA 3LAPA 3M8EA 1GXQA 2OCEA 1BI1A 2YPRA 1E3OC 3O6BB 4RAGA 4BBRJ 4BYYA 2ZFWA 1O3QA 1P6RA 5JHUA 5F0CA 2HVRA 1RESA 3HPHA 1IGNA 2NVQJ 4L18B 2GQQA 5B1BH 3ABUA 5FLXZ 4A3JJ 2VUMA 4UV9A 2Y2ZA 2VXZA 1BJAA 4HSRA 4BBSJ 1FC3A 2BZTA 4MHGA 2CFXA 3RPQA 2V1XA 1Z91A 4OWRB 2L4AA 1SANA 3NARA 5LFAA 4F7ZA 2VIXA 2Y48A 2L7MP 4EMSA 3IAYA 2N8GA 4E7HA 4M3GA 2L0KA 4UNOA 2XAFA 3LMMA 4D3ZA 1BN5A 1QHGA 4BQOA 1G59A 1BC7C 3G4SI 1R7JA 3EYYA 4XORA 1OCZH 3ABLH 3Q0WA 4BXXJ 4J01A 3DV8A 2HDDA 3VODA 2Z5UA 2BXYA 2IP2A 1IO2A 2LP0A 2DA4A 2V1DA 2DOEA 3GO5A 1AOYA 2XGXA 3R60A 3VFZA 3HRMA 4KJZA 5E17F 2EV5A 2ELKA 1TW3A 2CUZA 1J7KA 2KIFA 3TP0A 1OKRA 3CDHA 5IYCJ 1MMAA 5D8KB 2NAZA 1YIJI 2X1EA 1SD4A 1QHHD 2UZKA 4EJTA 4N4NB 2DOFA 2RN7A 2MSYA 2A68F 2AQEA 1K6OA 1T0FC 2JTVA 1BOBA 3CUOA 3CQZJ 3VSKA 3IL2A 3A01A 3MD2A 1T33A 2BY0A 3HUGB 5DTDA 1GT0C 2HYGD 1I5ZA 4XR6A 5K5QA 1F36A 3GZ5A 1SC7A 3FIWA 4HZFA 3W2AA 2ELHA 4H3TA 1BIBA 3RPUA 2HVQA 4UB8C 2PX9A 2O61A 1A6QA 2WAFA 1BI3A 5HLTA 4AIDA 2XAUA 1R58A 1NK3P 3CCRI 1RZ4A 1YRNA 1GVDA 3WG7H 3IC7A 2KZVA 1MNDA 1SMYF 2BHZA 1H88C 3GZNB 2FU4A 3CCUI 4JX5A 1UCRA 5KAFC 2GIZA 4XN0A 2GXBA 5KNLA 4C3JJ 3RKWA 1RPWA 2HTSA 5B5EC 2XDVA 3J7AY 3KP3A 3WG9A 2ZXHA 4AUXA 1IRFA 1XSVA 1ETWA 4A0XA 2QQBA 4B8XA 2LKPA 3H5NA 5FKKA 1I3QJ 5A2QZ 4MIMA 1POGA 3DFGA 1JT6A 2A5WA 4HNTA 1X1DA 4I09A 3K57A 3T1BA 1P9QC 1MJAA 2R5ZA 4FX4A 2QENA 4DZPA 4A3CJ 1SFOJ 3HJEA 2QUFA 4LD5A 5DM7F 1GE9A 2ME6A 4PUSA 1PJRA 1U0JA 1R5ID 1YJNI 1LUJB 3MZYA 2QA4I 3QODA 2IT0A 1ETYA 1KQ0A 3ZMUA 1XN7A 1ZAOA 2KQRA 1S9HA 2XUBA 5J4YA 5GTHC 4WXHA 1G8XA 5LHIA 2CW8A 2EPFA 3PQJA 5J8FA 5EYRA 1MDMB 2GXGA 4U87A 5EG0B 4U0YA 3FX3A 4BHBA 1BL0A 3SQNA 3OYIA 2CRGA 1YI2I 4NOKA 2F6CA 1I1GA 2E1CA 4XOTA 4L9JA 5IY5H 2NVYJ 1SD5A 3QWLA 1FTZA 3IKVA 2BY3A 1WJ5A 1SVOA 3QOPA 2D1HA 3HL2A 3HGGA 3DTIA 2DMTA 4AIJA 3HRTA 2MG4A 1V5GA 4F91B 3G1MA 3M1CA 2VASA 3SJMA 3H0GA 1S5LC 3GTKA 1Q1VA 3C3WA 4L5IA 3CCJI 2EFNA 3F8BA 1F1ZA 3ELKA 4P5OA 5FLVA 3WTXC 3ML6A 5EJCA 1JJ6C 4MO7A 2ZMEA 1WI3A 4PJ0C 3KZIC 4E7SA 2K9MA 1SVMA 2DOAA 4MEXF 1TZLA 1Y1VA 1G4DA 3L2QA 2KKOA 2R7SA 1FJLA 2YU9A 1QVUA 5KK1A 2YS9A 3GYHX 1XG1A 2R7DA 2VQCA 2VOPA 3JRIA 1UMQA 5FB2A 1H9GA 1E3PA 2VE9A 4ZTJA 1DU6A 4QIWA 5D8LB 2CJJA 2K27A 1Y1WA 2GZWA 2R5YA 4DIQA 1T2KA 3CMAI 1PP7U 2E7XA 3MVPA 3I5UA 1XGMA 4OAZA 5F0HA 5E1XA 4L9NA 1KYZA 2G9WA 1W5CC 3LSHA 1MBJA 2VKVA 2ZC2A 1R22A 1OCCH 2VT2A 3BG5A 3HSFA 5JVTA 4ENKA 1V3FA 3DU5A 1TWGJ 2O3FA 3DTKA 3EUAA 4KUMA 3G1LA 2ZSHB 1X1PA 1R4NB 1YS6A 3L7WA 2A61A 1YQAA 4A6DA 5IT9Z 1MJBA 1KU3A 5J1UA 1K61A 5IOZA 2VI6A 2XC7A 1TWAA 5LGTA 4LJZF 1P4XA 3D0SA 1LPQA 2CQXA 1YX5A 2CW0F 1RUNA 4IX7A 3K59A 2DN0A 2PEXA 1FX7A 1MIJA 1V5FA 2K9SA 5L3FA 4KA4A 1LB2A 1GDTA 2A69D 1K4SA 4XSXF 5BQTA 2DA7A 2KLOA 2CQNA 4HLXA 2JA7J 1Z7UA 4WXDA 1W7PA 2D2WA 1ZGWA 1G6NA 5AIPA 3GTLJ 1PUFB 3DBRB 3CDIA 2YSRA 4KICA 3X2QH 1FP1D 2J5PA 1HA8A 1P2FA 2O7OA 2LG4A 2QQAA 3V8KA 1IW7D 3WODF 2M4KA 1EV7A 3B02A 3CJTB 4M6VA 1J9IA 5FKNA 2MD5A 5GAGJ 1I50A 1WJAA 3KETA 3FMRA 3OS2A 2JZYA 4JBAA 4NC7A 1W1WE 1RKTA 3HB9A 3N05A 5ERIA 3ZQCA 2WAEA 1XTAA 1Q1HA 4XM3A 1JKQC 4AHCA 3HOWJ 3I54A 1TGOA 2DBBA 5E1ZB 2VC0A 2VL8A 3HRSA 4MLOA 2BVLA 4UV8A 4KMFA 5HS7A 4D1QA 3M9AA 3ZPLA 2RAEA 2E1OA 3FXQA 2V1NA 1X4OA 4ITVA 4PJNA 3DP7A 2RREA 4JOMA 3WTZA 3OOPA 4NC8A 3MKZA 4AIKA 3K4LA 4N9HA 3M07A 2H27A 2FJ1A 3TO9A 1X2NA 2W84A 3CZ6A 2JRTA 2KDOA 1I6HJ 2W24A 5EF6A 2CS3A 3AKZA 5D5VB 3I59B 3OYFA 2DJIA 1LFUP 1QZZA 3CP8A 4U88A 5DUIA 3FM5A 4EGZA 5KAIC 3GTKJ 2J5OA 4M9SA 1IC8A 2F4OB 1QZYA 2KMUA 4D7NA 3K4JA 4HA8A 4U7BA 3KEOA 3CCLI 5BPIA 2AO9A 3OSGA 3S14J 1REPC 2PJPA 1DPRA 4V2FA 3M8JA 2PG4A 4P1WA 3BOQA 3BR5A 2HYFA 4A3IJ 1A5JA 4WWCA 2W1OA 1XCVA 3ZGKA 3VEPA 2VC1A 4DQ2A 2Z1DA 2JVHA 4HNVA 5JI6A 2XRLA 1WJEA 4S04A 3GTPJ 3ZMDA 4LG3A 4CCJA 1FNNA 1LFBA 1YW9A 2ZKZA 1OISA 4PJJA 3K4KA 1YJWI 4HG2A 2JUCA 4CXFA 4EM0B 2XSDC 1FBQA 2FNAA 1A6IA 1WQFA 1J0RA 2PMUA 2HKXA 4DGWB 2LH9A 4IHWA 3G2BA 2B63J 2ESNA 3K10A 1QGPA 2JA6A 1U5TC 5H20A 4G7OF 2Q2EB 4BY7J 2BXZA 2E71A 1ETOA 1R5HA 1ZGAA 4ZZDA 5F64A 2JA8J 1WVRA 2LK2A 4CICA 3K4CA 4L8IA 2K3PA 3V42A 4LIUA 4IQ4A 2EIJH 3LSGA 1CF7B 3KP7A 2X6WA 4HV6A 1LVKA 4Q5SF 2OD5A 3HEFA 2E2IA 4BQQA 2DA3A 1UHSA 1IN7A 2QQ8A 5M3FJ 2P8TA 1H89C 3BJ6A 4RGSA 3BPXA 3BG6A 1HKSA 2L9SA 2VQHA 2ECBA 1K7AA 3QQAA 3C2HA 1UELB 3E3VA 1WQHA 2JQ7A 2PFBA 1E0EA 3LSJA 3OMYA 2HR3A 2UXXA 4L5EA 3F21A 3A03A 5CPRB 2DQLA 3LSIA 1OCRH 2I8DA 5D5WB 1QQIA 3R0JA 2ZJRF 4H0EA 4B44A 4EQQA 2DA1A 3IH2A 2M8EA 1XGOA 1IDYA 2VB6A 3LQQA 2KT0A 1ULYA 2FUG2 3GTGJ 3S1QJ 1ZGJA 2HNHA 2TDXA 2P5KA 2M9HA 4RAZA 5CVRA 4HAMA 2ZSIB 2LBFB 3FXUA 3ZQIA 1U2WA 3BJAA 1DP3A 3QP6A 4BDYA 1BIAA 3G3ZA 3S2DJ 3FXRA 4QWQA 2OV7A 1O7FA 1FP2A 1BI0A 1RI7A 1LDDA 1VQ6I 2KRFA 1ZYRD 3G1OA 1J5YA 1GXPA 1X3WB 2CUFA 4YFXF 4ESBA 2ZJPF 3ASNH 3PFIA 4IF4A 4P9FA 4FISA 3R4KA 1RR7A 4CSWA 3NAUA 5GP9A 1EF4A 4TV7A 2BHYA 1JTXA 2NVTJ 1XGSA 3VWBA 1D5VA 1P7IA 3VYUB 3A01B 4F3EA 2D1VA 1FOYA 1OYWA 5JR3A 1D8KA 1LEAA 2HGCA 4NBQA 4OIQF 2E2HA 4AVPA 2STWA 4MFDA 2JA5J 1FPQA 1WHUA 3WU1B 3GCMA 1IV8A 4Q4ZF 5FD5A 2HOTA 5LEKA 2KIUA 2STTA 4B4CA 3EYIA 1S3JA 3L09A 1YE9A 3U1KA 1I3AA 2PJRA 2FXAA 1IG7A 4OMYA 3E5UA 1YRNB 1P4AA 2E1MC 3FF5A 3KPHA 4XL9A 4Y13A 3ISPA 3TO7A 3NWSA 2K86A 3QU6A 5E20A 4QPQA 2DU9A 2P5LC 5C9HA 3F9KA 3VYSB 5DCMA 1JKRC 3CD6I 1B59A 3FZVA 2QBYA 2JVGA 5D6FA 4DW6A 5LEJA 1S7OA 5FRMA 3FMSA 3GBGA 1ZH5A 3EDPA 1HF0A 1OPCA 1IN8A 2WV1A 4UVAA 4HF2A 1MGTA 4NUBA 3O8GA 5HS8A 3KP5A 4XLPF 3R0AA 2Z2SB 4IKFA 2QKMB 2DPDA 2RNJA 1KZHA 1AWCA 3F8CA 4BNCA 2R5ZB 2H8WA 1ZREA 4WXCA 3MKWB 2XAGA 3IH3A 3OYDA 5DD8A 1D8JA 3ROUA 4B09A 1FSEA 4ASNA 1ENHA 1MW7A 3AL0B 5C4XJ 3CUQC 4RB0A 3BZKA 3F23A
chains in the Genus database with same CATH topology
1J09A 4II3A 4C9YA 4ZYAA 1WJFA 4BL0B 2B63A 4N4NB 2UWMA 2AQEA 2R92A 3IAS2 4G6TB 1T0FC 4AYBA 3UR3C 1BOBA 2VJIA 3VSKA 3MD2A 3HUGB 2BOLA 3S93A 1OLTA 1X1BA 4LITA 3H5AA 4RMNA 2UV1A 3LSMA 4XR6A 2MC4A 1SC7A 5HVQC 3A2KA 3OYEA 3W2AA 3DWLE 3VSLA 4H3TA 2HVQA 3K70C 3KEYA 4FASD 4EATA 3L2VA 1X19A 2WAFA 3UNGC 5HLTA 2R7TA 2XAUA 2VKHA 3LHPS 4FGUA 4X0GA 4RM3A 2K5CA 2KZVA 3GTJA 1MNDA 4J00A 2LREA 1R6RA 2CV0A 3CMMA 3DKYA 4XN0A 3LL7A 4YELA 5KNLA 1K6YA 2ZXIA 4XKCA 4B47A 2XF5A 4DBRA 2XDVA 3J7AY 3K70D 1K83A 3OYMA 3S3OA 2NOJB 2ZXHA 4RLQA 4E7LA 2VJJA 3SJRA 4BJ6C 3BCBA 2F5VA 3FDYA 3H5NA 4BEHA 3S3NA 3RPUD 3OYLA 2P0WA 3HOSA 2V26A 2A5WA 4HNTA 1X1DA 3K57A 3GTGA 1PYVA 4IP8A 2KPMA 1P9QC 2VPLA 3HG9A 1SFKA 2E5NA 4XONA 4AU7A 1GE9A 4E7KA 4XNFA 3K5NA 2DT6A 2XF6A 2BE5D 4PUSA 4KDDA 1PJRA 1U0JA 5CQGA 4Y33A 1X1AA 3RTRA 1Z3XA 2R7UA 3OR2C 3QODA 4JQFA 5TGTA 1K4TA 4IQJA 3QYEA 2M3AA 2KQRA 1KONA 4DOZA 5HNHA 1S9HA 4O26A 1MMNA 1G8XA 4CCLA 2CW8A 1ISEA 1V9MA 1N75A 4U87A 1EK8A 4RM2A 3K4BA 2JSPA 4BUPA 4ZJZA 3OYIA 3OR1C 3FBNB 4NOKA 2HQAA 1DGRM 2F6CA 2A6HD 3PNYA 4XOTA 1V5EA 1WJ5A 4F52A 2VLAA 3HL2A 3DTIA 2BVMA 1V5GA 4F91B 4HEA2 2AQFA 3QOEA 1EJ9A 3M1CA 2VASA 3H0GA 3GTKA 3OL3A 4KB2A 1WQGA 4P5OA 3K58A 2LBFA 2IS4A 2JA5A 1IS1A 4ZC3A 2MD0A 4E7SA 2K9MA 2DOAA 5JSNB 1TZLA 3QYFA 2MFZA 1Y1VA 4BE0A 3SZGA 3L2QA 2R7SA 2MYSA 2UUZA 3NWTA 3FBIB 4Q5VA 2YU9A 4C2TA 4EJ3A 2VQCA 2R7VA 2M7BA 2A6ED 5JSBB 4F55A 1Y698 1D0XA 4ZTJA 2XSJC 4QIWA 2MABA 1QU3A 1EH1A 3P9AA 3OYBA 1Y1WA 2E60A 4XN3A 2LC2A 4DIQA 4BGDA 3ZXSA 3AFHA 2CW7A 3DU6A 1MNEA 3DKXA 1ERDA 2L5QA 3MMYB 4XLEA 2R7XA 4OAZA 3H9QA 2VQGA 3LSHA 4LIVA 3CP2A 2F4QA 4NQWB 3DU5A 5JHFA 1MMDA 4FXDA 3DTKA 3EUAA 4DBQA 1T8IA 1Y6IA 2X6YA 2BW3B 2ZSHB 3EPZA 1BR1A 3PFYA 4B3XA 4KITB 4BQNA 4PK4A 3OL4A 4N4OB 3H9JA 2X85A 3LF9A 1N77A 3CF2A 2XC7A 1TWAA 4IZZA 4HRIA 4JLRC 1LPQA 4C2MA 2OUMA 3EUHC 2WB1A 5LD2C 3S3MA 1YX5A 4KC6A 4IX7A 3K59A 4PSWA 3GTQA 1A36A 3GTMA 1NG7A 1YNND 1V5FA 1WJDA 4KISA 3D5LA 2A69D 1K4SA 2HDWA 2WADA 2W00A 2KLOA 3PSFA 3KYLA 1W36C 3CQZA 2WY7Q 4GRIA 1MIUA 1OR7C 2CV2A 1RR8C 2M7AA 1WCMA 2L9NA 4PSXA 3H35A 2A6TA 4PFOA 4R79A 2PMZA 1HA8A 3S32A 2LG4A 3DTEA 4ANJA 1IW7D 1R49A 2M4KA 2HU9A 3WVOA 3BLYA 4CCKA 2Y0SA 4CZCA 2KP6A 4XLAA 1I50A 2JUGA 3L2WA 2R7WA 1WJAA 3SDBA 1W36D 1HQMD 3OS2A 3K5OA 4ZDLA 3K5LA 4NC7A 3N05A 1SEUA 2RNGA 3HKZA 4FYDA 2WAEA 3DPTA 4XM3A 3QYBA 4CCMA 4AHCA 1TGOA 2NVXA 4XKBA 4C2UA 2VL8A 4MLOA 2BVLA 4HSTA 3OIPA 2W7NA 2E5ZA 1AA7A 4D1QA 2VKDA 4XKWA 4CUGA 2V1NA 3AL0C 1X4OA 1GLNA 2DT7B 2WAQA 4ITVA 4PJNA 2RREA 4JOMA 3VDXA 4QCLA 4NC8A 2L7KA 3MKZA 1I3QA 5HOOA 2LRDA 2OC6A 3K4LA 1Z21A 2BW3A 4BJTA 1DGWY 3A1YA 2VQLA 1LFPA 3CZ6A 1ZELA 2KDOA 4FETA 4XKVA 4XQFA 3OYCA 2CS3A 2IGNA 4PFPA 3PUBA 3AKZA 4NOMA 2V4JC 3OYFA 3OIQA 1SFOA 2DJIA 2KRCA 2W82A 2B9SB 3CP8A 4HPQA 4BACA 1A31A 4ZDPA 4Y3OA 4H4KC 2HPMA 1WFXA 2R7ZA 2V6EA 2R4GA 2CV1A 1YX3A 4B48A 3M4AA 2WBMA 2KMUA 3IUOA 2LYCA 3ZCOA 1R9TA 4D9JA 3K4JA 1Y56A 4AVZA 2CMPA 4U7BA 5HNFA 3MAQA 3OYKA 2K9LA 4F3QA 4KB4A 2IGOA 3OS0A 4XLCA 3RCOA 1JI8A 3FKIA 3K4NA 2F4IA 1QHHD 3FHNA 3M8JA 3TMOA 4P1WA 4PJLA 1D1BA 2IS1A 2W1OA 3ZGKA 3OYHA 3GTOA 3L2RA 2Z1DA 3EUKL 2JVHA 4BDZA 2KHMA 5CKTA 2DXIA 1WJEA 2NVYA 4XOPA 4LG3A 4CCJA 2LY2A 4PJJA 3K4KA 4HG2A 2V9KA 3VYTB 3OYAA 1SMYD 1WQFA 1TWFA 2IS2A 4DGWB 2LH9A 1T95A 3G2BA 4E7ZA 2IS6A 3E0JB 4CA0A 3K10A 2L2OA 4RLFA 4BU2A 2JA6A 1LDKB 2M0MA 2Q2EB 2IGMA 3W3CA 4GFQA 3OYGA 4OYDB 4BEHB 4IP9A 2LY1A 2RQQA 3VYRB 1TT0A 2X1CA 1Z3YA 3K4CA 3LFUA 2WA0A 3D5SC 4L8IA 1SAUA 2K3PA 3V42A 4LIUA 4IQ4A 3LSGA 4XLFA 1X4PA 3PNTA 4PJMA 2O5RA 4E6KG 2CH0A 4YRVA 2X6WA 1N78A 1Q8IA 3H0DA 1LVKA 2GOMA 1UAAA 2X51A 3LSKA 4CCOA 2E2IA 2R7QA 3HXLA 3ZRGA 3U21A 3DPLC 3DPUA 4BQQA 3PJRA 3L2UA 1TWCA 2HPIA 1D0YA 3TBIA 3OOUA 3K6GA 3BG6A 2VQHA 2L9SA 4E4HA 3CJRB 1YNJD 3C2HA 1UELB 1WQHA 2HZDA 2CUJA 2Q1ZB 4II2A 2E1MB 1E0EA 2IGKA 1TWGA 3OMYA 3CJQB 2CFOA 5CPRB 5KHDA 3BG7A 3IP4B 3ZQQA 2PJRB 3LSIA 3A4CA 3RQ4A 2I8DA 3HPGA 2M4GA 4OAYA 4E7IA 1WJBA 3S8PA 4B44A 1TL8A 3K5MA 4ZDOA 3HOTA 2VB6A 2FUG2 2HNHA 3E1SA 1D1CA 2W4SA 4XMYA 4ZTFA 3H9GA 2R7RA 3C2GA 1EA3A 2ZSIB 2LBFB 4AN8A 3DLAA 3I3LA 4BJ5C 4F92B 1DP3A 4BDYA 1Z7LA 2R93A 1RRJA 5MLC9 2O5JD 5FRNA 2JA7A 3W2WA 3HC7A 1DQUA 2OV7A 3PNVA 4NNJA 3OS1A 3GTLA 3I9V2 4Q5GA 2XF7A 4YEJA 1ZYRD 2VJ5A 3OYNA 1DD5A 4BE2A 3OWTA 2KL4A 3SYTA 3SEZA 3PSIA 2ZFUA 3RSNA 3D5RC 4BXFA 2Z16A 4CSWA 3K4MA 4BE1A 3BCAA 4XLHA 4E7JA 4C30A 1NG6A 3VWBA 3VYUB 2X1DA 4F3EA 3OY9A 3HPHA 2HVRA 2A68D 3KX2A 3OYJA 2E2HA 2VUMA 1IRXA 4Y4RA 2VXZA 2R7OA 3PL8A 4HSRA 3W2VA 3MKYB 1NH3A 4OWRB 4B43A 3ONQA 3TL4X 2IXSA 1FMWA 1MMGA 3CESA 4LMOA 4D3YA 2X6XA 5LFAA 5KCMA 1BR4A 4KT6A 1YE9A 3ZR8X 2KRHA 3FKJA 4F93B 2VIXA 2VXDA 2PJRA 1I6VD 4KAWX 3IAM2 4CH7A 1A35A 2V7FA 3BC8A 5FROA 3IAYA 4E7HA 2E1MC 2JA2A 2LOOA 4XL9A 2DCEA 4HNUA 4BS9A 2HVSA 2CW0D 1WJCA 3LMMA 3NWSA 4DJAA 4D3ZA 5C9HA 4QPQA 1QHGA 4BQOA 3F9KA 3VYSB 1G59A 4NOLA 2GOXB 2JVGA 1D0ZA 5FRMA 4XORA 3GBGA 3H5RA 4J01A 1D1AA 2ELJA 4NUBA 1X1CA 2Z2SB 4IKFA 2QKMB 2WY8Q 1FMVA 1VZ0A 1R5ZA 2QKLB 1TWHA 4KJZA 5CQEA 2CUZA 3SEQA 3MKWB 3OYDA 3GTPA 4CCNA 1LKXA 4QPOA 2VJ4A 1MMAA 1UG0A 1BR2A 3DQVC 1MW7A 3AL0B 2X1EA 3DEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C9H A;  2R4G A;  4LMO A;  5CQG A;  3DU5 A;  4O26 A;  3DU6 A;  3KYL A; 
#chains in the Genus database with same CATH topology
 4C9Y A;  2QCO A;  1QPM A;  4IHX A;  4BL0 B;  1YTY A;  1T39 A;  3GTQ J;  5DDG A;  4RB3 C;  2KJB A;  5F08 A;  3GTM J;  3I59 A;  1UZC A;  2R92 A;  2MC3 A;  4AYB A;  2AXL A;  3TDZ C;  2X0L A;  1OYI A;  4EJW A;  2EIN H;  4X6A J;  5L3B A;  3JAM Z;  5E1W A;  1OLT A;  5D5X B;  3LSM A;  4HYE A;  2DMU A;  3ZN0 A;  3BP8 A;  2MC4 A;  3KFW X;  2QM3 A;  1R71 A;  3OYE A;  2EFW A;  2VKE A;  3IRQ A;  2ZJ2 A;  5K7H A;  1I6X A;  4XID A;  1I39 A;  3GVA A;  4FGU A;  2FOW A;  4A5M A;  2K5C A;  2MH9 A;  3GTJ A;  2CO5 A;  2ZME B;  1Y8Q B;  2VON A;  3CMM A;  2CQQ A;  1HW2 A;  3BZC A;  4EV0 A;  4MFE A;  2LTP A;  2BGC A;  3F72 A;  1A04 A;  3BG9 A;  4NDL A;  2IW5 A;  3MQ0 A;  2CUE A;  2NOJ B;  4G8X A;  2OTJ I;  4E7L A;  3SJR A;  3I4P A;  3QPS A;  4FTH A;  4A3M J;  2R5Y B;  3OYL A;  2P0W A;  3CLQ A;  4UUT A;  2UXN A;  2M1B A;  5FO5 A;  3F0C A;  5J6X A;  2Y0M A;  1N25 A;  5H6Q A;  4OIN F;  1VQM I;  3QP5 A;  3MCZ A;  3KZZ A;  2HTJ A;  1KGS A;  2E5N A;  4AU7 A;  3LSR A;  2CSO A;  2ECC A;  4E7K A;  2DT6 A;  2XF6 A;  3K5N A;  1G3Y A;  1W4M A;  2L4M A;  3E5Q A;  3LA7 A;  3S2H J;  1G2H A;  2FBI A;  2YUS A;  1STZ A;  1WH5 A;  4Y33 A;  1CQT A;  3W6V A;  2R7Z J;  1L0O C;  3J7Z I;  5BPD A;  1ZG5 A;  4U0V A;  1K4T A;  5HLH A;  3QYE A;  4M6Y A;  1YO5 C;  2M3A A;  4XRS A;  3I55 I;  2FF4 A;  1TNT A;  3KIO A;  4KIF A;  1WGX A;  4L9T A;  3BG3 A;  2DT5 A;  4N9I A;  3WU0 A;  4BKX A;  1UG2 A;  1JXS A;  4RM2 A;  1EK8 A;  3H36 A;  3K4B A;  1TQM A;  4BUP A;  4ZJZ A;  1IXC A;  3COA C;  1DGR M;  2ZNZ A;  3GTO J;  3FXK A;  3J81 Z;  2XRN A;  1T98 A;  3MKL A;  2NNY A;  1XD7 A;  3IKT A;  2XGC A;  2XPV A;  4HW0 A;  4EVI A;  4M71 A;  1W7P B;  3OL3 A;  3R6S A;  5E3N A;  3V4G A;  3K58 A;  2LBF A;  5HLG A;  1IS1 A;  4ZC3 A;  2TRT A;  2B0L A;  1GHC A;  1S8N A;  1FWZ A;  1KU7 A;  3QYF A;  2MFZ A;  3O8H A;  3SZG A;  4E70 A;  2XKP A;  2MYS A;  2UUZ A;  1QPI A;  3GFI A;  4C2T A;  1ETX A;  1KA8 A;  5B66 C;  4F55 A;  4LB6 B;  2EA4 A;  4UUV A;  1T6S A;  5J8C A;  1GV2 A;  1ACI A;  1EH1 A;  5ICG A;  3OYB A;  2E60 A;  4XN3 A;  2LC2 A;  3HGY A;  4YFK F;  4BGD A;  5FLM J;  1HCR A;  2M45 A;  2CW7 A;  4DYQ A;  1ERD A;  1SAX A;  1TWC J;  2R7X A;  4R1H A;  4M3E A;  4LIV A;  3CP2 A;  2F4Q A;  5FFZ A;  2IBD A;  1VTN C;  1MMD A;  2H1L A;  4A6E A;  5HDN A;  3B6C A;  5EGO A;  1Y6I A;  3PFY A;  5ILU A;  2XV4 S;  1ZLJ A;  4BQN A;  1ZQ3 P;  3H9J A;  4G6D A;  3ZQG A;  1MSF C;  4HDV A;  4ESJ A;  1N77 A;  3CF2 A;  1LVA A;  2OZU A;  4IZZ A;  4HRI A;  1NK2 P;  1MBG A;  4C2M A;  3EUH C;  2I5U A;  3S3M A;  4PSW A;  3GTJ J;  5HDG A;  1NG7 A;  1OR7 A;  3TED A;  2Q8K A;  4Z2Y A;  3J80 Z;  3D5L A;  3WTT C;  5F1R A;  2HDW A;  4O6J A;  2H6C A;  3PSF A;  1IN4 A;  3ASO H;  5DUK A;  2WY7 Q;  5LLQ A;  4GRI A;  4RGX A;  1MIU A;  2F5D A;  4HX8 A;  4UB6 C;  1MNM C;  4PSX A;  3H35 A;  4PFO A;  4AWX B;  4R79 A;  2PMZ A;  3DTE A;  1VQK I;  3WVO A;  3HSR A;  5E18 F;  4PGH A;  5B1A H;  3MEX A;  5J1R A;  4C3H J;  1LDJ A;  3GFM A;  4XLA A;  4RS8 A;  3CCY A;  5HLI A;  5M5W J;  5K1Y A;  3K5O A;  4ZDL A;  2L3D A;  1JUM A;  1S7E A;  2OU2 A;  4CYC A;  1JT0 A;  4FYD A;  5IT3 A;  3DPT A;  3CME I;  3I71 A;  3FWE A;  3QYB A;  4CCM A;  2NVX A;  2MH2 A;  4XKB A;  2XRO A;  1ZG1 A;  2NRA C;  1QBJ A;  3CJN A;  1TLH B;  2MW8 A;  4HST A;  2VUM J;  4R8H A;  2E5Z A;  3PO3 J;  1AA7 A;  4XKW A;  2E36 A;  5K7Z A;  2WAQ A;  1GLN A;  2L54 A;  4QCL A;  3VDX A;  2YX7 A;  2L7K A;  1KQ9 A;  2BW3 A;  2YU3 A;  1T08 B;  1LFP A;  1ZEL A;  5DYM A;  1RNL A;  4FET A;  4XKV A;  2ZJQ F;  3PUB A;  2V4J C;  5GPC A;  5F27 A;  3DEU A;  4ZYG A;  2KRC A;  3E6M A;  1G3S A;  4M72 A;  2ADU A;  2QYO A;  1WFX A;  1WPK A;  2LR8 A;  2R4G A;  2CV1 A;  2M2E A;  2JPC A;  3L00 A;  1GUU A;  2A69 F;  3QPT A;  4UHT A;  4B48 A;  2LYC A;  5LGU A;  1R9T A;  4IRI A;  3MAQ A;  2DFI A;  3JRE A;  4F3Q A;  3S1N J;  1VQO I;  4I02 A;  1NHA A;  3FKI A;  3K4N A;  3BQY A;  4GCV A;  3C2B A;  1IW7 F;  3K9T A;  4PJL A;  1D1B A;  1RIO H;  3DBH B;  3OYH A;  2FBK A;  1XPX A;  1EKE A;  3M3Y J;  3EUK L;  4IHT A;  2NOG A;  5C4J J;  1HSJ A;  4PGG A;  4AM3 A;  2X48 A;  5DV5 A;  2H8R A;  2BBY A;  2QF7 A;  2DI3 A;  2IRF G;  1SMY D;  1TWF A;  3JRF A;  1T95 A;  2PQ8 A;  3B6A A;  3Q3S A;  4CA0 A;  3F6O A;  2L2O A;  4RLF A;  4HX4 A;  4BU2 A;  4QLC U;  5BNG A;  2IGM A;  3W3C A;  3OYG A;  1XMA A;  3BT9 A;  4OYD B;  2LY1 A;  2HS5 A;  2RQQ A;  1U8B A;  4LOC A;  1TT0 A;  4CZZ A;  3W6K B;  2V9V A;  3K7A J;  4OMZ A;  4N0B A;  4D7M A;  4OIP F;  3GW2 A;  3CTA A;  3F8M A;  2HZT A;  3PNT A;  2O5R A;  4NB5 A;  4XRM A;  4HLY A;  1O4X A;  5D4R A;  3BPV A;  4I2O A;  1IRG A;  2IJL A;  3WGG A;  2R7Q A;  4CCO A;  2JMW A;  4A12 A;  1ZR2 A;  3U21 A;  1Z1D A;  5FFX A;  3W6J B;  2H94 A;  2VOO A;  1VQ7 I;  5GAE J;  1XX5 A;  3TBI A;  3OOU A;  5EZH A;  4MQ9 F;  1ORK A;  3KEQ A;  1K78 A;  2AS5 F;  1AHD P;  3MWM A;  2OTL I;  1B1B A;  2CFO A;  5KHD A;  2EFQ A;  3BG7 A;  3IP4 B;  5GPA A;  4ZYH A;  2PJR B;  3RQ4 A;  4HF1 A;  4OAY A;  2EFO A;  5M5Y J;  1TL8 A;  4ETS A;  3K5M A;  2OQR A;  4RDU A;  1VQ5 I;  4HX7 A;  5DCM B;  3QAH A;  2HOA A;  3DLL F;  4PCQ A;  2VPR A;  3E1S A;  1D1C A;  2QBY B;  4ZTF A;  3H9G A;  2M30 A;  2F5C A;  2OZ6 A;  2VBW A;  3V8J A;  1O3T A;  3C2G A;  2A07 F;  2XAJ A;  4Q48 A;  4AN8 A;  1YJ9 I;  4BJ5 C;  1OCT C;  3V7R A;  1Z7L A;  2R93 A;  1JGS A;  1J75 A;  5H2F C;  2O5J D;  3JRB A;  1R23 A;  3FM3 A;  2VOD A;  2A5Y B;  3HC7 A;  4UVB A;  3RJP A;  3C18 A;  2QGU A;  1ONV A;  2E2J J;  1ETQ A;  3OS1 A;  1OMI A;  1WQ2 A;  4M6X A;  3ABM H;  5J47 A;  2OF7 A;  1C0W A;  3CDL A;  4IOA F;  2Y69 H;  2HEO A;  3I9V 2;  4Q5G A;  1JTY A;  2F5F A;  2VJ5 A;  1TP4 A;  3PM1 A;  3DEW A;  3HOV J;  1M1E B;  3OWT A;  1BOA A;  2L9R A;  3LWF A;  3DBL B;  1I1S A;  1U3E M;  3PSI A;  2ZFU A;  3F8F A;  3RSN A;  4BXF A;  2EZK A;  2MBF A;  3G73 A;  4BE1 A;  4KMU X;  1TC3 C;  3MZ8 A;  2LNB A;  1PDN C;  1T56 A;  3K2Z A;  2KIQ A;  1NG6 A;  2MLK A;  5KVR A;  3KLN A;  4V2G A;  2ZO4 A;  4XLN F;  3OY9 A;  3H0G J;  3A02 A;  3BJO A;  5J1Y A;  1YW7 A;  3KX2 A;  3OYJ A;  4KFC A;  5DEQ A;  1O3R A;  4Y15 A;  2VT3 A;  1Y8R B;  3PL8 A;  2O9L A;  3W2V A;  2X9D A;  3PUF A;  2FQ4 A;  1Y1V J;  4RB1 A;  5F6F A;  3TL4 X;  1X3U A;  1FMW A;  1MMG A;  2IXS A;  1ETK A;  1VFC A;  3FMQ A;  2YU9 J;  4J19 A;  4EJU A;  5KCM A;  3FKJ A;  4KAW X;  2QSG X;  4IHY A;  1YIT I;  4IPA A;  4JX4 A;  4CH7 A;  4D5F A;  2V7F A;  3BC8 A;  5FRO A;  4YFN F;  4Y17 A;  4HNU A;  3U9G A;  4BS9 A;  1Y1W J;  2CW0 D;  1WJC A;  3F22 A;  1FIP A;  2NNN A;  1TWF J;  2VBZ A;  1Z9C A;  2EV6 A;  4NOL A;  2GOX B;  2RV8 A;  1D0Z A;  3BTC A;  3SDG A;  2LVS A;  3H5R A;  3RDI A;  1RC9 A;  2TCT A;  1BJZ A;  2E35 A;  3R61 A;  2P81 A;  4KT5 C;  1D1A A;  4UY8 I;  2HQR A;  1WZ2 A;  3I4N J;  2HQN A;  1X1C A;  2HOS A;  2BV6 A;  2WY8 Q;  1ZYR F;  1FMV A;  1VZ0 A;  3K1N A;  1I27 A;  3JSO A;  1R5Z A;  1TWH A;  3HM5 A;  2DLL A;  3ERE D;  5ICC A;  2OCC H;  1DU0 A;  4CCN A;  2IA0 A;  4QPO A;  3M8F A;  2VJ4 A;  2EA2 A;  2XKO A;  3DQV C;  5K5R A;  3LA3 A;  1HC8 A;  1TWA J;  2PN6 A;  3OSF A;  3K69 A;  1T0F A;  3DEE A;  5EEG A;  1SVL A;  5DM6 F;  4II3 A;  2GLO A;  4G9Y A;  4ZYA A;  1VQ9 I;  3K0L A;  1WJF A;  3AG1 H;  2DTR A;  2UWM A;  3S15 J;  5TJJ A;  3BY6 A;  3IAS 2;  4G6T B;  3UR3 C;  3OIO A;  4LLN A;  1OJL A;  1TQI A;  1WKM A;  2X6O A;  3Q0V A;  2ZXW H;  3I4M J;  3HDD A;  3C1D A;  4QIW N;  1X1B A;  4LIT A;  4GFB A;  3H5A A;  2PLY A;  2UV1 A;  3FXM A;  1SFX A;  3IWZ A;  1FOX A;  4L5J A;  4RAF A;  1S29 A;  3DWL E;  3RI4 A;  2CWE A;  3K70 C;  1I50 J;  3KEY A;  4FAS D;  1J2X A;  3L2V A;  2DMP A;  3UNG C;  3FK7 A;  5JLX A;  1O7L A;  3RQI A;  1HBX G;  2R7T A;  2ACJ A;  3GFL A;  3CCM I;  3LHP S;  3PQK A;  1FBS A;  3K2A A;  4FQG A;  4M9Z A;  5TIS C;  2LLK A;  1V55 H;  3WTW C;  2F2E A;  2VE8 A;  4Z6Y A;  4ON0 A;  1ZKG A;  5IP9 J;  4J00 A;  2LRE A;  1R6R A;  2CV0 A;  2P4W A;  3DKY A;  4YEL A;  1ZAR A;  2NS7 A;  4B47 A;  2CGP A;  3IRR A;  4LG0 A;  2W48 A;  4DBR A;  4KDP A;  3K70 D;  1UJ8 A;  2HXO A;  1K83 A;  3S3O A;  3ZQH A;  3H3U A;  2DAO A;  3C7J A;  2OQG A;  2VJJ A;  5FLX K;  4RAY A;  1HQC A;  3ESW B;  3S3N A;  1S7A A;  2F5V A;  2DO7 A;  1R1V A;  2Y9Y A;  3RPU D;  2GM4 A;  5E8G A;  3HOS A;  3JRC A;  1YFH A;  2L9V A;  1SFE A;  1PYV A;  4IP8 A;  4IXA A;  1XMK A;  3ABK H;  3UKG A;  1D3Y A;  3BQZ A;  4XON A;  2DFF A;  4LGW A;  1H0M A;  4CO8 A;  1DP7 P;  2BE5 D;  3GWZ A;  1WSU A;  2COB A;  1YG2 A;  5EGO B;  4KIG A;  1KON A;  3NQO A;  1UHW A;  1MMN A;  4CCL A;  1JKO C;  2M5W A;  2H09 A;  1AKH A;  3E6C C;  1N75 A;  2FD5 A;  4LLG F;  4D0P A;  5TRD A;  1IZ1 A;  2FQ3 A;  1X3Z B;  3OR1 C;  5ED4 A;  2HQA A;  2A6H D;  2F4M B;  5IP7 J;  3BDD A;  2CYY A;  3AAF A;  2G0E A;  1MH4 A;  2FMY A;  1V5E A;  1DDN A;  4F52 A;  2M8G X;  4FHT A;  2BVM A;  4RB2 C;  4HEA 2;  1FOW A;  4IJA A;  3DCF A;  5HS9 A;  3REO A;  2JRM A;  3QOE A;  4ZYD A;  4HQE A;  1UHM A;  4YII A;  2DK5 A;  1XB4 A;  2QLZ A;  4KB2 A;  3JW4 A;  1Y39 A;  2JA6 J;  1BW6 A;  1KQ8 A;  2MD0 A;  2GBY A;  2JJ7 A;  3M1E A;  4L9V A;  5JSN B;  1TWH J;  4M3B A;  4Q5V A;  4ZH4 F;  3FBI B;  2DK8 A;  2M7B A;  2V1U A;  1QNT A;  2ZME C;  2A6E D;  2P7C B;  4HBL A;  1Y69 8;  2DA2 A;  2XSJ C;  4FT8 A;  3SZP A;  4Q47 A;  3P9A A;  4CYC B;  4QTR A;  3JRG A;  1IUY A;  2E2I J;  2K02 A;  4BQA A;  3ZXS A;  1Z0X A;  2EBI A;  4A0Y A;  3AFH A;  3DU6 A;  1F5T A;  3DKX A;  1ZN2 A;  3MMY B;  4XLE A;  1LNW A;  3IWF A;  4KN4 X;  3H9Q A;  2VQG A;  4GGG A;  2PI0 A;  2D5V A;  3S16 J;  2DYS H;  3RYR A;  2R0Q C;  1Y0U A;  4FXD A;  3E6D A;  2E7W A;  4FE4 A;  4DBQ A;  2EZI A;  2R3S A;  2BW3 B;  4B3X A;  5DD4 A;  4KIT B;  4EM1 A;  3HYI A;  4O3M A;  3OL4 A;  4N4O B;  2X85 A;  5FKM A;  5F0F A;  3LF9 A;  2OA4 A;  3QPH A;  1W0U A;  1RET A;  4JLR C;  3M7G A;  2OUM A;  2O0Y A;  4GYI A;  5LD2 C;  3DXJ F;  5A2Q K;  1A36 A;  2P6T A;  1YNN D;  1WJD A;  2K3F A;  1OCP A;  2WAD A;  2FNP A;  3ECO A;  3WTS C;  1J59 A;  2RKH A;  5K7F A;  2ESH A;  2FE3 A;  3KYL A;  3HOX J;  3CQZ A;  2HWV A;  4I01 A;  3RKQ A;  4A3G J;  2JK3 A;  5F04 A;  4AC0 A;  2A6T A;  3BR1 A;  1UST A;  2XGD A;  1X58 A;  4A3L J;  2Y30 A;  1Z6R A;  2ETH A;  3JRH A;  4A3E J;  2HU9 A;  3BLY A;  4CCK A;  2KP6 A;  3Q9V A;  3TOA A;  1EH8 A;  1SMT A;  2JUG A;  5HOD A;  2WB1 N;  5IP6 A;  4MQV A;  1HQM D;  3SDB A;  1FIA A;  3K5L A;  3CF5 F;  3BZ6 A;  5FD6 A;  1OYY A;  2RNG A;  5CYV A;  1SEU A;  4MEY F;  3ULQ B;  4WCG A;  4RA2 A;  2IPQ X;  2Q0O A;  4C2U A;  1W7P D;  3RIR A;  1MD0 A;  4UVC A;  1UB9 A;  3ZMS A;  5M3M J;  2E2H J;  1ODD A;  3S1R J;  5BOX A;  4CUG A;  1ON2 A;  3CO6 C;  2DT7 B;  4NQW A;  1JUS A;  2Y0S N;  2Z99 A;  1I3Q A;  5EEH A;  2LRD A;  3K1P A;  4I76 A;  3I53 A;  2C6Y A;  1Z05 A;  4BJT A;  1DGW Y;  4BAY A;  2OAZ A;  1O57 A;  3OYC A;  2K4B A;  4XRF A;  3GUD A;  1RUO A;  2XIG A;  1JHF A;  2K9Q A;  3F8N A;  3OIQ A;  3V7S A;  3JRA A;  2W82 A;  3HKZ N;  1SFO A;  4HPQ A;  4BAC A;  4ZDP A;  4Y3O A;  4H4K C;  2NXN B;  4LMY A;  4JYK A;  3ZMT A;  5D4S A;  4U7D A;  1K78 B;  2HPM A;  3RZO J;  5H6R A;  3FIS A;  2V6E A;  2RDP A;  1MMS A;  3M4A A;  2AHQ A;  2GWR A;  4DZJ A;  3IUO A;  5EZG A;  3HTU A;  4D9J A;  3G6E I;  3EQL F;  1B72 A;  3DKW A;  4AVZ A;  2CMP A;  5HNF A;  4LB5 A;  2FRH A;  3FHZ A;  3E6B A;  1ZLK A;  2IGO A;  1V54 H;  1BW5 A;  1F4K A;  1ZRC A;  5L3E A;  1IUF A;  4HV5 A;  1K79 A;  1PVE A;  3MZH A;  4CDG A;  2QVO A;  2P6S A;  1E3H A;  2ME0 A;  4ENN A;  2IS1 A;  1FT9 A;  2DW4 A;  4UUS B;  3I0T A;  4OU0 A;  1G3T A;  2NS0 A;  3A0H C;  1GV5 A;  4BDZ A;  2KHM A;  5CKT A;  2DXI A;  2NVY A;  4IRH A;  3S2W A;  2FX0 A;  1U5T A;  3LFK A;  5BMZ A;  2HXI A;  5IT9 K;  1BM9 A;  2L01 A;  3BTL A;  3VYT B;  3OYA A;  3JTG A;  4WX9 A;  1XSD A;  2IS6 A;  5J40 A;  2DQR A;  4NHJ A;  2JWT A;  2R92 J;  5CVU A;  2K7L A;  1OQY A;  2W57 A;  1HST A;  2O8K A;  1LE8 A;  2BY2 A;  2ID6 A;  3LOC A;  4BEH B;  4IP9 A;  3FXL A;  2GA1 A;  4CGZ A;  1Z3Y A;  2X1C A;  4CYD A;  3LFU A;  2WA0 A;  1VND A;  2HI3 A;  5AIQ A;  3IHU A;  3CC4 I;  1EH6 A;  1EH7 A;  1UFM A;  1XC5 A;  3P9C A;  4PJM A;  2CH0 A;  1Q8I A;  1T38 A;  2HQ5 A;  3H0D A;  1IF1 A;  1FLI A;  3NEU A;  3AG3 H;  4G12 A;  3HXL A;  3ZRG A;  5E3L A;  1WWX A;  2OBP A;  1P92 A;  3PJR A;  3ERM A;  1ZHF A;  5CVV A;  3L2U A;  4A2U A;  1IJW C;  2HPI A;  3BTJ A;  1MH3 A;  5JFR A;  2B9S A;  5E8I A;  4M3D A;  3K6G A;  1HXD A;  2E34 A;  3TGN A;  1IXR C;  2LY9 A;  2Z3Y A;  1QA6 A;  2H6B A;  1ITY A;  1B4A A;  2CUJ A;  1TWG A;  1BI2 A;  3E5X A;  3H3Z A;  3CJQ B;  4OIO F;  2LF7 A;  2O6G E;  5L3D A;  1MBH A;  1XCB A;  2LFB A;  3ZQQ A;  1TTY A;  4V19 K;  3VPR A;  3A4C A;  3HPG A;  2HOE A;  4L0Y B;  4E7I A;  1WJB A;  3GEZ A;  4JX6 A;  2JSC A;  3GF2 A;  1VF9 A;  3F3X A;  3IH4 A;  4UXN A;  3BR2 A;  5FGM A;  2GXA A;  2LSO A;  2Y31 A;  4HOB A;  1VQ4 I;  4ZDO A;  4WF2 A;  2QSH X;  2G7U A;  1JUP A;  4QSH A;  3M4O J;  1FEX A;  2RQP A;  2W4S A;  4XMY A;  2R7R A;  4LLL A;  4AYB N;  3CC7 I;  3I3L A;  4F92 B;  3MN2 A;  2YR2 A;  2BY1 A;  5MLC 9;  2JA7 A;  3W2W A;  1U8R A;  2FBH A;  4I99 C;  2FSW A;  4NNJ A;  3GTL A;  1MJ9 A;  5LGN A;  1XDU A;  1R1T A;  1GVJ A;  3TO6 A;  3GXO A;  4ENJ A;  3OYN A;  3VOE A;  1DD5 A;  4OIR F;  4KYW A;  3SYT A;  2IVM A;  1MBE A;  3SEZ A;  2GAU A;  5EDN A;  3D5R C;  2Z16 A;  1HDD C;  1APL C;  1B8I A;  3K4M A;  3BCA A;  4Y7N J;  5AON A;  4HQM A;  4E7J A;  4PDK A;  4MTE A;  1E17 A;  4C30 A;  1H8A C;  1FOK A;  2EIL H;  3P9K A;  1JGG A;  3NRV A;  2X1D A;  4O5V A;  2A68 D;  3TP3 A;  2R7F A;  3WTV C;  2KFD A;  5JLW A;  1LEB A;  1IRX A;  2M34 A;  4Y4R A;  2R7O A;  4A5N A;  4XIC A;  3HOY J;  4WK8 F;  5D6E A;  3MKY B;  1NH3 A;  1IN6 A;  1WH7 A;  2COM A;  2EK5 A;  3ZQF A;  2QZ8 A;  4ABZ A;  3ONQ A;  4B43 A;  3AG4 H;  4MNU A;  1TNS A;  1KU2 A;  1USS A;  3CES A;  4LMO A;  4D3Y A;  2X6X A;  4IL6 C;  1BR4 A;  4KT6 A;  3ZR8 X;  4F93 B;  2KRH A;  1I6V D;  2VXD A;  2XVC A;  2NVU B;  3IAM 2;  1A35 A;  4EJV A;  3KYC B;  3VB2 A;  1MBK A;  2GA2 A;  2QSF X;  2VBY A;  1FY7 A;  3ZMZ A;  2JA2 A;  1X2M A;  2LOO A;  2DCE A;  3MFK A;  3HTS B;  1HKT A;  2HVS A;  4RGR A;  4I0B A;  4DJA A;  3H1C A;  4IHS A;  4LK1 F;  2EJR A;  3HIF A;  4LG0 B;  2FML A;  3GZ6 A;  3Q9S A;  9ANT A;  4YIR X;  5D5U B;  1IXS B;  3WTU C;  3J7A O;  2ELJ A;  1AU7 A;  2FOK A;  4GO1 A;  3K1M A;  4GYG A;  4P55 A;  3QPL A;  4XK4 A;  3TKY A;  5EEA A;  2EFP A;  2QKL B;  4I7H A;  1W0T A;  3ECH A;  5DS9 A;  5LHG A;  1KYW A;  3CUQ A;  5CQE A;  4DYC A;  3FK6 A;  3SEQ A;  2KJC A;  3E7L A;  2ICW G;  3GTP A;  1JJ8 C;  1LKX A;  1IDZ A;  1FTT A;  1SD6 A;  2LDU A;  1UG0 A;  1BR2 A;  3KCC A;  4A0Z A;  1YS7 A;  2KIM A;  1PP8 F;  3HHG A;  5JVG F;  4C2M J;  3ZQL A;  1J09 A;  2B63 A;  2DFE A;  1HLV A;  1D5Y A;  5CVI A;  3G71 I;  5LRR A;  2CG4 A;  3IV5 A;  4EEF G;  4G6Q A;  4I0A A;  2ZCW A;  3BR3 A;  5CLS A;  4A3B J;  2VJI A;  1R5G A;  1AKH B;  4DYR A;  3P7N A;  2BOL A;  4B1R A;  4ESF A;  2ISY A;  4K2E A;  5FKO A;  3S93 A;  5IPA A;  3L1P A;  4RMN A;  1Z67 A;  2D45 A;  5J4V A;  1P4W A;  4KN7 X;  3SFZ A;  2V79 A;  5HVQ C;  3A2K A;  1TT5 B;  3GME A;  3VSL A;  2EIK H;  2LMD A;  3HSE A;  3WGH A;  1FYK A;  2WTE A;  1DPU A;  4EAT A;  1X19 A;  5DCF A;  4M9X A;  1O3S A;  4UUS A;  2VKH A;  2XGE A;  2ZBK A;  4IVN A;  4W97 A;  4X0G A;  3H3V K;  4RM3 A;  4XBF A;  1CGP A;  3WE2 A;  3U2R A;  3CCV I;  3HOU J;  1YW8 A;  1YYV A;  5LRS A;  2NYX A;  3LL7 A;  2NVX J;  1K6Y A;  2ZXI A;  4XKC A;  2XF5 A;  4BHC A;  3LAJ A;  3TQN A;  2KZG A;  3O2P E;  1Y0N A;  3OYM A;  5GTI C;  4RLQ A;  3I58 A;  3CO7 C;  2EIM H;  3RKY A;  1BBY A;  1P7J A;  2DDB A;  4BJ6 C;  3BCB A;  3FDY A;  4BEH A;  4GXO A;  2QWW A;  1ZR4 A;  4BY1 J;  2Y9Z A;  2JT1 A;  2V26 A;  3GTG A;  1JKP C;  1OCO H;  2KPM A;  4RGU A;  2VPL A;  1R00 A;  3CMY A;  3HG9 A;  1TQP A;  1SFK A;  1HKQ A;  3I64 A;  1WI9 A;  2DPU A;  4XNF A;  3V8L A;  4C3I J;  3HBL A;  4KDD A;  4EGY A;  5CQG A;  2RVC A;  1X1A A;  3RTR A;  4XSZ F;  1Z3X A;  3WGI A;  2F48 A;  1FZP B;  2AXT C;  2R7U A;  3OR2 C;  4JQF A;  5TGT A;  1R9T J;  2LKX A;  1H9T A;  2PBI A;  3GFJ A;  4IQJ A;  2PMZ N;  4DOZ A;  5HNH A;  4O26 A;  4W1U A;  2MLG A;  1W5S A;  1R1U A;  2LF8 A;  2ZXJ A;  1FBU A;  1ISE A;  1V9M A;  5IYD J;  3FKI J;  5FJ8 J;  1ZRD A;  1Z77 A;  2WV0 A;  5CVJ A;  3HUG A;  1U6G A;  2JSP A;  4BHP A;  4A93 J;  4A3K J;  3FBN B;  1QRY A;  2A3S A;  1W5T A;  2E1N A;  4EM2 A;  3QU3 A;  3JTH A;  3PNY A;  4AD9 A;  4LK0 F;  3KYD B;  3KLO A;  2CQ7 A;  2VLA A;  1PUE E;  3T5X A;  1QZE A;  1B6A A;  4NC6 A;  3RKX A;  2Z33 A;  2AQF A;  4KIB A;  4AIH A;  1E2X A;  1EJ9 A;  4YG2 F;  2ISZ A;  1WQG A;  2WAQ N;  1IRZ A;  2ID3 A;  2IS4 A;  1F43 A;  2JA5 A;  2IA1 A;  4JK1 X;  4LFU A;  2V6C A;  1QVT A;  2K4J A;  3L2C A;  3PIP F;  4BE0 A;  3NWT A;  3I56 I;  5M5X J;  4EJ3 A;  2R7V A;  4DNC A;  5L3C A;  1U9O A;  5JSB B;  2DA6 A;  1D0X A;  1RKW A;  2BEO A;  2RGV A;  2MAB A;  3JAM K;  3WTY C;  1QU3 A;  1IAW A;  4FE7 A;  3BTI A;  1R36 A;  4IOC F;  2X4H A;  1FYL A;  3RYP A;  3E97 A;  5ILS A;  3BR6 A;  3ZN1 A;  2OPT A;  1MNE A;  2BE5 F;  3B73 A;  2L5Q A;  1HW1 A;  3ZQ7 A;  4KNY A;  2CU7 A;  2QQ9 A;  3PO2 J;  3HOZ J;  2V9P A;  2XB0 X;  3U1D A;  4NQW B;  2DFH A;  5JHF A;  4X1E A;  1T8I A;  4A69 C;  2DTZ A;  2X6Y A;  2ZNY A;  1XSX A;  3EPZ A;  1BR1 A;  2EQR A;  3WHB A;  2IA2 A;  2OJE D;  1IN5 A;  3Q0U A;  3LST A;  5C3E J;  1Z6T A;  2LKS A;  1MKM A;  1HDP A;  2DMN A;  3EUH A;  3CCQ I;  3FXJ A;  4S05 A;  4PK4 A;  1MDM A;  3JSP A;  2JN6 A;  3ZP5 A;  1MBF A;  2A6H F;  3CCS I;  5EG0 A;  3JRD A;  1VQ8 I;  3T8R A;  5E3M A;  4M73 A;  2F5E A;  2EZL A;  2P7V B;  2WB1 A;  1ZTR A;  3T0Y A;  4KC6 A;  4MTD A;  5ICE A;  3J7Y J;  3JCU C;  3CCE I;  1B72 B;  3GTQ A;  3GTM A;  2PMH A;  2R93 J;  4KIS A;  2XPU A;  2KIS A;  2W00 A;  3WHC A;  3LA2 A;  4HDU A;  1W36 C;  4M3F A;  4A3D J;  5K5O A;  1JHH A;  1SFU A;  1OR7 C;  5IYB J;  3Q5F A;  1RR8 C;  1VQL I;  2CV2 A;  2E19 A;  2M7A A;  1VQN I;  1IV6 A;  2L9N A;  4IHV A;  1WCM A;  2XHK A;  2A05 A;  1L3L A;  3S32 A;  4ANJ A;  3N4M A;  2M87 A;  2A6E F;  2W85 A;  1R49 A;  3WE3 A;  2FA5 A;  2FEZ A;  1ETV A;  1U5T B;  2Y0S A;  4CZC A;  4MGR A;  2O8X A;  5E79 C;  3CLO A;  1YHQ I;  3L2W A;  2HYJ A;  2R7W A;  4BH9 A;  1W36 D;  3KP4 A;  1V4R A;  2DA5 A;  3HKZ A;  1LE8 B;  2WC2 A;  3J81 K;  3TW6 A;  4YIF A;  5BS6 A;  5B3S H;  1YIO A;  3OIP A;  4B3A A;  2W7N A;  1LQ1 A;  3GLL A;  2VKD A;  1KU9 A;  2H1K A;  1XDS A;  3HHH A;  3O3K A;  2I10 A;  3PIO F;  4U0W A;  3AL0 C;  3A0B C;  5CJ9 A;  1U9N A;  3H92 A;  4S0H B;  2MGQ A;  4IEJ A;  2EB7 A;  4D5C A;  5HOO A;  2OC6 A;  3DF8 A;  1Z21 A;  4G7Z F;  2EZH A;  2VQL A;  3A1Y A;  4P9U A;  4XQF A;  2HDC A;  4PFP A;  2IGN A;  4NOM A;  4FCY A;  2B9S B;  5LBQ A;  3ZOB A;  3TDU C;  1A31 A;  2Y75 A;  2R7Z A;  3V7C A;  1YX3 A;  3LSP A;  2WBM A;  1QO0 D;  2ZB9 A;  2CQK A;  3WU2 C;  4RBO A;  4P96 A;  2XB5 A;  3ZCO A;  1VI0 A;  5HDK A;  2XAQ A;  1TW2 A;  2NS8 A;  2XPW A;  4A3F J;  1FYM A;  1Y56 A;  3CC2 I;  3OYK A;  2K9L A;  3KP2 A;  4KB4 A;  3OS0 A;  2DYR H;  4XLC A;  3RZD J;  1BC8 C;  3RCO A;  1JI8 A;  2IEK A;  2F4I A;  2GIV A;  3FHN A;  3TMO A;  5F1J A;  4XRS G;  4Y52 J;  1PUF A;  4OOI A;  2YX4 A;  2WWY A;  2LD5 A;  1LJ9 A;  3GTO A;  3L2R A;  4I98 B;  1XS9 A;  1B9N A;  2VBX A;  3GX4 X;  5GAH J;  4XOP A;  3S17 J;  3JR9 A;  5FKL A;  1JE8 A;  1YLF A;  2LY2 A;  2IAI A;  2DMQ A;  2V9K A;  2G7H A;  4GDF A;  3AG2 H;  1XGN A;  3QRF F;  2RC4 A;  2IS2 A;  3SHF A;  4E7Z A;  3E0J B;  1BA5 A;  3SZT A;  1HOM A;  1YOV B;  3KP6 A;  4EJO A;  1LDK B;  2M0M A;  3ZMV A;  2KDZ A;  4GFQ A;  3N97 A;  2W25 A;  3VYR B;  5IOY A;  1ZK8 A;  2VN2 A;  3D5S C;  3S1M J;  1SAU A;  2L02 A;  3J80 K;  1ON1 A;  3MAJ A;  4XLF A;  1B8I B;  1X4P A;  3LQR A;  3KE2 A;  3TW7 A;  4E6K G;  1MSE C;  4YRV A;  1N78 A;  2M0C A;  1OFC X;  3FXO A;  1ZRF A;  1UAA A;  2GOM A;  2JPB A;  3KZY A;  2X51 A;  3LSK A;  5GAD J;  4BXU A;  1DUX C;  3T8T A;  3DPL C;  3DPU A;  2B7E A;  3BR0 A;  4JP0 A;  1TWC A;  4G7H F;  3HRU A;  2K85 A;  1D0Y A;  4ZZL A;  2DJN A;  2EH3 A;  4ZYE A;  1B9M A;  5ICF A;  4IO9 F;  4E4H A;  1VQP I;  2L7F P;  3CJR B;  2O03 A;  1YNJ D;  1G3W A;  2DDA A;  2HZD A;  2Q1Z B;  4II2 A;  2E1M B;  2IGK A;  2XAS A;  5C44 J;  1WRJ A;  3LNQ A;  1WCM J;  4L0Z B;  1FSH A;  1ZG3 A;  3D1N I;  2K40 A;  3ABT A;  3TOB A;  1K83 J;  6PAX A;  2M4G A;  3P9I A;  2XAH A;  1XMX A;  5E3O A;  4G94 A;  3S8P A;  2MA3 A;  3SFI A;  3OV8 A;  2L7Z A;  4I6Z A;  4IRG A;  3HOT A;  1S72 I;  5ILV A;  2EV0 A;  3GLX A;  3SXY A;  3HZJ A;  1EA3 A;  1U78 A;  3DLA A;  3L9F A;  2HFH A;  1TBX A;  1RRJ A;  4M74 A;  5FRN A;  4CHU A;  1NTC A;  1DQU A;  3EET A;  5J3L A;  4FX0 A;  3PNV A;  2HKO A;  2K9N A;  1R4M B;  4HF0 A;  1MZB A;  3BWG A;  3CUQ B;  2Q2E A;  1HW5 A;  2Z9O A;  3P5J A;  2P5V A;  2XF7 A;  4YEJ A;  3F6V A;  4PZJ A;  2DOD A;  4BE2 A;  2BYV E;  5LHH A;  2KL4 A;  3BRO A;  2QEX I;  4ENM A;  1SD7 A;  5L3G A;  1S6L A;  2EWN A;  1CF7 A;  4XLH A;  1F9N A;  3LAP A;  3M8E A;  1GXQ A;  2OCE A;  1BI1 A;  2YPR A;  1E3O C;  3O6B B;  4RAG A;  4BBR J;  4BYY A;  2ZFW A;  1O3Q A;  1P6R A;  5JHU A;  5F0C A;  2HVR A;  1RES A;  3HPH A;  1IGN A;  2NVQ J;  4L18 B;  2GQQ A;  5B1B H;  3ABU A;  5FLX Z;  4A3J J;  2VUM A;  4UV9 A;  2Y2Z A;  2VXZ A;  1BJA A;  4HSR A;  4BBS J;  1FC3 A;  2BZT A;  4MHG A;  2CFX A;  3RPQ A;  2V1X A;  1Z91 A;  4OWR B;  2L4A A;  1SAN A;  3NAR A;  5LFA A;  4F7Z A;  2VIX A;  2Y48 A;  2L7M P;  4EMS A;  3IAY A;  2N8G A;  4E7H A;  4M3G A;  2L0K A;  4UNO A;  2XAF A;  3LMM A;  4D3Z A;  1BN5 A;  1QHG A;  4BQO A;  1G59 A;  1BC7 C;  3G4S I;  1R7J A;  3EYY A;  4XOR A;  1OCZ H;  3ABL H;  3Q0W A;  4BXX J;  4J01 A;  3DV8 A;  2HDD A;  3VOD A;  2Z5U A;  2BXY A;  2IP2 A;  1IO2 A;  2LP0 A;  2DA4 A;  2V1D A;  2DOE A;  3GO5 A;  1AOY A;  2XGX A;  3R60 A;  3VFZ A;  3HRM A;  4KJZ A;  5E17 F;  2EV5 A;  2ELK A;  1TW3 A;  2CUZ A;  1J7K A;  2KIF A;  3TP0 A;  1OKR A;  3CDH A;  5IYC J;  1MMA A;  5D8K B;  2NAZ A;  1YIJ I;  2X1E A;  1SD4 A;  1QHH D;  2UZK A;  4EJT A;  4N4N B;  2DOF A;  2RN7 A;  2MSY A;  2A68 F;  2AQE A;  1K6O A;  1T0F C;  2JTV A;  1BOB A;  3CUO A;  3CQZ J;  3VSK A;  3IL2 A;  3A01 A;  3MD2 A;  1T33 A;  2BY0 A;  3HUG B;  5DTD A;  1GT0 C;  2HYG D;  1I5Z A;  4XR6 A;  5K5Q A;  1F36 A;  3GZ5 A;  1SC7 A;  3FIW A;  4HZF A;  3W2A A;  2ELH A;  4H3T A;  1BIB A;  3RPU A;  2HVQ A;  4UB8 C;  2PX9 A;  2O61 A;  1A6Q A;  2WAF A;  1BI3 A;  5HLT A;  4AID A;  2XAU A;  1R58 A;  1NK3 P;  3CCR I;  1RZ4 A;  1YRN A;  1GVD A;  3WG7 H;  3IC7 A;  2KZV A;  1MND A;  1SMY F;  2BHZ A;  1H88 C;  3GZN B;  2FU4 A;  3CCU I;  4JX5 A;  1UCR A;  5KAF C;  2GIZ A;  4XN0 A;  2GXB A;  5KNL A;  4C3J J;  3RKW A;  1RPW A;  2HTS A;  5B5E C;  2XDV A;  3J7A Y;  3KP3 A;  3WG9 A;  2ZXH A;  4AUX A;  1IRF A;  1XSV A;  1ETW A;  4A0X A;  2QQB A;  4B8X A;  2LKP A;  3H5N A;  5FKK A;  1I3Q J;  5A2Q Z;  4MIM A;  1POG A;  3DFG A;  1JT6 A;  2A5W A;  4HNT A;  1X1D A;  4I09 A;  3K57 A;  3T1B A;  1P9Q C;  1MJA A;  2R5Z A;  4FX4 A;  2QEN A;  4DZP A;  4A3C J;  1SFO J;  3HJE A;  2QUF A;  4LD5 A;  5DM7 F;  1GE9 A;  2ME6 A;  4PUS A;  1PJR A;  1U0J A;  1R5I D;  1YJN I;  1LUJ B;  3MZY A;  2QA4 I;  3QOD A;  2IT0 A;  1ETY A;  1KQ0 A;  3ZMU A;  1XN7 A;  1ZAO A;  2KQR A;  1S9H A;  2XUB A;  5J4Y A;  5GTH C;  4WXH A;  1G8X A;  5LHI A;  2CW8 A;  2EPF A;  3PQJ A;  5J8F A;  5EYR A;  1MDM B;  2GXG A;  4U87 A;  5EG0 B;  4U0Y A;  3FX3 A;  4BHB A;  1BL0 A;  3SQN A;  3OYI A;  2CRG A;  1YI2 I;  4NOK A;  2F6C A;  1I1G A;  2E1C A;  4XOT A;  4L9J A;  5IY5 H;  2NVY J;  1SD5 A;  3QWL A;  1FTZ A;  3IKV A;  2BY3 A;  1WJ5 A;  1SVO A;  3QOP A;  2D1H A;  3HL2 A;  3HGG A;  3DTI A;  2DMT A;  4AIJ A;  3HRT A;  2MG4 A;  1V5G A;  4F91 B;  3G1M A;  3M1C A;  2VAS A;  3SJM A;  3H0G A;  1S5L C;  3GTK A;  1Q1V A;  3C3W A;  4L5I A;  3CCJ I;  2EFN A;  3F8B A;  1F1Z A;  3ELK A;  4P5O A;  5FLV A;  3WTX C;  3ML6 A;  5EJC A;  1JJ6 C;  4MO7 A;  2ZME A;  1WI3 A;  4PJ0 C;  3KZI C;  4E7S A;  2K9M A;  1SVM A;  2DOA A;  4MEX F;  1TZL A;  1Y1V A;  1G4D A;  3L2Q A;  2KKO A;  2R7S A;  1FJL A;  2YU9 A;  1QVU A;  5KK1 A;  2YS9 A;  3GYH X;  1XG1 A;  2R7D A;  2VQC A;  2VOP A;  3JRI A;  1UMQ A;  5FB2 A;  1H9G A;  1E3P A;  2VE9 A;  4ZTJ A;  1DU6 A;  4QIW A;  5D8L B;  2CJJ A;  2K27 A;  1Y1W A;  2GZW A;  2R5Y A;  4DIQ A;  1T2K A;  3CMA I;  1PP7 U;  2E7X A;  3MVP A;  3I5U A;  1XGM A;  4OAZ A;  5F0H A;  5E1X A;  4L9N A;  1KYZ A;  2G9W A;  1W5C C;  3LSH A;  1MBJ A;  2VKV A;  2ZC2 A;  1R22 A;  1OCC H;  2VT2 A;  3BG5 A;  3HSF A;  5JVT A;  4ENK A;  1V3F A;  3DU5 A;  1TWG J;  2O3F A;  3DTK A;  3EUA A;  4KUM A;  3G1L A;  2ZSH B;  1X1P A;  1R4N B;  1YS6 A;  3L7W A;  2A61 A;  1YQA A;  4A6D A;  5IT9 Z;  1MJB A;  1KU3 A;  5J1U A;  1K61 A;  5IOZ A;  2VI6 A;  2XC7 A;  1TWA A;  5LGT A;  4LJZ F;  1P4X A;  3D0S A;  1LPQ A;  2CQX A;  1YX5 A;  2CW0 F;  1RUN A;  4IX7 A;  3K59 A;  2DN0 A;  2PEX A;  1FX7 A;  1MIJ A;  1V5F A;  2K9S A;  5L3F A;  4KA4 A;  1LB2 A;  1GDT A;  2A69 D;  1K4S A;  4XSX F;  5BQT A;  2DA7 A;  2KLO A;  2CQN A;  4HLX A;  2JA7 J;  1Z7U A;  4WXD A;  1W7P A;  2D2W A;  1ZGW A;  1G6N A;  5AIP A;  3GTL J;  1PUF B;  3DBR B;  3CDI A;  2YSR A;  4KIC A;  3X2Q H;  1FP1 D;  2J5P A;  1HA8 A;  1P2F A;  2O7O A;  2LG4 A;  2QQA A;  3V8K A;  1IW7 D;  3WOD F;  2M4K A;  1EV7 A;  3B02 A;  3CJT B;  4M6V A;  1J9I A;  5FKN A;  2MD5 A;  5GAG J;  1I50 A;  1WJA A;  3KET A;  3FMR A;  3OS2 A;  2JZY A;  4JBA A;  4NC7 A;  1W1W E;  1RKT A;  3HB9 A;  3N05 A;  5ERI A;  3ZQC A;  2WAE A;  1XTA A;  1Q1H A;  4XM3 A;  1JKQ C;  4AHC A;  3HOW J;  3I54 A;  1TGO A;  2DBB A;  5E1Z B;  2VC0 A;  2VL8 A;  3HRS A;  4MLO A;  2BVL A;  4UV8 A;  4KMF A;  5HS7 A;  4D1Q A;  3M9A A;  3ZPL A;  2RAE A;  2E1O A;  3FXQ A;  2V1N A;  1X4O A;  4ITV A;  4PJN A;  3DP7 A;  2RRE A;  4JOM A;  3WTZ A;  3OOP A;  4NC8 A;  3MKZ A;  4AIK A;  3K4L A;  4N9H A;  3M07 A;  2H27 A;  2FJ1 A;  3TO9 A;  1X2N A;  2W84 A;  3CZ6 A;  2JRT A;  2KDO A;  1I6H J;  2W24 A;  5EF6 A;  2CS3 A;  3AKZ A;  5D5V B;  3I59 B;  3OYF A;  2DJI A;  1LFU P;  1QZZ A;  3CP8 A;  4U88 A;  5DUI A;  3FM5 A;  4EGZ A;  5KAI C;  3GTK J;  2J5O A;  4M9S A;  1IC8 A;  2F4O B;  1QZY A;  2KMU A;  4D7N A;  3K4J A;  4HA8 A;  4U7B A;  3KEO A;  3CCL I;  5BPI A;  2AO9 A;  3OSG A;  3S14 J;  1REP C;  2PJP A;  1DPR A;  4V2F A;  3M8J A;  2PG4 A;  4P1W A;  3BOQ A;  3BR5 A;  2HYF A;  4A3I J;  1A5J A;  4WWC A;  2W1O A;  1XCV A;  3ZGK A;  3VEP A;  2VC1 A;  4DQ2 A;  2Z1D A;  2JVH A;  4HNV A;  5JI6 A;  2XRL A;  1WJE A;  4S04 A;  3GTP J;  3ZMD A;  4LG3 A;  4CCJ A;  1FNN A;  1LFB A;  1YW9 A;  2ZKZ A;  1OIS A;  4PJJ A;  3K4K A;  1YJW I;  4HG2 A;  2JUC A;  4CXF A;  4EM0 B;  2XSD C;  1FBQ A;  2FNA A;  1A6I A;  1WQF A;  1J0R A;  2PMU A;  2HKX A;  4DGW B;  2LH9 A;  4IHW A;  3G2B A;  2B63 J;  2ESN A;  3K10 A;  1QGP A;  2JA6 A;  1U5T C;  5H20 A;  4G7O F;  2Q2E B;  4BY7 J;  2BXZ A;  2E71 A;  1ETO A;  1R5H A;  1ZGA A;  4ZZD A;  5F64 A;  2JA8 J;  1WVR A;  2LK2 A;  4CIC A;  3K4C A;  4L8I A;  2K3P A;  3V42 A;  4LIU A;  4IQ4 A;  2EIJ H;  3LSG A;  1CF7 B;  3KP7 A;  2X6W A;  4HV6 A;  1LVK A;  4Q5S F;  2OD5 A;  3HEF A;  2E2I A;  4BQQ A;  2DA3 A;  1UHS A;  1IN7 A;  2QQ8 A;  5M3F J;  2P8T A;  1H89 C;  3BJ6 A;  4RGS A;  3BPX A;  3BG6 A;  1HKS A;  2L9S A;  2VQH A;  2ECB A;  1K7A A;  3QQA A;  3C2H A;  1UEL B;  3E3V A;  1WQH A;  2JQ7 A;  2PFB A;  1E0E A;  3LSJ A;  3OMY A;  2HR3 A;  2UXX A;  4L5E A;  3F21 A;  3A03 A;  5CPR B;  2DQL A;  3LSI A;  1OCR H;  2I8D A;  5D5W B;  1QQI A;  3R0J A;  2ZJR F;  4H0E A;  4B44 A;  4EQQ A;  2DA1 A;  3IH2 A;  2M8E A;  1XGO A;  1IDY A;  2VB6 A;  3LQQ A;  2KT0 A;  1ULY A;  2FUG 2;  3GTG J;  3S1Q J;  1ZGJ A;  2HNH A;  2TDX A;  2P5K A;  2M9H A;  4RAZ A;  5CVR A;  4HAM A;  2ZSI B;  2LBF B;  3FXU A;  3ZQI A;  1U2W A;  3BJA A;  1DP3 A;  3QP6 A;  4BDY A;  1BIA A;  3G3Z A;  3S2D J;  3FXR A;  4QWQ A;  2OV7 A;  1O7F A;  1FP2 A;  1BI0 A;  1RI7 A;  1LDD A;  1VQ6 I;  2KRF A;  1ZYR D;  3G1O A;  1J5Y A;  1GXP A;  1X3W B;  2CUF A;  4YFX F;  4ESB A;  2ZJP F;  3ASN H;  3PFI A;  4IF4 A;  4P9F A;  4FIS A;  3R4K A;  1RR7 A;  4CSW A;  3NAU A;  5GP9 A;  1EF4 A;  4TV7 A;  2BHY A;  1JTX A;  2NVT J;  1XGS A;  3VWB A;  1D5V A;  1P7I A;  3VYU B;  3A01 B;  4F3E A;  2D1V A;  1FOY A;  1OYW A;  5JR3 A;  1D8K A;  1LEA A;  2HGC A;  4NBQ A;  4OIQ F;  2E2H A;  4AVP A;  2STW A;  4MFD A;  2JA5 J;  1FPQ A;  1WHU A;  3WU1 B;  3GCM A;  1IV8 A;  4Q4Z F;  5FD5 A;  2HOT A;  5LEK A;  2KIU A;  2STT A;  4B4C A;  3EYI A;  1S3J A;  3L09 A;  1YE9 A;  3U1K A;  1I3A A;  2PJR A;  2FXA A;  1IG7 A;  4OMY A;  3E5U A;  1YRN B;  1P4A A;  2E1M C;  3FF5 A;  3KPH A;  4XL9 A;  4Y13 A;  3ISP A;  3TO7 A;  3NWS A;  2K86 A;  3QU6 A;  5E20 A;  4QPQ A;  2DU9 A;  2P5L C;  5C9H A;  3F9K A;  3VYS B;  5DCM A;  1JKR C;  3CD6 I;  1B59 A;  3FZV A;  2QBY A;  2JVG A;  5D6F A;  4DW6 A;  5LEJ A;  1S7O A;  5FRM A;  3FMS A;  3GBG A;  1ZH5 A;  3EDP A;  1HF0 A;  1OPC A;  1IN8 A;  2WV1 A;  4UVA A;  4HF2 A;  1MGT A;  4NUB A;  3O8G A;  5HS8 A;  3KP5 A;  4XLP F;  3R0A A;  2Z2S B;  4IKF A;  2QKM B;  2DPD A;  2RNJ A;  1KZH A;  1AWC A;  3F8C A;  4BNC A;  2R5Z B;  2H8W A;  1ZRE A;  4WXC A;  3MKW B;  2XAG A;  3IH3 A;  3OYD A;  5DD8 A;  1D8J A;  3ROU A;  4B09 A;  1FSE A;  4ASN A;  1ENH A;  1MW7 A;  3AL0 B;  5C4X J;  3CUQ C;  4RB0 A;  3BZK A;  3F23 A; 
#chains in the Genus database with same CATH homology
 1J09 A;  4II3 A;  4C9Y A;  4ZYA A;  1WJF A;  4BL0 B;  2B63 A;  4N4N B;  2UWM A;  2AQE A;  2R92 A;  3IAS 2;  4G6T B;  1T0F C;  4AYB A;  3UR3 C;  1BOB A;  2VJI A;  3VSK A;  3MD2 A;  3HUG B;  2BOL A;  3S93 A;  1OLT A;  1X1B A;  4LIT A;  3H5A A;  4RMN A;  2UV1 A;  3LSM A;  4XR6 A;  2MC4 A;  1SC7 A;  5HVQ C;  3A2K A;  3OYE A;  3W2A A;  3DWL E;  3VSL A;  4H3T A;  2HVQ A;  3K70 C;  3KEY A;  4FAS D;  4EAT A;  3L2V A;  1X19 A;  2WAF A;  3UNG C;  5HLT A;  2R7T A;  2XAU A;  2VKH A;  3LHP S;  4FGU A;  4X0G A;  4RM3 A;  2K5C A;  2KZV A;  3GTJ A;  1MND A;  4J00 A;  2LRE A;  1R6R A;  2CV0 A;  3CMM A;  3DKY A;  4XN0 A;  3LL7 A;  4YEL A;  5KNL A;  1K6Y A;  2ZXI A;  4XKC A;  4B47 A;  2XF5 A;  4DBR A;  2XDV A;  3J7A Y;  3K70 D;  1K83 A;  3OYM A;  3S3O A;  2NOJ B;  2ZXH A;  4RLQ A;  4E7L A;  2VJJ A;  3SJR A;  4BJ6 C;  3BCB A;  2F5V A;  3FDY A;  3H5N A;  4BEH A;  3S3N A;  3RPU D;  3OYL A;  2P0W A;  3HOS A;  2V26 A;  2A5W A;  4HNT A;  1X1D A;  3K57 A;  3GTG A;  1PYV A;  4IP8 A;  2KPM A;  1P9Q C;  2VPL A;  3HG9 A;  1SFK A;  2E5N A;  4XON A;  4AU7 A;  1GE9 A;  4E7K A;  4XNF A;  3K5N A;  2DT6 A;  2XF6 A;  2BE5 D;  4PUS A;  4KDD A;  1PJR A;  1U0J A;  5CQG A;  4Y33 A;  1X1A A;  3RTR A;  1Z3X A;  2R7U A;  3OR2 C;  3QOD A;  4JQF A;  5TGT A;  1K4T A;  4IQJ A;  3QYE A;  2M3A A;  2KQR A;  1KON A;  4DOZ A;  5HNH A;  1S9H A;  4O26 A;  1MMN A;  1G8X A;  4CCL A;  2CW8 A;  1ISE A;  1V9M A;  1N75 A;  4U87 A;  1EK8 A;  4RM2 A;  3K4B A;  2JSP A;  4BUP A;  4ZJZ A;  3OYI A;  3OR1 C;  3FBN B;  4NOK A;  2HQA A;  1DGR M;  2F6C A;  2A6H D;  3PNY A;  4XOT A;  1V5E A;  1WJ5 A;  4F52 A;  2VLA A;  3HL2 A;  3DTI A;  2BVM A;  1V5G A;  4F91 B;  4HEA 2;  2AQF A;  3QOE A;  1EJ9 A;  3M1C A;  2VAS A;  3H0G A;  3GTK A;  3OL3 A;  4KB2 A;  1WQG A;  4P5O A;  3K58 A;  2LBF A;  2IS4 A;  2JA5 A;  1IS1 A;  4ZC3 A;  2MD0 A;  4E7S A;  2K9M A;  2DOA A;  5JSN B;  1TZL A;  3QYF A;  2MFZ A;  1Y1V A;  4BE0 A;  3SZG A;  3L2Q A;  2R7S A;  2MYS A;  2UUZ A;  3NWT A;  3FBI B;  4Q5V A;  2YU9 A;  4C2T A;  4EJ3 A;  2VQC A;  2R7V A;  2M7B A;  2A6E D;  5JSB B;  4F55 A;  1Y69 8;  1D0X A;  4ZTJ A;  2XSJ C;  4QIW A;  2MAB A;  1QU3 A;  1EH1 A;  3P9A A;  3OYB A;  1Y1W A;  2E60 A;  4XN3 A;  2LC2 A;  4DIQ A;  4BGD A;  3ZXS A;  3AFH A;  2CW7 A;  3DU6 A;  1MNE A;  3DKX A;  1ERD A;  2L5Q A;  3MMY B;  4XLE A;  2R7X A;  4OAZ A;  3H9Q A;  2VQG A;  3LSH A;  4LIV A;  3CP2 A;  2F4Q A;  4NQW B;  3DU5 A;  5JHF A;  1MMD A;  4FXD A;  3DTK A;  3EUA A;  4DBQ A;  1T8I A;  1Y6I A;  2X6Y A;  2BW3 B;  2ZSH B;  3EPZ A;  1BR1 A;  3PFY A;  4B3X A;  4KIT B;  4BQN A;  4PK4 A;  3OL4 A;  4N4O B;  3H9J A;  2X85 A;  3LF9 A;  1N77 A;  3CF2 A;  2XC7 A;  1TWA A;  4IZZ A;  4HRI A;  4JLR C;  1LPQ A;  4C2M A;  2OUM A;  3EUH C;  2WB1 A;  5LD2 C;  3S3M A;  1YX5 A;  4KC6 A;  4IX7 A;  3K59 A;  4PSW A;  3GTQ A;  1A36 A;  3GTM A;  1NG7 A;  1YNN D;  1V5F A;  1WJD A;  4KIS A;  3D5L A;  2A69 D;  1K4S A;  2HDW A;  2WAD A;  2W00 A;  2KLO A;  3PSF A;  3KYL A;  1W36 C;  3CQZ A;  2WY7 Q;  4GRI A;  1MIU A;  1OR7 C;  2CV2 A;  1RR8 C;  2M7A A;  1WCM A;  2L9N A;  4PSX A;  3H35 A;  2A6T A;  4PFO A;  4R79 A;  2PMZ A;  1HA8 A;  3S32 A;  2LG4 A;  3DTE A;  4ANJ A;  1IW7 D;  1R49 A;  2M4K A;  2HU9 A;  3WVO A;  3BLY A;  4CCK A;  2Y0S A;  4CZC A;  2KP6 A;  4XLA A;  1I50 A;  2JUG A;  3L2W A;  2R7W A;  1WJA A;  3SDB A;  1W36 D;  1HQM D;  3OS2 A;  3K5O A;  4ZDL A;  3K5L A;  4NC7 A;  3N05 A;  1SEU A;  2RNG A;  3HKZ A;  4FYD A;  2WAE A;  3DPT A;  4XM3 A;  3QYB A;  4CCM A;  4AHC A;  1TGO A;  2NVX A;  4XKB A;  4C2U A;  2VL8 A;  4MLO A;  2BVL A;  4HST A;  3OIP A;  2W7N A;  2E5Z A;  1AA7 A;  4D1Q A;  2VKD A;  4XKW A;  4CUG A;  2V1N A;  3AL0 C;  1X4O A;  1GLN A;  2DT7 B;  2WAQ A;  4ITV A;  4PJN A;  2RRE A;  4JOM A;  3VDX A;  4QCL A;  4NC8 A;  2L7K A;  3MKZ A;  1I3Q A;  5HOO A;  2LRD A;  2OC6 A;  3K4L A;  1Z21 A;  2BW3 A;  4BJT A;  1DGW Y;  3A1Y A;  2VQL A;  1LFP A;  3CZ6 A;  1ZEL A;  2KDO A;  4FET A;  4XKV A;  4XQF A;  3OYC A;  2CS3 A;  2IGN A;  4PFP A;  3PUB A;  3AKZ A;  4NOM A;  2V4J C;  3OYF A;  3OIQ A;  1SFO A;  2DJI A;  2KRC A;  2W82 A;  2B9S B;  3CP8 A;  4HPQ A;  4BAC A;  1A31 A;  4ZDP A;  4Y3O A;  4H4K C;  2HPM A;  1WFX A;  2R7Z A;  2V6E A;  2R4G A;  2CV1 A;  1YX3 A;  4B48 A;  3M4A A;  2WBM A;  2KMU A;  3IUO A;  2LYC A;  3ZCO A;  1R9T A;  4D9J A;  3K4J A;  1Y56 A;  4AVZ A;  2CMP A;  4U7B A;  5HNF A;  3MAQ A;  3OYK A;  2K9L A;  4F3Q A;  4KB4 A;  2IGO A;  3OS0 A;  4XLC A;  3RCO A;  1JI8 A;  3FKI A;  3K4N A;  2F4I A;  1QHH D;  3FHN A;  3M8J A;  3TMO A;  4P1W A;  4PJL A;  1D1B A;  2IS1 A;  2W1O A;  3ZGK A;  3OYH A;  3GTO A;  3L2R A;  2Z1D A;  3EUK L;  2JVH A;  4BDZ A;  2KHM A;  5CKT A;  2DXI A;  1WJE A;  2NVY A;  4XOP A;  4LG3 A;  4CCJ A;  2LY2 A;  4PJJ A;  3K4K A;  4HG2 A;  2V9K A;  3VYT B;  3OYA A;  1SMY D;  1WQF A;  1TWF A;  2IS2 A;  4DGW B;  2LH9 A;  1T95 A;  3G2B A;  4E7Z A;  2IS6 A;  3E0J B;  4CA0 A;  3K10 A;  2L2O A;  4RLF A;  4BU2 A;  2JA6 A;  1LDK B;  2M0M A;  2Q2E B;  2IGM A;  3W3C A;  4GFQ A;  3OYG A;  4OYD B;  4BEH B;  4IP9 A;  2LY1 A;  2RQQ A;  3VYR B;  1TT0 A;  2X1C A;  1Z3Y A;  3K4C A;  3LFU A;  2WA0 A;  3D5S C;  4L8I A;  1SAU A;  2K3P A;  3V42 A;  4LIU A;  4IQ4 A;  3LSG A;  4XLF A;  1X4P A;  3PNT A;  4PJM A;  2O5R A;  4E6K G;  2CH0 A;  4YRV A;  2X6W A;  1N78 A;  1Q8I A;  3H0D A;  1LVK A;  2GOM A;  1UAA A;  2X51 A;  3LSK A;  4CCO A;  2E2I A;  2R7Q A;  3HXL A;  3ZRG A;  3U21 A;  3DPL C;  3DPU A;  4BQQ A;  3PJR A;  3L2U A;  1TWC A;  2HPI A;  1D0Y A;  3TBI A;  3OOU A;  3K6G A;  3BG6 A;  2VQH A;  2L9S A;  4E4H A;  3CJR B;  1YNJ D;  3C2H A;  1UEL B;  1WQH A;  2HZD A;  2CUJ A;  2Q1Z B;  4II2 A;  2E1M B;  1E0E A;  2IGK A;  1TWG A;  3OMY A;  3CJQ B;  2CFO A;  5CPR B;  5KHD A;  3BG7 A;  3IP4 B;  3ZQQ A;  2PJR B;  3LSI A;  3A4C A;  3RQ4 A;  2I8D A;  3HPG A;  2M4G A;  4OAY A;  4E7I A;  1WJB A;  3S8P A;  4B44 A;  1TL8 A;  3K5M A;  4ZDO A;  3HOT A;  2VB6 A;  2FUG 2;  2HNH A;  3E1S A;  1D1C A;  2W4S A;  4XMY A;  4ZTF A;  3H9G A;  2R7R A;  3C2G A;  1EA3 A;  2ZSI B;  2LBF B;  4AN8 A;  3DLA A;  3I3L A;  4BJ5 C;  4F92 B;  1DP3 A;  4BDY A;  1Z7L A;  2R93 A;  1RRJ A;  5MLC 9;  2O5J D;  5FRN A;  2JA7 A;  3W2W A;  3HC7 A;  1DQU A;  2OV7 A;  3PNV A;  4NNJ A;  3OS1 A;  3GTL A;  3I9V 2;  4Q5G A;  2XF7 A;  4YEJ A;  1ZYR D;  2VJ5 A;  3OYN A;  1DD5 A;  4BE2 A;  3OWT A;  2KL4 A;  3SYT A;  3SEZ A;  3PSI A;  2ZFU A;  3RSN A;  3D5R C;  4BXF A;  2Z16 A;  4CSW A;  3K4M A;  4BE1 A;  3BCA A;  4XLH A;  4E7J A;  4C30 A;  1NG6 A;  3VWB A;  3VYU B;  2X1D A;  4F3E A;  3OY9 A;  3HPH A;  2HVR A;  2A68 D;  3KX2 A;  3OYJ A;  2E2H A;  2VUM A;  1IRX A;  4Y4R A;  2VXZ A;  2R7O A;  3PL8 A;  4HSR A;  3W2V A;  3MKY B;  1NH3 A;  4OWR B;  4B43 A;  3ONQ A;  3TL4 X;  2IXS A;  1FMW A;  1MMG A;  3CES A;  4LMO A;  4D3Y A;  2X6X A;  5LFA A;  5KCM A;  1BR4 A;  4KT6 A;  1YE9 A;  3ZR8 X;  2KRH A;  3FKJ A;  4F93 B;  2VIX A;  2VXD A;  2PJR A;  1I6V D;  4KAW X;  3IAM 2;  4CH7 A;  1A35 A;  2V7F A;  3BC8 A;  5FRO A;  3IAY A;  4E7H A;  2E1M C;  2JA2 A;  2LOO A;  4XL9 A;  2DCE A;  4HNU A;  4BS9 A;  2HVS A;  2CW0 D;  1WJC A;  3LMM A;  3NWS A;  4DJA A;  4D3Z A;  5C9H A;  4QPQ A;  1QHG A;  4BQO A;  3F9K A;  3VYS B;  1G59 A;  4NOL A;  2GOX B;  2JVG A;  1D0Z A;  5FRM A;  4XOR A;  3GBG A;  3H5R A;  4J01 A;  1D1A A;  2ELJ A;  4NUB A;  1X1C A;  2Z2S B;  4IKF A;  2QKM B;  2WY8 Q;  1FMV A;  1VZ0 A;  1R5Z A;  2QKL B;  1TWH A;  4KJZ A;  5CQE A;  2CUZ A;  3SEQ A;  3MKW B;  3OYD A;  3GTP A;  4CCN A;  1LKX A;  4QPO A;  2VJ4 A;  1MMA A;  1UG0 A;  1BR2 A;  3DQV C;  1MW7 A;  3AL0 B;  2X1E A;  3DEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...