2R4GA

The high resolution structure of the rna-binding domain of telomerase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
261
structure length
250
Chain Sequence
KVIQEKLKPDHPQTIIKKTLLKEYQSKNFSCQEERDLFLEFTEKIVQNFHNINFNYLLKKFCKLPENYQSLKSQVKQIVQSENKANQQSCENLFNSLYDTEISYKQITNFLRQIIQNCVPNQLLGKKNFKVFLEKLYEFVQMKRFENQKVLDYICFMDVFDVEWFVDLKNQKFTQKRKYISDKRKILGDLIVFIINKIVIPVLRYNFYITEKHKEGSQIFYYRKPIWKLVSKLTIVKLEEENLEKVEEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase reverse transcriptase
publication title Structure of the RNA-Binding Domain of Telomerase: Implications for RNA Recognition and Binding.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase
total genus 89
structure length 250
sequence length 261
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1970 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2r4gA02
1.10.132.70 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 2r4gA01
5CQGA 2R4GA 4O26A 4LMOA 3KYLA 3DU6A 3DU5A 5C9HA
chains in the Genus database with same CATH superfamily
1OJLA 2AS5F 4EJTA 1HW5A 3P5JA 3SEQA 2EJRA 3KIOA 1RKWA 4AN8A 2Z5UA 4ZDPA 1PUEE 4OAZA 2IPQX 3G1LA 4I99C 3OYCA 4MGRA 1DDNA 2EIMH 3BG7A 3D1NI 2A5WA 4HYEA 3MEXA 3TOBA 1A5JA 1U8RA 3ERED 2JN6A 2ESNA 1KQ0A 3CF2A 2O61A 4ESBA 3FXJA 4RBOA 1UFMA 2QVOA 2NVYA 3HSRA 1WQFA 1ZELA 3JREA 2KRFA 3W2AA 4NQWA 2XKOA 5DCMA 1RR8C 2GOMA 1TGOA 1BN5A 1T08B 3UNGC 1VNDA 4BH9A 2DT7B 4E7JA 4XM3A 2D5VA 2F6CA 4ZZLA 4PJJA 1ZRCA 1T8IA 3DU5A 2W84A 2OD5A 1UCRA 3I4PA 1T38A 1X3ZB 3CCVI 2Y9YA 5CVUA 2PMHA 4I6ZA 1ULYA 1O7FA 3VOEA 3F8NA 2BY2A 2DMQA 2DQRA 2LVSA 2JA2A 2ZCWA 4UB8C 1TT5B 2WBMA 4WK8F 3SJMA 4L18B 3CJQB 4HSRA 3CCUI 1JGGA 4I0AA 5J47A 2MH9A 4BBSJ 2YU3A 2Q1ZB 2VLAA 2XRNA 3RSNA 5EZGA 4E7KA 4BDZA 4UUSA 1UMQA 2F5CA 1XCBA 2JSCA 1D0YA 2R7FA 1XDUA 3O2PE 3PM1A 2XAQA 3EYIA 2EV0A 1ZHFA 1OPCA 4RGXA 2B9SA 2LY1A 4GGGA 1J9IA 3GLLA 2E2IJ 2Y0SA 1XGNA 4DBQA 3JTHA 2NXNB 2JA5J 3DLAA 3CLQA 5LLQA 3EQLF 4WF2A 5EEGA 3ZN1A 3O6BB 3KEYA 3MN2A 1MNDA 3GXOA 3HRUA 4LG0A 3BTJA 2NS0A 2K4JA 4PJMA 4DIQA 3I56I 4NC6A 2ZMEA 2KIMA 3ONQA 3BROA 4Z6YA 4Q48A 2JWTA 1OR7A 5BQTA 4U88A 1N77A 2R7DA 1QPIA 3OOPA 2NNYA 1MNEA 5J8FA 4BQOA 4R8HA 1ENHA 4LD5A 2F5DA 4E70A 4WXHA 3K1PA 1GLNA 5FKNA 2JVHA 3M1CA 3A2KA 3OL4A 4KMFA 4RA2A 1XGSA 4LJZF 1S72I 3ECOA 2NVQJ 1Y39A 2NVXA 2EA2A 3BG6A 4M6XA 2K40A 3K59A 1U78A 1LFUP 1IW7D 3VWBA 3ZMZA 1J75A 2CQQA 4KYWA 2EZLA 4DZPA 3RZDJ 4OWRB 5B5EC 2ISYA 3G1MA 1VQ7I 1R36A 3RYPA 2DO7A 2IGKA 2RV8A 3ZMTA 1B8IB 4I76A 3U1KA 2DMTA 3K6GA 1ZR2A 4FT8A 4BDYA 2R7XA 5E17F 4LOCA 2UUZA 4PGGA 1H9TA 3IC7A 3ZOBA 4ZYGA 3OOUA 3BTIA 5HLHA 4MLOA 1BR1A 2YU9J 3V8JA 3L7WA 3DTEA 1IRZA 4AIKA 5JI6A 2STTA 4CDGA 2EIJH 3AFHA 3DEWA 1F36A 5EGOA 2HQRA 3CD6I 3IV5A 3K10A 2V9VA 1XGOA 2X1DA 2DMUA 4QPQA 2COMA 4RGSA 3RZOJ 2OTLI 1MJAA 1RETA 3HOTA 5HS8A 2VI6A 3EUAA 4XRSG 4UV9A 2NS8A 2QQ8A 1ZG3A 2VB6A 2YSRA 2QSFX 3SJRA 1B9MA 3K0LA 2EFNA 3V8KA 2R7UA 5LRRA 5CVJA 3GUDA 4LLLA 1QPMA 4E7IA 4E7LA 2QCOA 3Q5FA 1LQ1A 1VQNI 4MFEA 2XGXA 1LUJB 2FEZA 2E7WA 5KCMA 5F6FA 1FSEA 2YR2A 1WJFA 3MWMA 3KETA 1LE8A 4L5EA 3K5LA 5F04A 2E1MB 3E97A 5BS6A 1OCCH 5IPAA 2E1MC 4FGUA 2KIUA 1BOAA 3BCAA 1FT9A 2LBFA 2STWA 1TC3C 2P7VB 2HVSA 1MMSA 2M87A 2BBYA 5E18F 1YE9A 1V54H 1U6GA 3M4AA 1YJ9I 1WVRA 2L7KA 2W48A 3KZZA 3TQNA 4MTDA 4ENMA 2XPUA 3ISPA 1P6RA 2KJCA 3E6BA 2ZFUA 1BM9A 2K85A 3DPLC 4UVBA 3TP0A 2DW4A 3VSKA 1TWHJ 1G3SA 2Y0MA 1HLVA 4F3EA 2K86A 2VE8A 3W2VA 4F3QA 2VJIA 3JW4A 3V7SA 4MIMA 4IP8A 2FJ1A 1UG0A 2I5UA 1R1VA 4M72A 2GA2A 3QYFA 4ON0A 4Y7NJ 4CGZA 3KP7A 1JXSA 4CZZA 4KT6A 2I8DA 4XNFA 4A3LJ 4EJUA 1OQYA 3KYCB 4S0HB 1HCRA 3H3VK 4RB1A 3S2WA 5GPCA 3UKGA 2OPTA 2EA4A 3M9AA 5ICEA 3RPQA 1HQMD 2BEOA 3QP6A 4I7HA 3Q9SA 1QHHD 3G6EI 3GX4X 1HKSA 4XQFA 2V26A 2OV7A 3H92A 3KZIC 1WCMA 5HDKA 2V1XA 5FROA 5IY5H 1XMKA 2EZIA 1HSTA 1YTYA 1D0XA 4JLRC 1LFBA 1YI2I 1AA7A 1R22A 3DF8A 1IW7F 2EK5A 2FRHA 2JA7A 5M5XJ 1G2HA 4FE7A 2OQRA 5HS7A 3H36A 3MFKA 2OCCH 1TT0A 1MSEC 2K9NA 4QIWN 3FKIA 4P96A 1F43A 2R4GA 4L5IA 3SYTA 5DEQA 2KT0A 2OF7A 1DU0A 2CW7A 3PUFA 3WTXC 2Y30A 1TNSA 3K4MA 4XORA 4LLNA 3FF5A 3KX2A 3BJOA 2CU7A 2JUGA 2A07F 3OWTA 2LC2A 3MZHA 2FOKA 1MBJA 1F4KA 2ZXIA 1BR4A 2HVQA 2KP6A 1OMIA 4IRIA 1X1BA 5DYMA 2MA3A 1APLC 1PVEA 4EVIA 1G3YA 2R7SA 3O8HA 3S32A 2VT3A 3I4MJ 4ZYEA 3DP7A 1XPXA 1SFKA 4D3YA 1SD7A 1H88C 1IN4A 3OL3A 2M1BA 2E1CA 1FBQA 3PQKA 3V4GA 4Y52J 3R60A 4CCKA 5ILUA 4QPOA 4U7DA 1Y1WJ 2X85A 1E0EA 4EJ3A 1O4XA 3HEFA 4RM2A 2YS9A 3K4CA 1T2KA 3E3VA 4G7OF 4EGZA 4NQWB 5DCMB 3HG9A 2O0YA 4NC7A 3F8FA 1VQ9I 4Q5VA 4PFPA 2W1OA 4PGHA 2PMZA 3WU1B 3WGHA 3IL2A 5E1ZB 1O57A 4HDUA 3OV8A 4DJAA 2NVYJ 2HQNA 1SVMA 2LOOA 4M9ZA 5IP7J 2XF7A 2W57A 2N8GA 4M3EA 1S8NA 3N97A 3ECHA 1MBFA 3F8MA 2V6CA 4H3TA 5FLVA 1P7JA 3BCBA 2R92A 1KONA 3ASNH 3TGNA 5CLSA 2MBFA 4LFUA 5DD8A 4F93B 3K9TA 1IV8A 3K70D 4A3IJ 2GXAA 1TWGA 1I39A 4XBFA 2LTPA 2Z99A 4A6EA 3R6SA 4PJNA 3LSTA 2VOPA 2VKHA 4C30A 2IEKA 4RMNA 3HRSA 1Q1HA 3SZGA 1WQGA 2L54A 1H89C 1E2XA 2B0LA 4UUSB 2BXZA 1HKQA 4PJLA 4M6VA 4CSWA 3LAJA 4LIVA 4S04A 4BHCA 5KVRA 2B9SB 4X1EA 4J00A 2MSYA 1SVLA 3O3KA 4KDPA 4HQMA 3C2GA 1JHFA 2L9SA 4JK1X 1SC7A 3BR1A 1SFUA 1HKTA 1P4AA 2IW5A 2EV5A 3PJRA 5FO5A 1FX7A 3DFGA 3BZ6A 4BXUA 3FWEA 4HW0A 4XKCA 2V9KA 5EG0A 1V9MA 2M45A 4EM0B 1ONVA 4V2GA 3KCCA 4LG0B 4JYKA 5DTDA 1HXDA 4FETA 5HOOA 3OYKA 2HOTA 4E6KG 5H2FC 4P9FA 2DTRA 3FXMA 2AXLA 3KP2A 1W7PD 1XB4A 3MKLA 3LSKA 2LY9A 1R71A 2PJPA 5C44J 3PO3J 2DA6A 2HZDA 1V55H 4BACA 3I71A 1XX5A 3OYDA 4A3MJ 3H0GJ 3HZJA 2ZJPF 2DU9A 2G0EA 1QZYA 4HF1A 2FBKA 1R5GA 1W7PA 3F22A 1WQ2A 4ANJA 4FASD 2FQ4A 2K02A 4D0PA 3FXLA 2CRGA 4YG2F 2MD5A 4YIRX 2WA0A 1KZHA 3S1NJ 3I58A 4B3AA 1O3SA 1ZQ3P 1XD7A 3CCLI 1DU6A 1OKRA 2K3FA 2O8XA 4F92B 2KRHA 1ZTRA 3PIOF 2DA4A 4UUTA 2P5LC 2P6SA 1BI1A 2Y9ZA 3HOZJ 4X6AJ 1G8XA 2L02A 3KPHA 3S16J 1MW7A 1B8IA 2DODA 2G7HA 4KNYA 3IUOA 2XAHA 2R7WA 4ZTJA 3N05A 1QU3A 1BI3A 4R1HA 3H0DA 1ZG5A 2VQCA 5D8LB 3A02A 3KP4A 5TISC 3J7AO 5GP9A 1K4TA 3BDDA 2M0CA 4BYYA 4AIDA 2L9RA 2TCTA 3VYTB 1X1AA 3OYBA 2FF4A 3JCUC 3GWZA 4L5JA 1R6RA 3BZKA 3D5SC 4NNJA 1FIAA 4WX9A 3C18A 2MLGA 3LQRA 4RB3C 2F4MB 1WJCA 2E7XA 3QPTA 2ZSHB 1I6VD 3S1RJ 3CC4I 4L9TA 3GTJJ 3ZRGA 3VEPA 3VSLA 3S93A 1LEAA 3LSHA 2CW8A 3S3MA 2DJNA 1VQLI 2HOSA 3WTZA 1UHMA 4CCLA 2B63A 2XV4S 1ON2A 2VPRA 3TMOA 2WB1N 3BC8A 5JVGF 5LGNA 2HQAA 1I27A 4M6YA 3TEDA 3LSMA 3FXOA 3HDDA 1GDTA 4BU2A 4OIPF 2D1VA 1MBKA 2OU2A 4BKXA 2ZJQF 4MQ9F 2PBIA 1FC3A 1BIBA 5L3DA 1FMVA 4IQ4A 1LE8B 3D5RC 2JJ7A 3HC7A 4ESJA 3QPSA 2CUZA 2IRFG 5M3MJ 4KT5C 3BJ6A 2F5EA 2ME0A 5K5OA 1EK8A 1V4RA 2LBFB 2ELJA 2E19A 2X9DA 4KB2A 3DKWA 3CCMI 3EETA 2OJED 1WJ5A 2G9WA 2Q2EA 3OIQA 1G59A 3A4CA 1WJDA 1TWAA 4RLFA 2L5QA 1FJLA 3F72A 4M3FA 2CJJA 3DQVC 2PJRB 2A6ED 2WAFA 3G2BA 4XOPA 2E34A 1I6XA 3K5OA 1WI3A 2NRAC 3T8RA 3ZQCA 3HRMA 1LNWA 1H9GA 4CZCA 4MNUA 1JJ8C 1HC8A 1R1UA 4BQQA 3F9KA 2VIXA 2BY0A 4FHTA 4GRIA 4M9XA 2L9VA 3OS0A 1K61A 1ZRFA 5A2QZ 2K9QA 5BMZA 1R9TJ 4F55A 1W0TA 1MGTA 4N4NB 4IZZA 2KL4A 1LVAA 2R7RA 1OCRH 1GE9A 1FYLA 4OIOF 5DUKA 2CW0D 1ETOA 3GLXA 1BIAA 1P4XA 2LR8A 4DYQA 2WADA 1EH8A 3LA3A 3BT9A 4B48A 1POGA 4Y4RA 1UZCA 3GBGA 1XC5A 1XSVA 2RAEA 1QZEA 1B59A 1G3TA 3TKYA 1GHCA 3GTGA 2MH2A 5L3BA 4N4OB 3BQYA 2E2HJ 4DZJA 4CUGA 5K1YA 3TDUC 1PDNC 3S15J 1MDMB 2LNBA 2IXSA 2QZ8A 1WCMJ 1WJAA 4KA4A 3WE3A 5KAIC 5HVQC 2XRLA 5D5UB 2NAZA 2DOAA 4KISA 1YO5C 1J2XA 1OYWA 1MMDA 5EJCA 1Q8IA 4PSWA 3GTPA 2ZKZA 4AYBA 2DOFA 3BJAA 3IAM2 1I50A 1R49A 3KYLA 1O3TA 3HM5A 4E7HA 3PQJA 1O3RA 4B44A 3H5RA 2DAOA 4KC6A 4B47A 2A6HD 1QGPA 4EJOA 3K5NA 4HBLA 3QQAA 5CYVA 2E5NA 4AM3A 1SFOA 2FXAA 2COBA 1JKPC 1GXQA 1D0ZA 4L8IA 1NTCA 3DKXA 2NYXA 4ZTFA 1E3HA 2D2WA 2O5JD 3GF2A 3JSPA 2XROA 2A5YB 4ESFA 1EV7A 1YFHA 2K9LA 1MJBA 2K5CA 1YRNA 4CH7A 1ITYA 2FUG2 3IAYA 3MD2A 2ACJA 4AD9A 5A2QK 3DTKA 1JT6A 2HTJA 3HGYA 9ANTA 3K5MA 4M3BA 3G4SI 4RB2C 4NOMA 2YPRA 3QYBA 4ZYHA 1A04A 2ZBKA 3GTKA 3S8PA 2FMYA 4RS8A 4UNOA 4AUXA 4IRHA 4IF4A 1LVKA 3SXYA 2M4KA 1G3WA 5GAEJ 3HIFA 4KJZA 1WH7A 2HXOA 4G9YA 3F21A 1GUUA 4A3EJ 4EATA 4KFCA 4J19A 1VQPI 4IL6C 3RI4A 3N4MA 3BP8A 3JRAA 3KYDB 3K4KA 1OYIA 5AIQA 4A3GJ 3RKWA 1P2FA 1RR7A 3BR6A 4XK4A 4BNCA 2DK5A 3P9CA 2UV1A 1WFXA 5BPDA 4KAWX 1K7AA 2O8KA 2EFWA 1B9NA 4YIFA 4LK1F 3K70C 1R5ID 2HR3A 1UB9A 2QEXI 4FQGA 4FX4A 2A6EF 2XF5A 2X6XA 1BI2A 1Z3XA 2DFIA 3CMYA 4QCLA 1QQIA 1IUFA 2GWRA 1W4MA 3TBIA 1QHGA 4BE2A 3K7AJ 2JPCA 4KITB 1KU2A 1RKTA 4HX4A 1TNTA 3U1DA 3M8FA 4U7BA 3BQZA 5FD6A 3WGIA 2EFPA 2Q0OA 3GEZA 5J4VA 5GAHJ 5EG0B 5JHFA 4GFBA 3QPHA 2TRTA 4EV0A 2MG4A 4XSXF 1B4AA 1BR2A 1TQMA 4E7SA 3PNVA 2IA2A 3G71I 3ASOH 2CW0F 2WWYA 4XICA 1W0UA 3EUHA 2ZJRF 5F1RA 3WGGA 2V7FA 2JT1A 4MTEA 5FKMA 3LSJA 2XB0X 2QKMB 1FP1D 3JRGA 4EM1A 2OUMA 1W7PB 1EF4A 2KZGA 2XDVA 1PUFA 2P7CB 4CCJA 2JA6J 4XRFA 3E7LA 4LB6B 1IRGA 1FP2A 2MW8A 3BR0A 1YIOA 1DGWY 4XR6A 4ZC3A 1VQOI 1P7IA 2CQ7A 2F5VA 1ERDA 5KHDA 4UUVA 2DDAA 1G4DA 1ZH5A 2KDOA 2VASA 3M8EA 3U21A 3WU0A 4D3ZA 1T56A 1YW9A 3CCQI 2WAQA 5JSNB 1Z0XA 5ICCA 4HV6A 3WU2C 1Y1VJ 4E7ZA 3CCSI 1W36D 4MHGA 1WGXA 2KRCA 4IOCF 2HKXA 3HOWJ 4PSXA 1ETVA 1KYWA 2GQQA 5LEJA 4KICA 1X4PA 1JKQC 1MMNA 2A6HF 2ZXWH 2LLKA 3HTUA 1HBXG 1QRYA 1EKEA 1ETXA 5HLGA 2V9PA 3S1QJ 2H94A 2FA5A 1D8JA 1Y0UA 4OIQF 4M73A 1FYKA 2OZUA 1R5HA 4XKBA 2CV0A 4A0ZA 1K78A 3CUQB 4F7ZA 1V5FA 2KIFA 3CUQC 2LK2A 1Y8QB 3IP4B 1S29A 2FNPA 4A3CJ 3GZNB 1I1SA 1FWZA 5FKKA 5IP6A 1TWCJ 2LMDA 1LDJA 3I9V2 3PNTA 2ISZA 4GDFA 4A12A 5DS9A 5CJ9A 5LGTA 4CO8A 2XHKA 4FISA 1TW3A 3R61A 2M4GA 1N25A 1TW2A 3TL4X 3OR2C 1YLFA 2QLZA 2R7ZA 3DBLB 3K4LA 5D4SA 1OCZH 5K7FA 2B63J 1Y8RB 4AU7A 2CH0A 2DQLA 3DEEA 3CMAI 3PSIA 2KMUA 2P5KA 4HEA2 2WC2A 3K69A 1LFPA 3OYJA 3TO6A 1FY7A 3A0HC 4B1RA 1RUNA 3ZQLA 2ECBA 5DM6F 1LKXA 2AQEA 3ZQQA 3F8BA 1TP4A 3RPUD 4XIDA 3J7ZI 4AIJA 2FSWA 4D7NA 3LA7A 3WTSC 2Q2EB 1S7OA 3MMYB 3M07A 4KB4A 5K5RA 2CGPA 3KLOA 1VI0A 3FK7A 3E5UA 2PJRA 2KHMA 1ISEA 2GIVA 3LMMA 2IT0A 2EWNA 2RQQA 5E1XA 1SAXA 5F0FA 3VPRA 1JT0A 3S14J 1U9OA 2ZC2A 2ZXHA 2YUSA 2ME6A 2X0LA 2BY1A 3QWLA 1XSDA 2VBYA 3FIWA 5L3CA 4ZH4F 4JBAA 2LFBA 3H5NA 5E3LA 4UVCA 1I5ZA 1Z7UA 4AC0A 2EIKH 3B6CA 3HYIA 3CMEI 3I0TA 2P81A 2X6WA 1I6HJ 2X6YA 3HXLA 3KP5A 4BXFA 2X4HA 5M3FJ 3KP6A 1BL0A 3PSFA 2M30A 2BGCA 3H9GA 2O3FA 3V7RA 1FMWA 1TBXA 3D0SA 2OAZA 2XPWA 1HA8A 3GVAA 4IO9F 2XKPA 2RKHA 3QYEA 1HOMA 1D5YA 5FJ8J 2PMZN 1M1EB 4NDLA 4ENNA 1IG7A 4HQEA 2ID3A 1IGNA 2VONA 1R58A 3EYYA 3WVOA 1N75A 3P9IA 2BY3A 1AU7A 2JK3A 1ZYRD 1RESA 5BPIA 2W4SA 1MDMA 3AAFA 1K79A 4ABZA 1FNNA 2CYYA 1XMAA 1IF1A 3GTMA 5GAGJ 1OISA 3JR9A 1J0RA 3HOSA 1UG2A 2QQ9A 2QGUA 4G6QA 4IP9A 4KDDA 5FLXK 2Q8KA 1QBJA 2FE3A 1U8BA 1K6OA 1YNJD 2XB5A 4MEYF 3ZMDA 3ZMVA 1DP3A 2IJLA 2CV2A 1SMTA 5CVRA 4KIBA 2V1UA 1IN5A 2A61A 4YFNF 2R0QC 2HNHA 4IXAA 5M5WJ 4I01A 2VKDA 5EEHA 3LSGA 3GTLA 4EM2A 2R93A 1HQCA 1XCVA 3GTPJ 2M9HA 3CCEI 2VUMA 1U9NA 4M3DA 3GZ6A 1OLTA 1I50J 3G1OA 3A01B 2R5YA 1VF9A 3CTAA 1I3QA 3J81Z 2ZNZA 4B3XA 3E6MA 3B02A 3P7NA 1OCTC 1GVDA 1LDKB 4KIFA 2L0KA 2VOOA 5IOZA 1YRNB 3E1SA 3ZQ7A 2CV1A 2K3PA 4RB0A 2DT5A 3ZQIA 4WXCA 3P9AA 4L9JA 2GBYA 3AG1H 3C1DA 5HDNA 4N0BA 4XLPF 1F1ZA 4XKWA 3J80K 1K83A 1FLIA 3RKYA 2FU4A 2M7BA 1T95A 3MQ0A 2Z33A 3LFUA 1G6NA 4OOIA 2R7TA 1XGMA 4Q5SF 2UXNA 5E20A 3QOEA 2DI3A 1P92A 1FEXA 2NNNA 2WTEA 3MKWB 3HHHA 2O9LA 2XGCA 3GTKJ 2A69D 3CF5F 4AWXB 2M7AA 2CSOA 3CJRB 4WXDA 3SQNA 1ODDA 4Y17A 4UVAA 2QYOA 2WY7Q 2Z16A 3HKZN 5F0CA 2AO9A 2HDDA 1PYVA 4JP0A 5E8IA 2HWVA 2J5PA 3A1YA 3M3YJ 3GFJA 2QQBA 3IH4A 3BPXA 4AVPA 3W2WA 1D5VA 3GO5A 2VBWA 3QAHA 1K4SA 5TJJA 3FM3A 4M74A 1USSA 4WWCA 3LHPS 3OR1C 3I5UA 2E1OA 4M71A 3GTOA 1ACIA 2XGEA 4XRSA 2MLKA 3KLNA 1YNND 4HA8A 3KP3A 2JMWA 3BG9A 4C2MA 1BJAA 2D45A 1NG6A 4BXXJ 4F91B 3ZN0A 5IOYA 5L3FA 2ELHA 5F64A 2M2EA 3L00A 2XSDC 3J81K 2E2IA 2ELKA 5C3EJ 3CQZA 1MMAA 3OYEA 1VQ5I 3F0CA 4BHBA 3WHCA 4J01A 4BL0B 3C7JA 1QNTA 2DMPA 4IQJA 3C3WA 3L09A 2XF6A 4N9HA 3AL0B 1HDDC 3RIRA 4BGDA 1F9NA 2H8WA 3AL0C 3E6CC 3EUHC 2CUEA 2JPBA 3P9KA 4IHXA 1NG7A 3GFMA 4QSHA 4HG2A 1WZ2A 1IC8A 3H1CA 5FLMJ 2VKVA 3BTLA 5DV5A 4JX4A 3BR5A 3W6JB 4O5VA 2IS4A 1MNMC 3KE2A 1ZYRF 1KU9A 1BW5A 2JA8J 1PUFB 1X3WB 5HNFA 2F2EA 4A6DA 2YX7A 2HTSA 2FNAA 3SDBA 1TQPA 2KIQA 2VJ5A 2ESHA 5K7HA 3I55I 2PN6A 2W24A 3NARA 2NVXJ 1X1DA 2HEOA 2GXBA 1IUYA 2MGQA 5J6XA 5DUIA 4I2OA 1HW2A 4ZJZA 3DPUA 3BG3A 3DPTA 2E36A 2NVTJ 3DXJF 5F27A 3GYHX 1FPQA 2Y31A 3CUOA 4O6JA 1KYZA 3AG4H 2HFHA 3AG2H 2KDZA 1I3AA 3LF9A 3MVPA 2L2OA 2HI3A 4A3FJ 3TW7A 3OYMA 2XAUA 2DYSH 1W36C 3L2QA 4DYCA 1JGSA 1LJ9A 3ABKH 5KAFC 1VQMI 2G7UA 1AKHB 1XN7A 3ZQFA 3CUQA 3ZR8X 1AHDP 1K78B 4D9JA 4D1QA 3FX3A 3WTTC 3ZQGA 4LMOA 1T33A 3RQIA 2ECCA 1REPC 2W7NA 3CC7I 4QWQA 2W00A 3JTGA 4BE0A 3CESA 4BEHB 5GTIC 1SD6A 3I59B 2O7OA 1YG2A 4CYCB 1EH7A 3ABUA 4HNUA 1TQIA 2K7LA 4HRIA 2HDWA 3FM5A 3ZPLA 4Y3OA 1MBEA 4C3HJ 1QA6A 3K1NA 5JSBB 3K4BA 3RKQA 2H8RA 4ZZDA 3S3NA 4RAFA 2XIGA 1Z21A 4XONA 1P9QC 3NWTA 1V3FA 2VQLA 1MKMA 4CCNA 2MD0A 2PFBA 2WV1A 2A69F 3BZCA 1JUSA 4GO1A 5JVTA 2VQHA 3IHUA 3G3ZA 1D1AA 2M34A 2P0WA 3BR2A 4G12A 4QLCU 1O3QA 1B72A 3IWZA 3IWFA 3MAJA 3EUKL 1SANA 1NH3A 4BHPA 1RIOH 2H09A 2WV0A 4YFKF 4RM3A 3FKJA 5LHGA 3ROUA 5EF6A 4E4HA 4BY1J 2HQ5A 3ABTA 1IO2A 3CDLA 3ZCOA 4RDUA 3ABLH 4L9VA 2X1CA 4XLFA 3S2DJ 1XMXA 3I3LA 3HTSB 4MQVA 3T5XA 2ZNYA 2IA1A 3M4OJ 3VDXA 1F5TA 1D8KA 5E3OA 3J7AY 5FFZA 3MZYA 2TDXA 3Q0WA 5LD2C 1MH4A 1NHAA 2CFXA 3F3XA 5IT9K 1MD0A 1SAUA 2HDCA 2I10A 4AHCA 1ETQA 4B8XA 3HOVJ 1TWHA 4BBRJ 2X51A 4A0YA 3LA2A 4RGRA 1SMYD 2OZ6A 3OMYA 3LSIA 1JI8A 2ADUA 3SDGA 5E3NA 3LSPA 1R7JA 2VC0A 4CICA 2QA4I 4LGWA 3M8JA 3DCFA 3V8LA 1ZG1A 3S2HJ 1ZKGA 1ZK8A 3E5XA 4XSZF 1IAWA 2BV6A 3ZMUA 2V1NA 4PUSA 1A35A 3S17J 2PMUA 1UJ8A 2JRTA 2FQ3A 1Z9CA 1LDDA 1PP7U 1MMGA 5TGTA 1HDPA 3LWFA 2AHQA 4A3DJ 4V2FA 4XLEA 1IN6A 2DFHA 4UB6C 5JLWA 1CQTA 2LP0A 1OCOH 4HV5A 4C3JJ 4HSTA 5HLTA 4HNVA 4HLXA 3T8TA 2OCEA 2MABA 2EFOA 2VL8A 3BY6A 3TW6A 2C6YA 2UZKA 5M5YJ 2Y2ZA 2DPUA 1EJ9A 2F4OB 5LGUA 2JA7J 1IS1A 2KZVA 2B7EA 2JSPA 2M8EA 4I02A 4YRVA 2R7OA 5ILVA 4U0WA 3V7CA 5B1BH 3WODF 1WWXA 5D6EA 2Z3YA 5J8CA 3BG5A 2ZB9A 3FKIJ 1IRXA 5C4JJ 1GV2A 2R5ZB 4JX6A 4XL9A 3JRIA 2VN2A 4F52A 4RAYA 3T1BA 1FTTA 4L0ZB 5D5VB 4IVNA 2Y0SN 2AXTC 4HX7A 4DOZA 3A01A 4UHTA 3HOYJ 1YYVA 2R5YB 1FOWA 3TP3A 1H8AC 3GTLJ 1A6IA 1J09A 2KISA 2R93J 1W5SA 3OSFA 2EILH 1XG1A 2ZFWA 5HLIA 4HAMA 4JQFA 3OIPA 3ZQHA 4O26A 2JVGA 3FK6A 3ELKA 4G7HF 2MYSA 2XPVA 2L7ZA 5L3EA 2JTVA 4XKVA 4Y33A 5LBQA 2CWEA 2Z2SB 3QOPA 4P1WA 3KFWX 2BVMA 4FCYA 4OINF 1ETYA 1JTYA 1IZ1A 2FX0A 3FMQA 4C2UA 3T0YA 3BPVA 2E2JJ 2HPIA 1X1CA 1SD4A 2IP2A 4G8XA 4HZFA 1Y1WA 1ZAOA 4OYDB 2P8TA 1JUPA 1DUXC 2Z1DA 4MEXF 1EA3A 1IXSB 4FX0A 3GCMA 1IN8A 4IHSA 1D1CA 1XS9A 1K83J 2CUJA 3KEQA 3H9JA 3JRDA 3NRVA 1J5YA 2VC1A 3E6DA 2NOJB 3TO9A 3K58A 2KPMA 2HZTA 5JR3A 2E60A 1ETWA 3GW2A 3H35A 2BZTA 5LRSA 5FGMA 1YS7A 3WE2A 3W6VA 2DA1A 1YOVB 1QO0D 2FD5A 2GAUA 2WAQN 2XAFA 4I09A 2PQ8A 3TOAA 2Y48A 2WAEA 4NUBA 5IYDJ 1ZN2A 2CFOA 5H20A 2R92J 3FXUA 3L2UA 4FYDA 1TWGJ 1CGPA 2O03A 2HS5A 1JUMA 1FYMA 1YJNI 3OIOA 2EV6A 5CPRB 5KNLA 3K2ZA 2DFEA 3QU3A 4YEJA 3X2QH 2M0MA 4ZDOA 3Q3SA 3JRFA 2VBZA 4BE1A 5LHHA 2R7VA 4GXOA 1K6YA 1KGSA 1D3YA 2XAGA 2PLYA 3GTOJ 4V19K 3OS2A 4ZYDA 2H27A 2BOLA 4NC8A 1SMYF 4ASNA 3VYSB 1Z6TA 2DDBA 2QQAA 4RLQA 4NHJA 4A93J 2K27A 4C2MJ 1CF7B 3WTWC 2L4MA 3PFIA 2A05A 2BW3A 3I53A 4G94A 2RDPA 4OMZA 1YHQI 3CQZJ 3L1PA 1U3EM 4Q5GA 3WG9A 1ZREA 3WG7H 1VQKI 1BC8C 2X48A 2NOGA 4IHTA 3H3UA 2CQXA 3E5QA 4ENJA 1N78A 1V5GA 4U0VA 4IX7A 1KQ8A 2GM4A 2IGOA 2QUFA 1Y698 2LY2A 4C2TA 3H0GA 4AVZA 1YX3A 2Y75A 1RRJA 2NS7A 3ABMH 1S7EA 3HB9A 2EPFA 2EB7A 2L01A 3HRTA 3KEOA 2IS1A 2HOAA 2X6OA 4G6DA 3VFZA 2R7QA 1DPRA 1W5CC 2DMNA 2QWWA 1GXPA 1S9HA 3W3CA 2LDUA 3REOA 3A0BC 1PP8F 4HF2A 2HVRA 4BAYA 2JRMA 3E0JB 3B6AA 1YJWI 5B66C 1T0FC 4DNCA 4KIGA 3FISA 5K7ZA 4BY7J 4CCOA 1Z05A 2DBBA 4DGWB 4JX5A 3K57A 3QU6A 2W85A 3L2VA 5E8GA 3CJTB 5FKOA 3DEUA 4M3GA 2VQGA 1JJ6C 2QKLB 1X3UA 2VT2A 1ZGAA 5IT3A 3FZVA 3NWSA 1AKHA 3BOQA 3GZ5A 4CCMA 2DK8A 3IH2A 4UXNA 1R23A 1ZLKA 1WRJA 2PG4A 2ZXJA 4G6TB 2VXDA 4PFOA 2F5FA 2V4JC 4PDKA 4P55A 1NK2P 3AG3H 4BEHA 5D4RA 2RNJA 2V6EA 3I59A 4CYCA 3OSGA 2BYVE 4Q47A 1RPWA 2P4WA 1H0MA 2O5RA 1LB2A 2UXXA 1R00A 4BJ6C 3SZTA 3FMRA 4GYIA 3GTJA 3CCRI 2JUCA 3OYFA 5AIPA 2RREA 1Y6IA 3J7YJ 3LOCA 3MZ8A 3EPZA 3HGGA 3TO7A 2QENA 2CO5A 4LG3A 1FOKA 2LRDA 5GPAA 2PX9A 3DV8A 2XUBA 4Z2YA 2M5WA 2CS3A 4EGYA 4P9UA 1TWFA 2DJIA 3VODA 1X1PA 2BE5D 5J1YA 4D5FA 1UHSA 2VKEA 3CCYA 1FIPA 4EQQA 5F0HA 1B72B 3IH3A 5FLXZ 4LLGF 3JRBA 1S6LA 4L9NA 2GXGA 5DM7F 5C4XJ 1SD5A 5LEKA 1J59A 3M1EA 3FDYA 3QPLA 4LIUA 4Y13A 5ED4A 2VE9A 3MAQA 1BJZA 3RKXA 3ERMA 3K4JA 1ZARA 4A69C 3DBHB 1FBUA 4XOTA 3RPUA 4EMSA 2EZHA 1V5EA 1R5ZA 1FOYA 2KFDA 3GTQA 1E3PA 1TWAJ 4A2UA 4AIHA 3L2RA 1U5TB 1EH6A 2A6TA 1FOXA 3CDIA 1U5TC 2E1NA 5K5QA 4I98B 3K2AA 3I54A 5D5WB 3GFIA 1Z67A 1SEUA 1KU7A 2L7MP 2QBYA 1SVOA 3ULQB 3DTIA 1FTZA 4HLYA 5DCFA 1T6SA 3FHZA 2EINH 3J80Z 1Z77A 2DCEA 4A5NA 5EDNA 4XRMA 4BQAA 1BC7C 1R9TA 2CQNA 3CDHA 4LMYA 1MJ9A 5ICFA 1ORKA 1YW7A 4DW6A 5IP9J 2ETHA 2F4IA 1YQAA 2GA1A 4DQ2A 2DA2A 3HUGB 3DLLF 4N9IA 5BOXA 1BBYA 5IYCJ 2QF7A 3WHBA 4W97A 1B1BA 1ON1A 5ICGA 4GFQA 5D6FA 3QP5A 4ITVA 1X19A 1RC9A 3COAC 4BS9A 2AQFA 1A36A 3GTGJ 3LSRA 5FRMA 1IRFA 2KQRA 3F6VA 2E2HA 4HF0A 4A5MA 4UY8I 3K1MA 2KLOA 4II2A 4RGUA 5GADJ 3OYAA 3JRHA 2MC4A 4OAYA 1USTA 5D5XB 2K9MA 5TRDA 4A3JJ 1MH3A 1L0OC 3OYLA 2JQ7A 2BHZA 2DXIA 4RAGA 2NVUB 4Q4ZF 2DFFA 2VBXA 1ZGWA 2J5OA 3PL8A 1C0WA 2X1EA 2FMLA 2P5VA 3IKVA 2A68D 4NBQA 2R5ZA 3C2BA 1DD5A 3FBIB 4DYRA 2GOXB 1KU3A 4HDVA 4BJ5C 1UAAA 1Q1VA 4OIRF 2VPLA 4EJWA 1D1BA 2FBIA 4BJTA 4IHWA 5C9HA 1XTAA 5B3SH 3OS1A 3TDZC 4LITA 2LH9A 1L3LA 3EDPA 5LFAA 3RDIA 3B73A 1QVTA 1MBHA 3RYRA 1SFOJ 2RQPA 4U87A 1ZLJA 4FE4A 5J3LA 4PCQA 4C9YA 3Q0UA 2V1DA 1JTXA 2ZSIB 3ESWB 3NQOA 3H9QA 2W82A 3OYIA 3ZMSA 3Q0VA 4CA0A 2V79A 2WY8Q 3K4NA 3I4NJ 1FBSA 3G73A 1YITI 5E79C 3FXRA 1AWCA 1T98A 2ZO4A 4A3KJ 3OYNA 3PO2J 3BTCA 1E17A 3L9FA 3WTYC 2HXIA 4FXDA 3MKYB 4XN0A 5CVIA 2HYJA 2BE5F 5B1AH 1GT0C 5E1WA 3NEUA 3HOXJ 1X2MA 2L7FP 3W6KB 1R4MB 3IRQA 3LQQA 1R4NB 5CVVA 3ZXSA 3HL2A 4BQNA 2H1KA 5CQEA 2BXYA 2LF7A 3SZPA 3CCJI 4ETSA 3DBRB 4IHYA 4KN7X 3RJPA 4U0YA 2EH3A 1ZRDA 3S1MJ 1GVJA 4KN4X 4G7ZF 1JKOC 2DA5A 4I0BA 1EH1A 3CO7C 1Z7LA 3U2RA 3JSOA 3F23A 1A31A 3AKZA 2L9NA 4H4KC 2HOEA 2RC4A 5H6RA 3WTUC 5L3GA 1NK3P 1YS6A 1BA5A 2HU9A 3A03A 3ZP5A 3PFYA 5HDGA 2LG4A 4QIWA 2EQRA 1WH5A 1Z3YA 1DQUA 1TZLA 3VB2A 2HKOA 3H3ZA 4MO7A 3GFLA 2L3DA 2HYFA 4KMUX 4XLNF 1CF7A 3L2WA 4RAZA 5FFXA 1Z91A 1MSFC 2JA5A 5CKTA 2CG4A 2BW3B 4LK0F 5KK1A 3IRRA 1MIUA 1HW1A 4XN3A 2DN0A 3HPGA 1ETKA 3HBLA 4ZYAA 3SFZA 4EJVA 5MLC9 2YX4A 1X4OA 2IBDA 1WJEA 4X0GA 4TV7A 2K4BA 1KA8A 3UR3C 2IA0A 4EEFG 3JAMZ 2IVMA 3F6OA 3WTVC 2IAIA 5J1RA 1IXCA 1WHUA 4NOLA 4OU0A 3ZGKA 2XVCA 4IKFA 2HYGD 4D7MA 4YFXF 1BW6A 4DBRA 1DPUA 3BR3A 2ZMEB 1LEBA 4XMYA 1VFCA 2A3SA 2CMPA 2ZMEC 1ZGJA 2LF8A 1T39A 3DU6A 1TLHB 1SFXA 1J7KA 2IGMA 3VYUB 1OR7C 2JA6A 5F08A 4YELA 3SHFA 3CZ6A 5HODA 5EZHA 2F4QA 2E71A 5IYBJ 1T0FA 2ID6A 2VJ4A 2OTJI 2M8GX 1JE8A 1IJWC 2A68F 5JFRA 4NOKA 4JOMA 3C2HA 2RN7A 3M7GA 4M9SA 1WJBA 2P6TA 2XC7A 2PEXA 4HOBA 1Y1VA 1RZ4A 5AONA 3RCOA 1WQHA 2L4AA 4R79A 5IT9Z 5CQGA 1XDSA 2MFZA 3HKZA 4QTRA 2M3AA 2QSHX 3FXKA 3IKTA 2XSJC 4A3BJ 2FOWA 5ERIA 1WPKA 3QODA 5FRNA 2YU9A 3RTRA 2D1HA 1YIJI 1IV6A 3HSFA 3MKZA 3RQ4A 4GCVA 1QZZA 2GIZA 3FXQA 3HSEA 1Z6RA 4D5CA 3CO6C 3CP8A 4B09A 1JKRC 2H6BA 2FBHA 2GLOA 3Q9VA 2VXZA 4S05A 4IEJA 3FMSA 2H1LA 4CXFA 1O7LA 5E3MA 1IDYA 2Z9OA 4FTHA 2DA7A 3LL7A 1TWCA 4PK4A 2EFQA 3V42A 5EGOB 2HPMA 3LNQA 2H6CA 3JAMK 4HNTA 1WI9A 2E5ZA 2R3SA 2W25A 2DOEA 3QRFF 1A6QA 3O8GA 5H6QA 1TL8A 2CQKA 1IN7A 4ENKA 4CHUA 2BVLA 2LD5A 4WCGA 2QM3A 1I1GA 3HJEA 4Y15A 2R7ZJ 1R1TA 5EEAA 1E3OC 1WKMA 3H5AA 3FBNB 1S5LC 3D5LA 1VQ4I 2IS2A 1TWFJ 1VZ0A 3JRCA 1X2NA 1OYYA 1U2WA 4CYDA 2CUFA 2PI0A 2IS6A 4MFDA 1MBGA 2KJBA 5J1UA 1ZR4A 4AYBN 2XGDA 4L0YB 2LKXA 4BUPA 3CP2A 6PAXA 4IJAA 1MZBA 2JZYA 4XLAA 4H0EA 1DGRM 2LKPA 1BOBA 2E35A 2EBIA 4K2EA 1LPQA 2DLLA 5DDGA 3CJNA 2DTZA 5JLXA 2RNGA 3HOUJ 4HPQA 1Y56A 1B6AA 2DYRH 1U5TA 3CLOA 4XLCA 5BNGA 1TTYA 3DWLE 4PZJA 1PJRA 4W1UA 1P4WA 1OCPA 3F8CA 1FZPB 5DD4A 1UHWA 2OA4A 5J40A 2DPDA 3OY9A 3CMMA 2DA3A 4A0XA 1X58A 1MIJA 1W5TA 3GTQJ 1GV5A 2LREA 5HNHA 4XLHA 2QBYB 1JHHA 5FD5A 2OC6A 2HGCA 2EZKA 2QSGX 4ZDLA 4IOAF 1DP7P 2KKOA 4II3A 4GYGA 2XASA 1XSXA 3R0JA 3SEZA 3R0AA 3IAS2 1FSHA 5GTHC 5HS9A 2LYCA 3HUGA 3BLYA 2LSOA 4IRGA 3U9GA 4KUMA 1STZA 1W1WE 5J4YA 3GMEA 3PIPF 3ML6A 3L2CA 2OBPA 1BI0A 3I64A 1QVUA 4OMYA 3OYHA 4LB5A 3S3OA 1Y0NA 2MC3A 2IGNA 4NB5A 3LAPA 2DT6A 3DKYA 4IPAA 3HPHA 4P5OA 4PJ0C 2WB1A 1VQ8I 2O6GE 4O3MA 2F48A 2RGVA 1RUOA 1S3JA 3KZYA 1RI7A 2VJJA 5F1JA 1Z1DA 4UV8A 4HX8A 1IDZA 2RVCA 3LFKA 2OQGA 3GTMJ 1HSJA 1IXRC 4YIIA 2GZWA 1YX5A 3FHNA 5FB2A 1VQ6I 1S7AA 1U0JA 3CC2I 3BWGA 5D8KB 1SFEA 3OYGA 4B4CA 1KQ9A 3NAUA 5FKLA 2BHYA 5ILSA 2VODA 1VTNC 3SFIA 2XAJA 2K9SA 5JHUA 3R4KA 4IHVA 3MCZA 5LHIA 2UWMA 1YW8A 5EYRA 4B43A 3HHGA 2ICWG 2ZJ2A 1WSUA 1OFCX 2Y69H 2VUMJ 1HF0A 4C3IJ 1AOYA 3PUBA 3PNYA 2LKSA 3VYRB 1UELB 1I3QJ 1RNLA
chains in the Genus database with same CATH topology
2V4JC 3OYBA 1LDKB 3SEQA 1R6RA 3D5SC 4NNJA 4BEHA 2V6EA 2O5RA 4AN8A 1WJCA 3E1SA 4ZDPA 4OAZA 2ZSHB 2K3PA 3OYCA 4BJ6C 2CV1A 1I6VD 3GTJA 3OYFA 3BG7A 3P9AA 3ZRGA 2RREA 2A5WA 1Y6IA 3VSLA 3EPZA 3S93A 3LSHA 4XKWA 1K83A 4LG3A 2CW8A 2LRDA 3S3MA 3CF2A 4CCLA 2B63A 2M7BA 1T95A 3TMOA 3BC8A 2CS3A 3LFUA 2NVYA 1WQFA 1ZELA 2HQAA 2R7TA 3W2AA 1TWFA 2DJIA 2BE5D 1RR8C 2GOMA 3LSMA 1TGOA 3UNGC 3QOEA 4BU2A 2DT7B 4E7JA 4XM3A 3MKWB 2A69D 2F6CA 4PJJA 1T8IA 2M7AA 1FMVA 3CJRB 4IQ4A 3D5RC 3DU5A 3HC7A 2CUZA 2WY7Q 2Z16A 1PYVA 3FDYA 4LIUA 3A1YA 3MAQA 1EK8A 3K4JA 2LBFB 2ELJA 2JA2A 3W2WA 4XOTA 2WBMA 1K4SA 3CJQB 4HSRA 4KB2A 3LHPS 3OR1C 1WJ5A 1V5EA 3OIQA 1R5ZA 3GTOA 2Q1ZB 1G59A 3A4CA 1WJDA 1TWAA 4RLFA 2VLAA 3L2RA 1YNND 3GTQA 3RSNA 2L5QA 2A6TA 4BDZA 4E7KA 4C2MA 3DQVC 1D0YA 2PJRB 2A6ED 2WAFA 1NG6A 3G2BA 4F91B 4XOPA 2LY1A 3K5OA 1SEUA 3DTIA 2E2IA 3CQZA 4CZCA 2Y0SA 1MMAA 4BQQA 3F9KA 3OYEA 2VIXA 4DBQA 4GRIA 4J01A 4BL0B 2DCEA 3DLAA 3OS0A 4IQJA 1R9TA 2XF6A 4F55A 3AL0B 4IZZA 4N4NB 3KEYA 2KL4A 4BGDA 1MNDA 2R7RA 3AL0C 3EUHC 1GE9A 2F4IA 4PJMA 4DIQA 1NG7A 3HUGB 2CW0D 4HG2A 3ONQA 2WADA 4B48A 4Y4RA 2IS4A 3GBGA 4GFQA 1N77A 4ITVA 1X19A 1MNEA 4BS9A 4BQOA 2AQFA 5HNFA 1A36A 3GTGA 5FRMA 2KQRA 4N4OB 2E2HA 3SDBA 4CUGA 1GLNA 2KLOA 2VJ5A 4II2A 2JVHA 3OYAA 3M1CA 3A2KA 2MC4A 3OL4A 4OAYA 2IXSA 2K9MA 1WJAA 2NVXA 3OYLA 1X1DA 2DXIA 3BG6A 5HVQC 3K59A 1IW7D 4ZJZA 3DPUA 2DOAA 2X1EA 3DPTA 3PL8A 3VWBA 4KISA 2A68D 1DD5A 3FBIB 1MMDA 2GOXB 4OWRB 4PSWA 1Q8IA 3LF9A 3GTPA 2L2OA 4BJ5C 4AYBA 1UAAA 3OYMA 3IAM2 2VPLA 2XAUA 1I50A 1R49A 2IGKA 3KYLA 1D1BA 1W36C 3L2QA 4E7HA 4BJTA 3K6GA 5C9HA 4B44A 3H5RA 4KC6A 4BDYA 2R7XA 4B47A 3OS1A 2A6HD 2UUZA 3K5NA 4LITA 2LH9A 3OOUA 5LFAA 3ZR8X 2E5NA 4MLOA 1BR1A 1SFOA 4D9JA 4D1QA 4U87A 4LMOA 1D0ZA 4C9YA 4L8IA 3DTEA 2W7NA 3DKXA 2ZSIB 4ZTFA 3H9QA 2W00A 2O5JD 2W82A 3AFHA 3OYIA 4BE0A 3CESA 4CA0A 4BEHB 2WY8Q 3K4NA 2K9LA 3K10A 2K5CA 4CH7A 2X1DA 2FUG2 4HNUA 3IAYA 3MD2A 4QPQA 4HRIA 2HDWA 3DTKA 4Y3OA 3OYNA 5JSBB 3HOTA 3K4BA 3EUAA 3S3NA 3K5MA 3MKYB 4FXDA 4XN0A 1Z21A 4XONA 1P9QC 3NWTA 4NOMA 2VQLA 3QYBA 2VB6A 3GTKA 3S8PA 4CCNA 3SJRA 2MD0A 3ZXSA 3HL2A 2R7UA 4BQNA 1LVKA 2VQHA 4E7IA 2M4KA 5CQEA 4E7LA 4KJZA 1D1AA 2P0WA 5KCMA 4EATA 1WJFA 3EUKL 1NH3A 3K5LA 3K4KA 4RM3A 2E1MB 3FKJA 2E1MC 4E4HA 4FGUA 2UV1A 1EH1A 1WFXA 3ZCOA 4KAWX 1Z7LA 3BCAA 1A31A 2LBFA 3AKZA 2L9NA 4H4KC 2X1CA 4XLFA 3K70C 3I3LA 2HVSA 3VDXA 1YE9A 2HU9A 3PFYA 4QIWA 2LG4A 2XF5A 3M4AA 2X6XA 3J7AY 1Z3YA 2L7KA 1DQUA 1Z3XA 5LD2C 1TZLA 4QCLA 3TBIA 1SAUA 4AHCA 1QHGA 2ZFUA 3DPLC 4BE2A 1TWHA 3VSKA 2X51A 4F3EA 4KITB 3L2WA 3W2VA 2JA5A 5CKTA 4F3QA 2VJIA 1SMYD 3OMYA 2BW3B 3LSIA 1JI8A 1MIUA 4IP8A 4XN3A 3HPGA 4U7BA 1UG0A 4ZYAA 5JHFA 3M8JA 5MLC9 1X4OA 4X0GA 1WJEA 3QYFA 1BR2A 3UR3C 1A35A 2V1NA 4PUSA 3PNVA 4E7SA 4KT6A 2I8DA 4XNFA 1MMGA 5TGTA 2V7FA 4NOLA 3ZGKA 2QKMB 4IKFA 4XLEA 4DBRA 1HQMD 2OUMA 4XMYA 1QHHD 2CMPA 2XDVA 4XQFA 2V26A 3DU6A 2OV7A 2IGMA 3VYUB 2JA6A 1OR7C 4CCJA 1WCMA 4YELA 5FROA 4HSTA 5HLTA 1D0XA 3CZ6A 4XR6A 1DGWY 4ZC3A 2F4QA 4JLRC 2VJ4A 2MABA 2VL8A 2F5VA 1AA7A 1ERDA 5KHDA 1EJ9A 2JA7A 2KDOA 2VASA 4NOKA 4JOMA 3U21A 2KZVA 3C2HA 1IS1A 4D3ZA 2JSPA 1WJBA 4YRVA 2XC7A 2R7OA 2WAQA 5JSNB 1Y1VA 1W36D 1TT0A 4E7ZA 2KRCA 3RCOA 1WQHA 4R79A 3FKIA 4PSXA 1IRXA 5CQGA 2R4GA 3SYTA 4XL9A 2MFZA 3HKZA 2M3AA 2CW7A 4F52A 2XSJC 1X4PA 1MMNA 3K4MA 4XORA 3QODA 5FRNA 3KX2A 3RTRA 4DOZA 2YU9A 2JUGA 3MKZA 3RQ4A 3OWTA 2LC2A 1J09A 2ZXIA 1BR4A 2HVQA 2KP6A 1X1BA 3CP8A 4XKBA 2CV0A 4JQFA 2VXZA 3OIPA 1V5FA 4O26A 2JVGA 2MYSA 2R7SA 4XKVA 4Y33A 3S32A 3IP4B 2Z2SB 4P1WA 1SFKA 4D3YA 2BVMA 3LL7A 1TWCA 4PK4A 3I9V2 3PNTA 3V42A 3OL3A 2HPMA 4C2UA 4HNTA 2E5ZA 2HPIA 1X1CA 4CCKA 1Y1WA 4QPOA 2X85A 4OYDB 1E0EA 4EJ3A 2M4GA 2Z1DA 4RM2A 1EA3A 3K4CA 3TL4X 1TL8A 3OR2C 2BVLA 4NQWB 1D1CA 2R7ZA 3HG9A 2CUJA 3K4LA 4NC7A 4Q5VA 3H9JA 4PFPA 2W1OA 4AU7A 2PMZA 3FBNB 3H5AA 2CH0A 2NOJB 3K58A 3DEEA 4DJAA 3D5LA 2KPMA 2KMUA 2LOOA 2E60A 3H35A 3PSIA 2IS2A 2XF7A 1VZ0A 4HEA2 2IS6A 1LFPA 4H3TA 3OYJA 3BCBA 2R92A 2WAEA 1KONA 4NUBA 2CFOA 1TWGA 4F93B 3L2UA 3K70D 4BUPA 4FYDA 3CP2A 1LKXA 2AQEA 3ZQQA 4XLAA 3RPUD 4PJNA 1DGRM 1BOBA 2VKHA 5CPRB 4C30A 5KNLA 1LPQA 1I3QA 4YEJA 4RMNA 2RNGA 3SZGA 2Q2EB 4HPQA 1Y56A 2M0MA 3MMYB 4ZDOA 1WQGA 4KB4A 4XLCA 3DWLE 1PJRA 4BE1A 2PJRA 2KHMA 2R7VA 4PJLA 1ISEA 3LMMA 2RQQA 1K6YA 4CSWA 3OY9A 4LIVA 3CMMA 3OS2A 2BOLA 4NC8A 4J00A 2B9SB 2ZXHA 2LREA 5HNHA 4XLHA 4PFOA 3VYSB 4RLQA 2OC6A 3C2GA 2L9SA 1SC7A 4ZDLA 3H5NA 3PJRA 2BW3A 4II3A 2X6WA 2X6YA 3HXLA 3SEZA 4XKCA 4BXFA 2V9KA 1V9MA 3IAS2 4Q5GA 3PSFA 2LYCA 3H9GA 3BLYA 3OYKA 4FETA 5HOOA 4E6KG 1FMWA 3LSKA 1N78A 1HA8A 1V5GA 4IX7A 2HZDA 2IGOA 3QYEA 3OYHA 4BACA 2LY2A 1Y698 3S3OA 4C2TA 3OYDA 3H0GA 2IGNA 4AVZA 1YX3A 1RRJA 2DT6A 3WVOA 1N75A 2IS1A 3DKYA 4P5OA 3HPHA 2R7QA 2WB1A 4ANJA 1ZYRD 4FASD 2W4SA 1S9HA 3W3CA 2VJJA 3GTMA 2WA0A 2HVRA 3E0JB 3HOSA 1YX5A 4IP9A 1T0FC 3FHNA 4KDDA 4F92B 4CCOA 2KRHA 1YNJD 1U0JA 4DGWB 3K57A 1DP3A 2CV2A 3OYGA 1G8XA 3L2VA 1MW7A 2VQGA 2HNHA 2QKLB 3IUOA 2R7WA 4ZTJA 2VKDA 3N05A 1QU3A 3LSGA 3GTLA 2UWMA 4B43A 3H0DA 2R93A 3NWSA 2VUMA 4CCMA 2VQCA 1OLTA 3PUBA 3PNYA 1K4TA 3VYRB 1UELB 4G6TB 2VXDA 3VYTB 4B3XA 1X1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQG A;  2R4G A;  4O26 A;  4LMO A;  3KYL A;  3DU6 A;  3DU5 A;  5C9H A; 
#chains in the Genus database with same CATH topology
 1OJL A;  2AS5 F;  4EJT A;  1HW5 A;  3P5J A;  3SEQ A;  2EJR A;  3KIO A;  1RKW A;  4AN8 A;  2Z5U A;  4ZDP A;  1PUE E;  4OAZ A;  2IPQ X;  3G1L A;  4I99 C;  3OYC A;  4MGR A;  1DDN A;  2EIM H;  3BG7 A;  3D1N I;  2A5W A;  4HYE A;  3MEX A;  3TOB A;  1A5J A;  1U8R A;  3ERE D;  2JN6 A;  2ESN A;  1KQ0 A;  3CF2 A;  2O61 A;  4ESB A;  3FXJ A;  4RBO A;  1UFM A;  2QVO A;  2NVY A;  3HSR A;  1WQF A;  1ZEL A;  3JRE A;  2KRF A;  3W2A A;  4NQW A;  2XKO A;  5DCM A;  1RR8 C;  2GOM A;  1TGO A;  1BN5 A;  1T08 B;  3UNG C;  1VND A;  4BH9 A;  2DT7 B;  4E7J A;  4XM3 A;  2D5V A;  2F6C A;  4ZZL A;  4PJJ A;  1ZRC A;  1T8I A;  3DU5 A;  2W84 A;  2OD5 A;  1UCR A;  3I4P A;  1T38 A;  1X3Z B;  3CCV I;  2Y9Y A;  5CVU A;  2PMH A;  4I6Z A;  1ULY A;  1O7F A;  3VOE A;  3F8N A;  2BY2 A;  2DMQ A;  2DQR A;  2LVS A;  2JA2 A;  2ZCW A;  4UB8 C;  1TT5 B;  2WBM A;  4WK8 F;  3SJM A;  4L18 B;  3CJQ B;  4HSR A;  3CCU I;  1JGG A;  4I0A A;  5J47 A;  2MH9 A;  4BBS J;  2YU3 A;  2Q1Z B;  2VLA A;  2XRN A;  3RSN A;  5EZG A;  4E7K A;  4BDZ A;  4UUS A;  1UMQ A;  2F5C A;  1XCB A;  2JSC A;  1D0Y A;  2R7F A;  1XDU A;  3O2P E;  3PM1 A;  2XAQ A;  3EYI A;  2EV0 A;  1ZHF A;  1OPC A;  4RGX A;  2B9S A;  2LY1 A;  4GGG A;  1J9I A;  3GLL A;  2E2I J;  2Y0S A;  1XGN A;  4DBQ A;  3JTH A;  2NXN B;  2JA5 J;  3DLA A;  3CLQ A;  5LLQ A;  3EQL F;  4WF2 A;  5EEG A;  3ZN1 A;  3O6B B;  3KEY A;  3MN2 A;  1MND A;  3GXO A;  3HRU A;  4LG0 A;  3BTJ A;  2NS0 A;  2K4J A;  4PJM A;  4DIQ A;  3I56 I;  4NC6 A;  2ZME A;  2KIM A;  3ONQ A;  3BRO A;  4Z6Y A;  4Q48 A;  2JWT A;  1OR7 A;  5BQT A;  4U88 A;  1N77 A;  2R7D A;  1QPI A;  3OOP A;  2NNY A;  1MNE A;  5J8F A;  4BQO A;  4R8H A;  1ENH A;  4LD5 A;  2F5D A;  4E70 A;  4WXH A;  3K1P A;  1GLN A;  5FKN A;  2JVH A;  3M1C A;  3A2K A;  3OL4 A;  4KMF A;  4RA2 A;  1XGS A;  4LJZ F;  1S72 I;  3ECO A;  2NVQ J;  1Y39 A;  2NVX A;  2EA2 A;  3BG6 A;  4M6X A;  2K40 A;  3K59 A;  1U78 A;  1LFU P;  1IW7 D;  3VWB A;  3ZMZ A;  1J75 A;  2CQQ A;  4KYW A;  2EZL A;  4DZP A;  3RZD J;  4OWR B;  5B5E C;  2ISY A;  3G1M A;  1VQ7 I;  1R36 A;  3RYP A;  2DO7 A;  2IGK A;  2RV8 A;  3ZMT A;  1B8I B;  4I76 A;  3U1K A;  2DMT A;  3K6G A;  1ZR2 A;  4FT8 A;  4BDY A;  2R7X A;  5E17 F;  4LOC A;  2UUZ A;  4PGG A;  1H9T A;  3IC7 A;  3ZOB A;  4ZYG A;  3OOU A;  3BTI A;  5HLH A;  4MLO A;  1BR1 A;  2YU9 J;  3V8J A;  3L7W A;  3DTE A;  1IRZ A;  4AIK A;  5JI6 A;  2STT A;  4CDG A;  2EIJ H;  3AFH A;  3DEW A;  1F36 A;  5EGO A;  2HQR A;  3CD6 I;  3IV5 A;  3K10 A;  2V9V A;  1XGO A;  2X1D A;  2DMU A;  4QPQ A;  2COM A;  4RGS A;  3RZO J;  2OTL I;  1MJA A;  1RET A;  3HOT A;  5HS8 A;  2VI6 A;  3EUA A;  4XRS G;  4UV9 A;  2NS8 A;  2QQ8 A;  1ZG3 A;  2VB6 A;  2YSR A;  2QSF X;  3SJR A;  1B9M A;  3K0L A;  2EFN A;  3V8K A;  2R7U A;  5LRR A;  5CVJ A;  3GUD A;  4LLL A;  1QPM A;  4E7I A;  4E7L A;  2QCO A;  3Q5F A;  1LQ1 A;  1VQN I;  4MFE A;  2XGX A;  1LUJ B;  2FEZ A;  2E7W A;  5KCM A;  5F6F A;  1FSE A;  2YR2 A;  1WJF A;  3MWM A;  3KET A;  1LE8 A;  4L5E A;  3K5L A;  5F04 A;  2E1M B;  3E97 A;  5BS6 A;  1OCC H;  5IPA A;  2E1M C;  4FGU A;  2KIU A;  1BOA A;  3BCA A;  1FT9 A;  2LBF A;  2STW A;  1TC3 C;  2P7V B;  2HVS A;  1MMS A;  2M87 A;  2BBY A;  5E18 F;  1YE9 A;  1V54 H;  1U6G A;  3M4A A;  1YJ9 I;  1WVR A;  2L7K A;  2W48 A;  3KZZ A;  3TQN A;  4MTD A;  4ENM A;  2XPU A;  3ISP A;  1P6R A;  2KJC A;  3E6B A;  2ZFU A;  1BM9 A;  2K85 A;  3DPL C;  4UVB A;  3TP0 A;  2DW4 A;  3VSK A;  1TWH J;  1G3S A;  2Y0M A;  1HLV A;  4F3E A;  2K86 A;  2VE8 A;  3W2V A;  4F3Q A;  2VJI A;  3JW4 A;  3V7S A;  4MIM A;  4IP8 A;  2FJ1 A;  1UG0 A;  2I5U A;  1R1V A;  4M72 A;  2GA2 A;  3QYF A;  4ON0 A;  4Y7N J;  4CGZ A;  3KP7 A;  1JXS A;  4CZZ A;  4KT6 A;  2I8D A;  4XNF A;  4A3L J;  4EJU A;  1OQY A;  3KYC B;  4S0H B;  1HCR A;  3H3V K;  4RB1 A;  3S2W A;  5GPC A;  3UKG A;  2OPT A;  2EA4 A;  3M9A A;  5ICE A;  3RPQ A;  1HQM D;  2BEO A;  3QP6 A;  4I7H A;  3Q9S A;  1QHH D;  3G6E I;  3GX4 X;  1HKS A;  4XQF A;  2V26 A;  2OV7 A;  3H92 A;  3KZI C;  1WCM A;  5HDK A;  2V1X A;  5FRO A;  5IY5 H;  1XMK A;  2EZI A;  1HST A;  1YTY A;  1D0X A;  4JLR C;  1LFB A;  1YI2 I;  1AA7 A;  1R22 A;  3DF8 A;  1IW7 F;  2EK5 A;  2FRH A;  2JA7 A;  5M5X J;  1G2H A;  4FE7 A;  2OQR A;  5HS7 A;  3H36 A;  3MFK A;  2OCC H;  1TT0 A;  1MSE C;  2K9N A;  4QIW N;  3FKI A;  4P96 A;  1F43 A;  2R4G A;  4L5I A;  3SYT A;  5DEQ A;  2KT0 A;  2OF7 A;  1DU0 A;  2CW7 A;  3PUF A;  3WTX C;  2Y30 A;  1TNS A;  3K4M A;  4XOR A;  4LLN A;  3FF5 A;  3KX2 A;  3BJO A;  2CU7 A;  2JUG A;  2A07 F;  3OWT A;  2LC2 A;  3MZH A;  2FOK A;  1MBJ A;  1F4K A;  2ZXI A;  1BR4 A;  2HVQ A;  2KP6 A;  1OMI A;  4IRI A;  1X1B A;  5DYM A;  2MA3 A;  1APL C;  1PVE A;  4EVI A;  1G3Y A;  2R7S A;  3O8H A;  3S32 A;  2VT3 A;  3I4M J;  4ZYE A;  3DP7 A;  1XPX A;  1SFK A;  4D3Y A;  1SD7 A;  1H88 C;  1IN4 A;  3OL3 A;  2M1B A;  2E1C A;  1FBQ A;  3PQK A;  3V4G A;  4Y52 J;  3R60 A;  4CCK A;  5ILU A;  4QPO A;  4U7D A;  1Y1W J;  2X85 A;  1E0E A;  4EJ3 A;  1O4X A;  3HEF A;  4RM2 A;  2YS9 A;  3K4C A;  1T2K A;  3E3V A;  4G7O F;  4EGZ A;  4NQW B;  5DCM B;  3HG9 A;  2O0Y A;  4NC7 A;  3F8F A;  1VQ9 I;  4Q5V A;  4PFP A;  2W1O A;  4PGH A;  2PMZ A;  3WU1 B;  3WGH A;  3IL2 A;  5E1Z B;  1O57 A;  4HDU A;  3OV8 A;  4DJA A;  2NVY J;  2HQN A;  1SVM A;  2LOO A;  4M9Z A;  5IP7 J;  2XF7 A;  2W57 A;  2N8G A;  4M3E A;  1S8N A;  3N97 A;  3ECH A;  1MBF A;  3F8M A;  2V6C A;  4H3T A;  5FLV A;  1P7J A;  3BCB A;  2R92 A;  1KON A;  3ASN H;  3TGN A;  5CLS A;  2MBF A;  4LFU A;  5DD8 A;  4F93 B;  3K9T A;  1IV8 A;  3K70 D;  4A3I J;  2GXA A;  1TWG A;  1I39 A;  4XBF A;  2LTP A;  2Z99 A;  4A6E A;  3R6S A;  4PJN A;  3LST A;  2VOP A;  2VKH A;  4C30 A;  2IEK A;  4RMN A;  3HRS A;  1Q1H A;  3SZG A;  1WQG A;  2L54 A;  1H89 C;  1E2X A;  2B0L A;  4UUS B;  2BXZ A;  1HKQ A;  4PJL A;  4M6V A;  4CSW A;  3LAJ A;  4LIV A;  4S04 A;  4BHC A;  5KVR A;  2B9S B;  4X1E A;  4J00 A;  2MSY A;  1SVL A;  3O3K A;  4KDP A;  4HQM A;  3C2G A;  1JHF A;  2L9S A;  4JK1 X;  1SC7 A;  3BR1 A;  1SFU A;  1HKT A;  1P4A A;  2IW5 A;  2EV5 A;  3PJR A;  5FO5 A;  1FX7 A;  3DFG A;  3BZ6 A;  4BXU A;  3FWE A;  4HW0 A;  4XKC A;  2V9K A;  5EG0 A;  1V9M A;  2M45 A;  4EM0 B;  1ONV A;  4V2G A;  3KCC A;  4LG0 B;  4JYK A;  5DTD A;  1HXD A;  4FET A;  5HOO A;  3OYK A;  2HOT A;  4E6K G;  5H2F C;  4P9F A;  2DTR A;  3FXM A;  2AXL A;  3KP2 A;  1W7P D;  1XB4 A;  3MKL A;  3LSK A;  2LY9 A;  1R71 A;  2PJP A;  5C44 J;  3PO3 J;  2DA6 A;  2HZD A;  1V55 H;  4BAC A;  3I71 A;  1XX5 A;  3OYD A;  4A3M J;  3H0G J;  3HZJ A;  2ZJP F;  2DU9 A;  2G0E A;  1QZY A;  4HF1 A;  2FBK A;  1R5G A;  1W7P A;  3F22 A;  1WQ2 A;  4ANJ A;  4FAS D;  2FQ4 A;  2K02 A;  4D0P A;  3FXL A;  2CRG A;  4YG2 F;  2MD5 A;  4YIR X;  2WA0 A;  1KZH A;  3S1N J;  3I58 A;  4B3A A;  1O3S A;  1ZQ3 P;  1XD7 A;  3CCL I;  1DU6 A;  1OKR A;  2K3F A;  2O8X A;  4F92 B;  2KRH A;  1ZTR A;  3PIO F;  2DA4 A;  4UUT A;  2P5L C;  2P6S A;  1BI1 A;  2Y9Z A;  3HOZ J;  4X6A J;  1G8X A;  2L02 A;  3KPH A;  3S16 J;  1MW7 A;  1B8I A;  2DOD A;  2G7H A;  4KNY A;  3IUO A;  2XAH A;  2R7W A;  4ZTJ A;  3N05 A;  1QU3 A;  1BI3 A;  4R1H A;  3H0D A;  1ZG5 A;  2VQC A;  5D8L B;  3A02 A;  3KP4 A;  5TIS C;  3J7A O;  5GP9 A;  1K4T A;  3BDD A;  2M0C A;  4BYY A;  4AID A;  2L9R A;  2TCT A;  3VYT B;  1X1A A;  3OYB A;  2FF4 A;  3JCU C;  3GWZ A;  4L5J A;  1R6R A;  3BZK A;  3D5S C;  4NNJ A;  1FIA A;  4WX9 A;  3C18 A;  2MLG A;  3LQR A;  4RB3 C;  2F4M B;  1WJC A;  2E7X A;  3QPT A;  2ZSH B;  1I6V D;  3S1R J;  3CC4 I;  4L9T A;  3GTJ J;  3ZRG A;  3VEP A;  3VSL A;  3S93 A;  1LEA A;  3LSH A;  2CW8 A;  3S3M A;  2DJN A;  1VQL I;  2HOS A;  3WTZ A;  1UHM A;  4CCL A;  2B63 A;  2XV4 S;  1ON2 A;  2VPR A;  3TMO A;  2WB1 N;  3BC8 A;  5JVG F;  5LGN A;  2HQA A;  1I27 A;  4M6Y A;  3TED A;  3LSM A;  3FXO A;  3HDD A;  1GDT A;  4BU2 A;  4OIP F;  2D1V A;  1MBK A;  2OU2 A;  4BKX A;  2ZJQ F;  4MQ9 F;  2PBI A;  1FC3 A;  1BIB A;  5L3D A;  1FMV A;  4IQ4 A;  1LE8 B;  3D5R C;  2JJ7 A;  3HC7 A;  4ESJ A;  3QPS A;  2CUZ A;  2IRF G;  5M3M J;  4KT5 C;  3BJ6 A;  2F5E A;  2ME0 A;  5K5O A;  1EK8 A;  1V4R A;  2LBF B;  2ELJ A;  2E19 A;  2X9D A;  4KB2 A;  3DKW A;  3CCM I;  3EET A;  2OJE D;  1WJ5 A;  2G9W A;  2Q2E A;  3OIQ A;  1G59 A;  3A4C A;  1WJD A;  1TWA A;  4RLF A;  2L5Q A;  1FJL A;  3F72 A;  4M3F A;  2CJJ A;  3DQV C;  2PJR B;  2A6E D;  2WAF A;  3G2B A;  4XOP A;  2E34 A;  1I6X A;  3K5O A;  1WI3 A;  2NRA C;  3T8R A;  3ZQC A;  3HRM A;  1LNW A;  1H9G A;  4CZC A;  4MNU A;  1JJ8 C;  1HC8 A;  1R1U A;  4BQQ A;  3F9K A;  2VIX A;  2BY0 A;  4FHT A;  4GRI A;  4M9X A;  2L9V A;  3OS0 A;  1K61 A;  1ZRF A;  5A2Q Z;  2K9Q A;  5BMZ A;  1R9T J;  4F55 A;  1W0T A;  1MGT A;  4N4N B;  4IZZ A;  2KL4 A;  1LVA A;  2R7R A;  1OCR H;  1GE9 A;  1FYL A;  4OIO F;  5DUK A;  2CW0 D;  1ETO A;  3GLX A;  1BIA A;  1P4X A;  2LR8 A;  4DYQ A;  2WAD A;  1EH8 A;  3LA3 A;  3BT9 A;  4B48 A;  1POG A;  4Y4R A;  1UZC A;  3GBG A;  1XC5 A;  1XSV A;  2RAE A;  1QZE A;  1B59 A;  1G3T A;  3TKY A;  1GHC A;  3GTG A;  2MH2 A;  5L3B A;  4N4O B;  3BQY A;  2E2H J;  4DZJ A;  4CUG A;  5K1Y A;  3TDU C;  1PDN C;  3S15 J;  1MDM B;  2LNB A;  2IXS A;  2QZ8 A;  1WCM J;  1WJA A;  4KA4 A;  3WE3 A;  5KAI C;  5HVQ C;  2XRL A;  5D5U B;  2NAZ A;  2DOA A;  4KIS A;  1YO5 C;  1J2X A;  1OYW A;  1MMD A;  5EJC A;  1Q8I A;  4PSW A;  3GTP A;  2ZKZ A;  4AYB A;  2DOF A;  3BJA A;  3IAM 2;  1I50 A;  1R49 A;  3KYL A;  1O3T A;  3HM5 A;  4E7H A;  3PQJ A;  1O3R A;  4B44 A;  3H5R A;  2DAO A;  4KC6 A;  4B47 A;  2A6H D;  1QGP A;  4EJO A;  3K5N A;  4HBL A;  3QQA A;  5CYV A;  2E5N A;  4AM3 A;  1SFO A;  2FXA A;  2COB A;  1JKP C;  1GXQ A;  1D0Z A;  4L8I A;  1NTC A;  3DKX A;  2NYX A;  4ZTF A;  1E3H A;  2D2W A;  2O5J D;  3GF2 A;  3JSP A;  2XRO A;  2A5Y B;  4ESF A;  1EV7 A;  1YFH A;  2K9L A;  1MJB A;  2K5C A;  1YRN A;  4CH7 A;  1ITY A;  2FUG 2;  3IAY A;  3MD2 A;  2ACJ A;  4AD9 A;  5A2Q K;  3DTK A;  1JT6 A;  2HTJ A;  3HGY A;  9ANT A;  3K5M A;  4M3B A;  3G4S I;  4RB2 C;  4NOM A;  2YPR A;  3QYB A;  4ZYH A;  1A04 A;  2ZBK A;  3GTK A;  3S8P A;  2FMY A;  4RS8 A;  4UNO A;  4AUX A;  4IRH A;  4IF4 A;  1LVK A;  3SXY A;  2M4K A;  1G3W A;  5GAE J;  3HIF A;  4KJZ A;  1WH7 A;  2HXO A;  4G9Y A;  3F21 A;  1GUU A;  4A3E J;  4EAT A;  4KFC A;  4J19 A;  1VQP I;  4IL6 C;  3RI4 A;  3N4M A;  3BP8 A;  3JRA A;  3KYD B;  3K4K A;  1OYI A;  5AIQ A;  4A3G J;  3RKW A;  1P2F A;  1RR7 A;  3BR6 A;  4XK4 A;  4BNC A;  2DK5 A;  3P9C A;  2UV1 A;  1WFX A;  5BPD A;  4KAW X;  1K7A A;  2O8K A;  2EFW A;  1B9N A;  4YIF A;  4LK1 F;  3K70 C;  1R5I D;  2HR3 A;  1UB9 A;  2QEX I;  4FQG A;  4FX4 A;  2A6E F;  2XF5 A;  2X6X A;  1BI2 A;  1Z3X A;  2DFI A;  3CMY A;  4QCL A;  1QQI A;  1IUF A;  2GWR A;  1W4M A;  3TBI A;  1QHG A;  4BE2 A;  3K7A J;  2JPC A;  4KIT B;  1KU2 A;  1RKT A;  4HX4 A;  1TNT A;  3U1D A;  3M8F A;  4U7B A;  3BQZ A;  5FD6 A;  3WGI A;  2EFP A;  2Q0O A;  3GEZ A;  5J4V A;  5GAH J;  5EG0 B;  5JHF A;  4GFB A;  3QPH A;  2TRT A;  4EV0 A;  2MG4 A;  4XSX F;  1B4A A;  1BR2 A;  1TQM A;  4E7S A;  3PNV A;  2IA2 A;  3G71 I;  3ASO H;  2CW0 F;  2WWY A;  4XIC A;  1W0U A;  3EUH A;  2ZJR F;  5F1R A;  3WGG A;  2V7F A;  2JT1 A;  4MTE A;  5FKM A;  3LSJ A;  2XB0 X;  2QKM B;  1FP1 D;  3JRG A;  4EM1 A;  2OUM A;  1W7P B;  1EF4 A;  2KZG A;  2XDV A;  1PUF A;  2P7C B;  4CCJ A;  2JA6 J;  4XRF A;  3E7L A;  4LB6 B;  1IRG A;  1FP2 A;  2MW8 A;  3BR0 A;  1YIO A;  1DGW Y;  4XR6 A;  4ZC3 A;  1VQO I;  1P7I A;  2CQ7 A;  2F5V A;  1ERD A;  5KHD A;  4UUV A;  2DDA A;  1G4D A;  1ZH5 A;  2KDO A;  2VAS A;  3M8E A;  3U21 A;  3WU0 A;  4D3Z A;  1T56 A;  1YW9 A;  3CCQ I;  2WAQ A;  5JSN B;  1Z0X A;  5ICC A;  4HV6 A;  3WU2 C;  1Y1V J;  4E7Z A;  3CCS I;  1W36 D;  4MHG A;  1WGX A;  2KRC A;  4IOC F;  2HKX A;  3HOW J;  4PSX A;  1ETV A;  1KYW A;  2GQQ A;  5LEJ A;  4KIC A;  1X4P A;  1JKQ C;  1MMN A;  2A6H F;  2ZXW H;  2LLK A;  3HTU A;  1HBX G;  1QRY A;  1EKE A;  1ETX A;  5HLG A;  2V9P A;  3S1Q J;  2H94 A;  2FA5 A;  1D8J A;  1Y0U A;  4OIQ F;  4M73 A;  1FYK A;  2OZU A;  1R5H A;  4XKB A;  2CV0 A;  4A0Z A;  1K78 A;  3CUQ B;  4F7Z A;  1V5F A;  2KIF A;  3CUQ C;  2LK2 A;  1Y8Q B;  3IP4 B;  1S29 A;  2FNP A;  4A3C J;  3GZN B;  1I1S A;  1FWZ A;  5FKK A;  5IP6 A;  1TWC J;  2LMD A;  1LDJ A;  3I9V 2;  3PNT A;  2ISZ A;  4GDF A;  4A12 A;  5DS9 A;  5CJ9 A;  5LGT A;  4CO8 A;  2XHK A;  4FIS A;  1TW3 A;  3R61 A;  2M4G A;  1N25 A;  1TW2 A;  3TL4 X;  3OR2 C;  1YLF A;  2QLZ A;  2R7Z A;  3DBL B;  3K4L A;  5D4S A;  1OCZ H;  5K7F A;  2B63 J;  1Y8R B;  4AU7 A;  2CH0 A;  2DQL A;  3DEE A;  3CMA I;  3PSI A;  2KMU A;  2P5K A;  4HEA 2;  2WC2 A;  3K69 A;  1LFP A;  3OYJ A;  3TO6 A;  1FY7 A;  3A0H C;  4B1R A;  1RUN A;  3ZQL A;  2ECB A;  5DM6 F;  1LKX A;  2AQE A;  3ZQQ A;  3F8B A;  1TP4 A;  3RPU D;  4XID A;  3J7Z I;  4AIJ A;  2FSW A;  4D7N A;  3LA7 A;  3WTS C;  2Q2E B;  1S7O A;  3MMY B;  3M07 A;  4KB4 A;  5K5R A;  2CGP A;  3KLO A;  1VI0 A;  3FK7 A;  3E5U A;  2PJR A;  2KHM A;  1ISE A;  2GIV A;  3LMM A;  2IT0 A;  2EWN A;  2RQQ A;  5E1X A;  1SAX A;  5F0F A;  3VPR A;  1JT0 A;  3S14 J;  1U9O A;  2ZC2 A;  2ZXH A;  2YUS A;  2ME6 A;  2X0L A;  2BY1 A;  3QWL A;  1XSD A;  2VBY A;  3FIW A;  5L3C A;  4ZH4 F;  4JBA A;  2LFB A;  3H5N A;  5E3L A;  4UVC A;  1I5Z A;  1Z7U A;  4AC0 A;  2EIK H;  3B6C A;  3HYI A;  3CME I;  3I0T A;  2P81 A;  2X6W A;  1I6H J;  2X6Y A;  3HXL A;  3KP5 A;  4BXF A;  2X4H A;  5M3F J;  3KP6 A;  1BL0 A;  3PSF A;  2M30 A;  2BGC A;  3H9G A;  2O3F A;  3V7R A;  1FMW A;  1TBX A;  3D0S A;  2OAZ A;  2XPW A;  1HA8 A;  3GVA A;  4IO9 F;  2XKP A;  2RKH A;  3QYE A;  1HOM A;  1D5Y A;  5FJ8 J;  2PMZ N;  1M1E B;  4NDL A;  4ENN A;  1IG7 A;  4HQE A;  2ID3 A;  1IGN A;  2VON A;  1R58 A;  3EYY A;  3WVO A;  1N75 A;  3P9I A;  2BY3 A;  1AU7 A;  2JK3 A;  1ZYR D;  1RES A;  5BPI A;  2W4S A;  1MDM A;  3AAF A;  1K79 A;  4ABZ A;  1FNN A;  2CYY A;  1XMA A;  1IF1 A;  3GTM A;  5GAG J;  1OIS A;  3JR9 A;  1J0R A;  3HOS A;  1UG2 A;  2QQ9 A;  2QGU A;  4G6Q A;  4IP9 A;  4KDD A;  5FLX K;  2Q8K A;  1QBJ A;  2FE3 A;  1U8B A;  1K6O A;  1YNJ D;  2XB5 A;  4MEY F;  3ZMD A;  3ZMV A;  1DP3 A;  2IJL A;  2CV2 A;  1SMT A;  5CVR A;  4KIB A;  2V1U A;  1IN5 A;  2A61 A;  4YFN F;  2R0Q C;  2HNH A;  4IXA A;  5M5W J;  4I01 A;  2VKD A;  5EEH A;  3LSG A;  3GTL A;  4EM2 A;  2R93 A;  1HQC A;  1XCV A;  3GTP J;  2M9H A;  3CCE I;  2VUM A;  1U9N A;  4M3D A;  3GZ6 A;  1OLT A;  1I50 J;  3G1O A;  3A01 B;  2R5Y A;  1VF9 A;  3CTA A;  1I3Q A;  3J81 Z;  2ZNZ A;  4B3X A;  3E6M A;  3B02 A;  3P7N A;  1OCT C;  1GVD A;  1LDK B;  4KIF A;  2L0K A;  2VOO A;  5IOZ A;  1YRN B;  3E1S A;  3ZQ7 A;  2CV1 A;  2K3P A;  4RB0 A;  2DT5 A;  3ZQI A;  4WXC A;  3P9A A;  4L9J A;  2GBY A;  3AG1 H;  3C1D A;  5HDN A;  4N0B A;  4XLP F;  1F1Z A;  4XKW A;  3J80 K;  1K83 A;  1FLI A;  3RKY A;  2FU4 A;  2M7B A;  1T95 A;  3MQ0 A;  2Z33 A;  3LFU A;  1G6N A;  4OOI A;  2R7T A;  1XGM A;  4Q5S F;  2UXN A;  5E20 A;  3QOE A;  2DI3 A;  1P92 A;  1FEX A;  2NNN A;  2WTE A;  3MKW B;  3HHH A;  2O9L A;  2XGC A;  3GTK J;  2A69 D;  3CF5 F;  4AWX B;  2M7A A;  2CSO A;  3CJR B;  4WXD A;  3SQN A;  1ODD A;  4Y17 A;  4UVA A;  2QYO A;  2WY7 Q;  2Z16 A;  3HKZ N;  5F0C A;  2AO9 A;  2HDD A;  1PYV A;  4JP0 A;  5E8I A;  2HWV A;  2J5P A;  3A1Y A;  3M3Y J;  3GFJ A;  2QQB A;  3IH4 A;  3BPX A;  4AVP A;  3W2W A;  1D5V A;  3GO5 A;  2VBW A;  3QAH A;  1K4S A;  5TJJ A;  3FM3 A;  4M74 A;  1USS A;  4WWC A;  3LHP S;  3OR1 C;  3I5U A;  2E1O A;  4M71 A;  3GTO A;  1ACI A;  2XGE A;  4XRS A;  2MLK A;  3KLN A;  1YNN D;  4HA8 A;  3KP3 A;  2JMW A;  3BG9 A;  4C2M A;  1BJA A;  2D45 A;  1NG6 A;  4BXX J;  4F91 B;  3ZN0 A;  5IOY A;  5L3F A;  2ELH A;  5F64 A;  2M2E A;  3L00 A;  2XSD C;  3J81 K;  2E2I A;  2ELK A;  5C3E J;  3CQZ A;  1MMA A;  3OYE A;  1VQ5 I;  3F0C A;  4BHB A;  3WHC A;  4J01 A;  4BL0 B;  3C7J A;  1QNT A;  2DMP A;  4IQJ A;  3C3W A;  3L09 A;  2XF6 A;  4N9H A;  3AL0 B;  1HDD C;  3RIR A;  4BGD A;  1F9N A;  2H8W A;  3AL0 C;  3E6C C;  3EUH C;  2CUE A;  2JPB A;  3P9K A;  4IHX A;  1NG7 A;  3GFM A;  4QSH A;  4HG2 A;  1WZ2 A;  1IC8 A;  3H1C A;  5FLM J;  2VKV A;  3BTL A;  5DV5 A;  4JX4 A;  3BR5 A;  3W6J B;  4O5V A;  2IS4 A;  1MNM C;  3KE2 A;  1ZYR F;  1KU9 A;  1BW5 A;  2JA8 J;  1PUF B;  1X3W B;  5HNF A;  2F2E A;  4A6D A;  2YX7 A;  2HTS A;  2FNA A;  3SDB A;  1TQP A;  2KIQ A;  2VJ5 A;  2ESH A;  5K7H A;  3I55 I;  2PN6 A;  2W24 A;  3NAR A;  2NVX J;  1X1D A;  2HEO A;  2GXB A;  1IUY A;  2MGQ A;  5J6X A;  5DUI A;  4I2O A;  1HW2 A;  4ZJZ A;  3DPU A;  3BG3 A;  3DPT A;  2E36 A;  2NVT J;  3DXJ F;  5F27 A;  3GYH X;  1FPQ A;  2Y31 A;  3CUO A;  4O6J A;  1KYZ A;  3AG4 H;  2HFH A;  3AG2 H;  2KDZ A;  1I3A A;  3LF9 A;  3MVP A;  2L2O A;  2HI3 A;  4A3F J;  3TW7 A;  3OYM A;  2XAU A;  2DYS H;  1W36 C;  3L2Q A;  4DYC A;  1JGS A;  1LJ9 A;  3ABK H;  5KAF C;  1VQM I;  2G7U A;  1AKH B;  1XN7 A;  3ZQF A;  3CUQ A;  3ZR8 X;  1AHD P;  1K78 B;  4D9J A;  4D1Q A;  3FX3 A;  3WTT C;  3ZQG A;  4LMO A;  1T33 A;  3RQI A;  2ECC A;  1REP C;  2W7N A;  3CC7 I;  4QWQ A;  2W00 A;  3JTG A;  4BE0 A;  3CES A;  4BEH B;  5GTI C;  1SD6 A;  3I59 B;  2O7O A;  1YG2 A;  4CYC B;  1EH7 A;  3ABU A;  4HNU A;  1TQI A;  2K7L A;  4HRI A;  2HDW A;  3FM5 A;  3ZPL A;  4Y3O A;  1MBE A;  4C3H J;  1QA6 A;  3K1N A;  5JSB B;  3K4B A;  3RKQ A;  2H8R A;  4ZZD A;  3S3N A;  4RAF A;  2XIG A;  1Z21 A;  4XON A;  1P9Q C;  3NWT A;  1V3F A;  2VQL A;  1MKM A;  4CCN A;  2MD0 A;  2PFB A;  2WV1 A;  2A69 F;  3BZC A;  1JUS A;  4GO1 A;  5JVT A;  2VQH A;  3IHU A;  3G3Z A;  1D1A A;  2M34 A;  2P0W A;  3BR2 A;  4G12 A;  4QLC U;  1O3Q A;  1B72 A;  3IWZ A;  3IWF A;  3MAJ A;  3EUK L;  1SAN A;  1NH3 A;  4BHP A;  1RIO H;  2H09 A;  2WV0 A;  4YFK F;  4RM3 A;  3FKJ A;  5LHG A;  3ROU A;  5EF6 A;  4E4H A;  4BY1 J;  2HQ5 A;  3ABT A;  1IO2 A;  3CDL A;  3ZCO A;  4RDU A;  3ABL H;  4L9V A;  2X1C A;  4XLF A;  3S2D J;  1XMX A;  3I3L A;  3HTS B;  4MQV A;  3T5X A;  2ZNY A;  2IA1 A;  3M4O J;  3VDX A;  1F5T A;  1D8K A;  5E3O A;  3J7A Y;  5FFZ A;  3MZY A;  2TDX A;  3Q0W A;  5LD2 C;  1MH4 A;  1NHA A;  2CFX A;  3F3X A;  5IT9 K;  1MD0 A;  1SAU A;  2HDC A;  2I10 A;  4AHC A;  1ETQ A;  4B8X A;  3HOV J;  1TWH A;  4BBR J;  2X51 A;  4A0Y A;  3LA2 A;  4RGR A;  1SMY D;  2OZ6 A;  3OMY A;  3LSI A;  1JI8 A;  2ADU A;  3SDG A;  5E3N A;  3LSP A;  1R7J A;  2VC0 A;  4CIC A;  2QA4 I;  4LGW A;  3M8J A;  3DCF A;  3V8L A;  1ZG1 A;  3S2H J;  1ZKG A;  1ZK8 A;  3E5X A;  4XSZ F;  1IAW A;  2BV6 A;  3ZMU A;  2V1N A;  4PUS A;  1A35 A;  3S17 J;  2PMU A;  1UJ8 A;  2JRT A;  2FQ3 A;  1Z9C A;  1LDD A;  1PP7 U;  1MMG A;  5TGT A;  1HDP A;  3LWF A;  2AHQ A;  4A3D J;  4V2F A;  4XLE A;  1IN6 A;  2DFH A;  4UB6 C;  5JLW A;  1CQT A;  2LP0 A;  1OCO H;  4HV5 A;  4C3J J;  4HST A;  5HLT A;  4HNV A;  4HLX A;  3T8T A;  2OCE A;  2MAB A;  2EFO A;  2VL8 A;  3BY6 A;  3TW6 A;  2C6Y A;  2UZK A;  5M5Y J;  2Y2Z A;  2DPU A;  1EJ9 A;  2F4O B;  5LGU A;  2JA7 J;  1IS1 A;  2KZV A;  2B7E A;  2JSP A;  2M8E A;  4I02 A;  4YRV A;  2R7O A;  5ILV A;  4U0W A;  3V7C A;  5B1B H;  3WOD F;  1WWX A;  5D6E A;  2Z3Y A;  5J8C A;  3BG5 A;  2ZB9 A;  3FKI J;  1IRX A;  5C4J J;  1GV2 A;  2R5Z B;  4JX6 A;  4XL9 A;  3JRI A;  2VN2 A;  4F52 A;  4RAY A;  3T1B A;  1FTT A;  4L0Z B;  5D5V B;  4IVN A;  2Y0S N;  2AXT C;  4HX7 A;  4DOZ A;  3A01 A;  4UHT A;  3HOY J;  1YYV A;  2R5Y B;  1FOW A;  3TP3 A;  1H8A C;  3GTL J;  1A6I A;  1J09 A;  2KIS A;  2R93 J;  1W5S A;  3OSF A;  2EIL H;  1XG1 A;  2ZFW A;  5HLI A;  4HAM A;  4JQF A;  3OIP A;  3ZQH A;  4O26 A;  2JVG A;  3FK6 A;  3ELK A;  4G7H F;  2MYS A;  2XPV A;  2L7Z A;  5L3E A;  2JTV A;  4XKV A;  4Y33 A;  5LBQ A;  2CWE A;  2Z2S B;  3QOP A;  4P1W A;  3KFW X;  2BVM A;  4FCY A;  4OIN F;  1ETY A;  1JTY A;  1IZ1 A;  2FX0 A;  3FMQ A;  4C2U A;  3T0Y A;  3BPV A;  2E2J J;  2HPI A;  1X1C A;  1SD4 A;  2IP2 A;  4G8X A;  4HZF A;  1Y1W A;  1ZAO A;  4OYD B;  2P8T A;  1JUP A;  1DUX C;  2Z1D A;  4MEX F;  1EA3 A;  1IXS B;  4FX0 A;  3GCM A;  1IN8 A;  4IHS A;  1D1C A;  1XS9 A;  1K83 J;  2CUJ A;  3KEQ A;  3H9J A;  3JRD A;  3NRV A;  1J5Y A;  2VC1 A;  3E6D A;  2NOJ B;  3TO9 A;  3K58 A;  2KPM A;  2HZT A;  5JR3 A;  2E60 A;  1ETW A;  3GW2 A;  3H35 A;  2BZT A;  5LRS A;  5FGM A;  1YS7 A;  3WE2 A;  3W6V A;  2DA1 A;  1YOV B;  1QO0 D;  2FD5 A;  2GAU A;  2WAQ N;  2XAF A;  4I09 A;  2PQ8 A;  3TOA A;  2Y48 A;  2WAE A;  4NUB A;  5IYD J;  1ZN2 A;  2CFO A;  5H20 A;  2R92 J;  3FXU A;  3L2U A;  4FYD A;  1TWG J;  1CGP A;  2O03 A;  2HS5 A;  1JUM A;  1FYM A;  1YJN I;  3OIO A;  2EV6 A;  5CPR B;  5KNL A;  3K2Z A;  2DFE A;  3QU3 A;  4YEJ A;  3X2Q H;  2M0M A;  4ZDO A;  3Q3S A;  3JRF A;  2VBZ A;  4BE1 A;  5LHH A;  2R7V A;  4GXO A;  1K6Y A;  1KGS A;  1D3Y A;  2XAG A;  2PLY A;  3GTO J;  4V19 K;  3OS2 A;  4ZYD A;  2H27 A;  2BOL A;  4NC8 A;  1SMY F;  4ASN A;  3VYS B;  1Z6T A;  2DDB A;  2QQA A;  4RLQ A;  4NHJ A;  4A93 J;  2K27 A;  4C2M J;  1CF7 B;  3WTW C;  2L4M A;  3PFI A;  2A05 A;  2BW3 A;  3I53 A;  4G94 A;  2RDP A;  4OMZ A;  1YHQ I;  3CQZ J;  3L1P A;  1U3E M;  4Q5G A;  3WG9 A;  1ZRE A;  3WG7 H;  1VQK I;  1BC8 C;  2X48 A;  2NOG A;  4IHT A;  3H3U A;  2CQX A;  3E5Q A;  4ENJ A;  1N78 A;  1V5G A;  4U0V A;  4IX7 A;  1KQ8 A;  2GM4 A;  2IGO A;  2QUF A;  1Y69 8;  2LY2 A;  4C2T A;  3H0G A;  4AVZ A;  1YX3 A;  2Y75 A;  1RRJ A;  2NS7 A;  3ABM H;  1S7E A;  3HB9 A;  2EPF A;  2EB7 A;  2L01 A;  3HRT A;  3KEO A;  2IS1 A;  2HOA A;  2X6O A;  4G6D A;  3VFZ A;  2R7Q A;  1DPR A;  1W5C C;  2DMN A;  2QWW A;  1GXP A;  1S9H A;  3W3C A;  2LDU A;  3REO A;  3A0B C;  1PP8 F;  4HF2 A;  2HVR A;  4BAY A;  2JRM A;  3E0J B;  3B6A A;  1YJW I;  5B66 C;  1T0F C;  4DNC A;  4KIG A;  3FIS A;  5K7Z A;  4BY7 J;  4CCO A;  1Z05 A;  2DBB A;  4DGW B;  4JX5 A;  3K57 A;  3QU6 A;  2W85 A;  3L2V A;  5E8G A;  3CJT B;  5FKO A;  3DEU A;  4M3G A;  2VQG A;  1JJ6 C;  2QKL B;  1X3U A;  2VT2 A;  1ZGA A;  5IT3 A;  3FZV A;  3NWS A;  1AKH A;  3BOQ A;  3GZ5 A;  4CCM A;  2DK8 A;  3IH2 A;  4UXN A;  1R23 A;  1ZLK A;  1WRJ A;  2PG4 A;  2ZXJ A;  4G6T B;  2VXD A;  4PFO A;  2F5F A;  2V4J C;  4PDK A;  4P55 A;  1NK2 P;  3AG3 H;  4BEH A;  5D4R A;  2RNJ A;  2V6E A;  3I59 A;  4CYC A;  3OSG A;  2BYV E;  4Q47 A;  1RPW A;  2P4W A;  1H0M A;  2O5R A;  1LB2 A;  2UXX A;  1R00 A;  4BJ6 C;  3SZT A;  3FMR A;  4GYI A;  3GTJ A;  3CCR I;  2JUC A;  3OYF A;  5AIP A;  2RRE A;  1Y6I A;  3J7Y J;  3LOC A;  3MZ8 A;  3EPZ A;  3HGG A;  3TO7 A;  2QEN A;  2CO5 A;  4LG3 A;  1FOK A;  2LRD A;  5GPA A;  2PX9 A;  3DV8 A;  2XUB A;  4Z2Y A;  2M5W A;  2CS3 A;  4EGY A;  4P9U A;  1TWF A;  2DJI A;  3VOD A;  1X1P A;  2BE5 D;  5J1Y A;  4D5F A;  1UHS A;  2VKE A;  3CCY A;  1FIP A;  4EQQ A;  5F0H A;  1B72 B;  3IH3 A;  5FLX Z;  4LLG F;  3JRB A;  1S6L A;  4L9N A;  2GXG A;  5DM7 F;  5C4X J;  1SD5 A;  5LEK A;  1J59 A;  3M1E A;  3FDY A;  3QPL A;  4LIU A;  4Y13 A;  5ED4 A;  2VE9 A;  3MAQ A;  1BJZ A;  3RKX A;  3ERM A;  3K4J A;  1ZAR A;  4A69 C;  3DBH B;  1FBU A;  4XOT A;  3RPU A;  4EMS A;  2EZH A;  1V5E A;  1R5Z A;  1FOY A;  2KFD A;  3GTQ A;  1E3P A;  1TWA J;  4A2U A;  4AIH A;  3L2R A;  1U5T B;  1EH6 A;  2A6T A;  1FOX A;  3CDI A;  1U5T C;  2E1N A;  5K5Q A;  4I98 B;  3K2A A;  3I54 A;  5D5W B;  3GFI A;  1Z67 A;  1SEU A;  1KU7 A;  2L7M P;  2QBY A;  1SVO A;  3ULQ B;  3DTI A;  1FTZ A;  4HLY A;  5DCF A;  1T6S A;  3FHZ A;  2EIN H;  3J80 Z;  1Z77 A;  2DCE A;  4A5N A;  5EDN A;  4XRM A;  4BQA A;  1BC7 C;  1R9T A;  2CQN A;  3CDH A;  4LMY A;  1MJ9 A;  5ICF A;  1ORK A;  1YW7 A;  4DW6 A;  5IP9 J;  2ETH A;  2F4I A;  1YQA A;  2GA1 A;  4DQ2 A;  2DA2 A;  3HUG B;  3DLL F;  4N9I A;  5BOX A;  1BBY A;  5IYC J;  2QF7 A;  3WHB A;  4W97 A;  1B1B A;  1ON1 A;  5ICG A;  4GFQ A;  5D6F A;  3QP5 A;  4ITV A;  1X19 A;  1RC9 A;  3COA C;  4BS9 A;  2AQF A;  1A36 A;  3GTG J;  3LSR A;  5FRM A;  1IRF A;  2KQR A;  3F6V A;  2E2H A;  4HF0 A;  4A5M A;  4UY8 I;  3K1M A;  2KLO A;  4II2 A;  4RGU A;  5GAD J;  3OYA A;  3JRH A;  2MC4 A;  4OAY A;  1UST A;  5D5X B;  2K9M A;  5TRD A;  4A3J J;  1MH3 A;  1L0O C;  3OYL A;  2JQ7 A;  2BHZ A;  2DXI A;  4RAG A;  2NVU B;  4Q4Z F;  2DFF A;  2VBX A;  1ZGW A;  2J5O A;  3PL8 A;  1C0W A;  2X1E A;  2FML A;  2P5V A;  3IKV A;  2A68 D;  4NBQ A;  2R5Z A;  3C2B A;  1DD5 A;  3FBI B;  4DYR A;  2GOX B;  1KU3 A;  4HDV A;  4BJ5 C;  1UAA A;  1Q1V A;  4OIR F;  2VPL A;  4EJW A;  1D1B A;  2FBI A;  4BJT A;  4IHW A;  5C9H A;  1XTA A;  5B3S H;  3OS1 A;  3TDZ C;  4LIT A;  2LH9 A;  1L3L A;  3EDP A;  5LFA A;  3RDI A;  3B73 A;  1QVT A;  1MBH A;  3RYR A;  1SFO J;  2RQP A;  4U87 A;  1ZLJ A;  4FE4 A;  5J3L A;  4PCQ A;  4C9Y A;  3Q0U A;  2V1D A;  1JTX A;  2ZSI B;  3ESW B;  3NQO A;  3H9Q A;  2W82 A;  3OYI A;  3ZMS A;  3Q0V A;  4CA0 A;  2V79 A;  2WY8 Q;  3K4N A;  3I4N J;  1FBS A;  3G73 A;  1YIT I;  5E79 C;  3FXR A;  1AWC A;  1T98 A;  2ZO4 A;  4A3K J;  3OYN A;  3PO2 J;  3BTC A;  1E17 A;  3L9F A;  3WTY C;  2HXI A;  4FXD A;  3MKY B;  4XN0 A;  5CVI A;  2HYJ A;  2BE5 F;  5B1A H;  1GT0 C;  5E1W A;  3NEU A;  3HOX J;  1X2M A;  2L7F P;  3W6K B;  1R4M B;  3IRQ A;  3LQQ A;  1R4N B;  5CVV A;  3ZXS A;  3HL2 A;  4BQN A;  2H1K A;  5CQE A;  2BXY A;  2LF7 A;  3SZP A;  3CCJ I;  4ETS A;  3DBR B;  4IHY A;  4KN7 X;  3RJP A;  4U0Y A;  2EH3 A;  1ZRD A;  3S1M J;  1GVJ A;  4KN4 X;  4G7Z F;  1JKO C;  2DA5 A;  4I0B A;  1EH1 A;  3CO7 C;  1Z7L A;  3U2R A;  3JSO A;  3F23 A;  1A31 A;  3AKZ A;  2L9N A;  4H4K C;  2HOE A;  2RC4 A;  5H6R A;  3WTU C;  5L3G A;  1NK3 P;  1YS6 A;  1BA5 A;  2HU9 A;  3A03 A;  3ZP5 A;  3PFY A;  5HDG A;  2LG4 A;  4QIW A;  2EQR A;  1WH5 A;  1Z3Y A;  1DQU A;  1TZL A;  3VB2 A;  2HKO A;  3H3Z A;  4MO7 A;  3GFL A;  2L3D A;  2HYF A;  4KMU X;  4XLN F;  1CF7 A;  3L2W A;  4RAZ A;  5FFX A;  1Z91 A;  1MSF C;  2JA5 A;  5CKT A;  2CG4 A;  2BW3 B;  4LK0 F;  5KK1 A;  3IRR A;  1MIU A;  1HW1 A;  4XN3 A;  2DN0 A;  3HPG A;  1ETK A;  3HBL A;  4ZYA A;  3SFZ A;  4EJV A;  5MLC 9;  2YX4 A;  1X4O A;  2IBD A;  1WJE A;  4X0G A;  4TV7 A;  2K4B A;  1KA8 A;  3UR3 C;  2IA0 A;  4EEF G;  3JAM Z;  2IVM A;  3F6O A;  3WTV C;  2IAI A;  5J1R A;  1IXC A;  1WHU A;  4NOL A;  4OU0 A;  3ZGK A;  2XVC A;  4IKF A;  2HYG D;  4D7M A;  4YFX F;  1BW6 A;  4DBR A;  1DPU A;  3BR3 A;  2ZME B;  1LEB A;  4XMY A;  1VFC A;  2A3S A;  2CMP A;  2ZME C;  1ZGJ A;  2LF8 A;  1T39 A;  3DU6 A;  1TLH B;  1SFX A;  1J7K A;  2IGM A;  3VYU B;  1OR7 C;  2JA6 A;  5F08 A;  4YEL A;  3SHF A;  3CZ6 A;  5HOD A;  5EZH A;  2F4Q A;  2E71 A;  5IYB J;  1T0F A;  2ID6 A;  2VJ4 A;  2OTJ I;  2M8G X;  1JE8 A;  1IJW C;  2A68 F;  5JFR A;  4NOK A;  4JOM A;  3C2H A;  2RN7 A;  3M7G A;  4M9S A;  1WJB A;  2P6T A;  2XC7 A;  2PEX A;  4HOB A;  1Y1V A;  1RZ4 A;  5AON A;  3RCO A;  1WQH A;  2L4A A;  4R79 A;  5IT9 Z;  5CQG A;  1XDS A;  2MFZ A;  3HKZ A;  4QTR A;  2M3A A;  2QSH X;  3FXK A;  3IKT A;  2XSJ C;  4A3B J;  2FOW A;  5ERI A;  1WPK A;  3QOD A;  5FRN A;  2YU9 A;  3RTR A;  2D1H A;  1YIJ I;  1IV6 A;  3HSF A;  3MKZ A;  3RQ4 A;  4GCV A;  1QZZ A;  2GIZ A;  3FXQ A;  3HSE A;  1Z6R A;  4D5C A;  3CO6 C;  3CP8 A;  4B09 A;  1JKR C;  2H6B A;  2FBH A;  2GLO A;  3Q9V A;  2VXZ A;  4S05 A;  4IEJ A;  3FMS A;  2H1L A;  4CXF A;  1O7L A;  5E3M A;  1IDY A;  2Z9O A;  4FTH A;  2DA7 A;  3LL7 A;  1TWC A;  4PK4 A;  2EFQ A;  3V42 A;  5EGO B;  2HPM A;  3LNQ A;  2H6C A;  3JAM K;  4HNT A;  1WI9 A;  2E5Z A;  2R3S A;  2W25 A;  2DOE A;  3QRF F;  1A6Q A;  3O8G A;  5H6Q A;  1TL8 A;  2CQK A;  1IN7 A;  4ENK A;  4CHU A;  2BVL A;  2LD5 A;  4WCG A;  2QM3 A;  1I1G A;  3HJE A;  4Y15 A;  2R7Z J;  1R1T A;  5EEA A;  1E3O C;  1WKM A;  3H5A A;  3FBN B;  1S5L C;  3D5L A;  1VQ4 I;  2IS2 A;  1TWF J;  1VZ0 A;  3JRC A;  1X2N A;  1OYY A;  1U2W A;  4CYD A;  2CUF A;  2PI0 A;  2IS6 A;  4MFD A;  1MBG A;  2KJB A;  5J1U A;  1ZR4 A;  4AYB N;  2XGD A;  4L0Y B;  2LKX A;  4BUP A;  3CP2 A;  6PAX A;  4IJA A;  1MZB A;  2JZY A;  4XLA A;  4H0E A;  1DGR M;  2LKP A;  1BOB A;  2E35 A;  2EBI A;  4K2E A;  1LPQ A;  2DLL A;  5DDG A;  3CJN A;  2DTZ A;  5JLX A;  2RNG A;  3HOU J;  4HPQ A;  1Y56 A;  1B6A A;  2DYR H;  1U5T A;  3CLO A;  4XLC A;  5BNG A;  1TTY A;  3DWL E;  4PZJ A;  1PJR A;  4W1U A;  1P4W A;  1OCP A;  3F8C A;  1FZP B;  5DD4 A;  1UHW A;  2OA4 A;  5J40 A;  2DPD A;  3OY9 A;  3CMM A;  2DA3 A;  4A0X A;  1X58 A;  1MIJ A;  1W5T A;  3GTQ J;  1GV5 A;  2LRE A;  5HNH A;  4XLH A;  2QBY B;  1JHH A;  5FD5 A;  2OC6 A;  2HGC A;  2EZK A;  2QSG X;  4ZDL A;  4IOA F;  1DP7 P;  2KKO A;  4II3 A;  4GYG A;  2XAS A;  1XSX A;  3R0J A;  3SEZ A;  3R0A A;  3IAS 2;  1FSH A;  5GTH C;  5HS9 A;  2LYC A;  3HUG A;  3BLY A;  2LSO A;  4IRG A;  3U9G A;  4KUM A;  1STZ A;  1W1W E;  5J4Y A;  3GME A;  3PIP F;  3ML6 A;  3L2C A;  2OBP A;  1BI0 A;  3I64 A;  1QVU A;  4OMY A;  3OYH A;  4LB5 A;  3S3O A;  1Y0N A;  2MC3 A;  2IGN A;  4NB5 A;  3LAP A;  2DT6 A;  3DKY A;  4IPA A;  3HPH A;  4P5O A;  4PJ0 C;  2WB1 A;  1VQ8 I;  2O6G E;  4O3M A;  2F48 A;  2RGV A;  1RUO A;  1S3J A;  3KZY A;  1RI7 A;  2VJJ A;  5F1J A;  1Z1D A;  4UV8 A;  4HX8 A;  1IDZ A;  2RVC A;  3LFK A;  2OQG A;  3GTM J;  1HSJ A;  1IXR C;  4YII A;  2GZW A;  1YX5 A;  3FHN A;  5FB2 A;  1VQ6 I;  1S7A A;  1U0J A;  3CC2 I;  3BWG A;  5D8K B;  1SFE A;  3OYG A;  4B4C A;  1KQ9 A;  3NAU A;  5FKL A;  2BHY A;  5ILS A;  2VOD A;  1VTN C;  3SFI A;  2XAJ A;  2K9S A;  5JHU A;  3R4K A;  4IHV A;  3MCZ A;  5LHI A;  2UWM A;  1YW8 A;  5EYR A;  4B43 A;  3HHG A;  2ICW G;  2ZJ2 A;  1WSU A;  1OFC X;  2Y69 H;  2VUM J;  1HF0 A;  4C3I J;  1AOY A;  3PUB A;  3PNY A;  2LKS A;  3VYR B;  1UEL B;  1I3Q J;  1RNL A; 
#chains in the Genus database with same CATH homology
 2V4J C;  3OYB A;  1LDK B;  3SEQ A;  1R6R A;  3D5S C;  4NNJ A;  4BEH A;  2V6E A;  2O5R A;  4AN8 A;  1WJC A;  3E1S A;  4ZDP A;  4OAZ A;  2ZSH B;  2K3P A;  3OYC A;  4BJ6 C;  2CV1 A;  1I6V D;  3GTJ A;  3OYF A;  3BG7 A;  3P9A A;  3ZRG A;  2RRE A;  2A5W A;  1Y6I A;  3VSL A;  3EPZ A;  3S93 A;  3LSH A;  4XKW A;  1K83 A;  4LG3 A;  2CW8 A;  2LRD A;  3S3M A;  3CF2 A;  4CCL A;  2B63 A;  2M7B A;  1T95 A;  3TMO A;  3BC8 A;  2CS3 A;  3LFU A;  2NVY A;  1WQF A;  1ZEL A;  2HQA A;  2R7T A;  3W2A A;  1TWF A;  2DJI A;  2BE5 D;  1RR8 C;  2GOM A;  3LSM A;  1TGO A;  3UNG C;  3QOE A;  4BU2 A;  2DT7 B;  4E7J A;  4XM3 A;  3MKW B;  2A69 D;  2F6C A;  4PJJ A;  1T8I A;  2M7A A;  1FMV A;  3CJR B;  4IQ4 A;  3D5R C;  3DU5 A;  3HC7 A;  2CUZ A;  2WY7 Q;  2Z16 A;  1PYV A;  3FDY A;  4LIU A;  3A1Y A;  3MAQ A;  1EK8 A;  3K4J A;  2LBF B;  2ELJ A;  2JA2 A;  3W2W A;  4XOT A;  2WBM A;  1K4S A;  3CJQ B;  4HSR A;  4KB2 A;  3LHP S;  3OR1 C;  1WJ5 A;  1V5E A;  3OIQ A;  1R5Z A;  3GTO A;  2Q1Z B;  1G59 A;  3A4C A;  1WJD A;  1TWA A;  4RLF A;  2VLA A;  3L2R A;  1YNN D;  3GTQ A;  3RSN A;  2L5Q A;  2A6T A;  4BDZ A;  4E7K A;  4C2M A;  3DQV C;  1D0Y A;  2PJR B;  2A6E D;  2WAF A;  1NG6 A;  3G2B A;  4F91 B;  4XOP A;  2LY1 A;  3K5O A;  1SEU A;  3DTI A;  2E2I A;  3CQZ A;  4CZC A;  2Y0S A;  1MMA A;  4BQQ A;  3F9K A;  3OYE A;  2VIX A;  4DBQ A;  4GRI A;  4J01 A;  4BL0 B;  2DCE A;  3DLA A;  3OS0 A;  4IQJ A;  1R9T A;  2XF6 A;  4F55 A;  3AL0 B;  4IZZ A;  4N4N B;  3KEY A;  2KL4 A;  4BGD A;  1MND A;  2R7R A;  3AL0 C;  3EUH C;  1GE9 A;  2F4I A;  4PJM A;  4DIQ A;  1NG7 A;  3HUG B;  2CW0 D;  4HG2 A;  3ONQ A;  2WAD A;  4B48 A;  4Y4R A;  2IS4 A;  3GBG A;  4GFQ A;  1N77 A;  4ITV A;  1X19 A;  1MNE A;  4BS9 A;  4BQO A;  2AQF A;  5HNF A;  1A36 A;  3GTG A;  5FRM A;  2KQR A;  4N4O B;  2E2H A;  3SDB A;  4CUG A;  1GLN A;  2KLO A;  2VJ5 A;  4II2 A;  2JVH A;  3OYA A;  3M1C A;  3A2K A;  2MC4 A;  3OL4 A;  4OAY A;  2IXS A;  2K9M A;  1WJA A;  2NVX A;  3OYL A;  1X1D A;  2DXI A;  3BG6 A;  5HVQ C;  3K59 A;  1IW7 D;  4ZJZ A;  3DPU A;  2DOA A;  2X1E A;  3DPT A;  3PL8 A;  3VWB A;  4KIS A;  2A68 D;  1DD5 A;  3FBI B;  1MMD A;  2GOX B;  4OWR B;  4PSW A;  1Q8I A;  3LF9 A;  3GTP A;  2L2O A;  4BJ5 C;  4AYB A;  1UAA A;  3OYM A;  3IAM 2;  2VPL A;  2XAU A;  1I50 A;  1R49 A;  2IGK A;  3KYL A;  1D1B A;  1W36 C;  3L2Q A;  4E7H A;  4BJT A;  3K6G A;  5C9H A;  4B44 A;  3H5R A;  4KC6 A;  4BDY A;  2R7X A;  4B47 A;  3OS1 A;  2A6H D;  2UUZ A;  3K5N A;  4LIT A;  2LH9 A;  3OOU A;  5LFA A;  3ZR8 X;  2E5N A;  4MLO A;  1BR1 A;  1SFO A;  4D9J A;  4D1Q A;  4U87 A;  4LMO A;  1D0Z A;  4C9Y A;  4L8I A;  3DTE A;  2W7N A;  3DKX A;  2ZSI B;  4ZTF A;  3H9Q A;  2W00 A;  2O5J D;  2W82 A;  3AFH A;  3OYI A;  4BE0 A;  3CES A;  4CA0 A;  4BEH B;  2WY8 Q;  3K4N A;  2K9L A;  3K10 A;  2K5C A;  4CH7 A;  2X1D A;  2FUG 2;  4HNU A;  3IAY A;  3MD2 A;  4QPQ A;  4HRI A;  2HDW A;  3DTK A;  4Y3O A;  3OYN A;  5JSB B;  3HOT A;  3K4B A;  3EUA A;  3S3N A;  3K5M A;  3MKY B;  4FXD A;  4XN0 A;  1Z21 A;  4XON A;  1P9Q C;  3NWT A;  4NOM A;  2VQL A;  3QYB A;  2VB6 A;  3GTK A;  3S8P A;  4CCN A;  3SJR A;  2MD0 A;  3ZXS A;  3HL2 A;  2R7U A;  4BQN A;  1LVK A;  2VQH A;  4E7I A;  2M4K A;  5CQE A;  4E7L A;  4KJZ A;  1D1A A;  2P0W A;  5KCM A;  4EAT A;  1WJF A;  3EUK L;  1NH3 A;  3K5L A;  3K4K A;  4RM3 A;  2E1M B;  3FKJ A;  2E1M C;  4E4H A;  4FGU A;  2UV1 A;  1EH1 A;  1WFX A;  3ZCO A;  4KAW X;  1Z7L A;  3BCA A;  1A31 A;  2LBF A;  3AKZ A;  2L9N A;  4H4K C;  2X1C A;  4XLF A;  3K70 C;  3I3L A;  2HVS A;  3VDX A;  1YE9 A;  2HU9 A;  3PFY A;  4QIW A;  2LG4 A;  2XF5 A;  3M4A A;  2X6X A;  3J7A Y;  1Z3Y A;  2L7K A;  1DQU A;  1Z3X A;  5LD2 C;  1TZL A;  4QCL A;  3TBI A;  1SAU A;  4AHC A;  1QHG A;  2ZFU A;  3DPL C;  4BE2 A;  1TWH A;  3VSK A;  2X51 A;  4F3E A;  4KIT B;  3L2W A;  3W2V A;  2JA5 A;  5CKT A;  4F3Q A;  2VJI A;  1SMY D;  3OMY A;  2BW3 B;  3LSI A;  1JI8 A;  1MIU A;  4IP8 A;  4XN3 A;  3HPG A;  4U7B A;  1UG0 A;  4ZYA A;  5JHF A;  3M8J A;  5MLC 9;  1X4O A;  4X0G A;  1WJE A;  3QYF A;  1BR2 A;  3UR3 C;  1A35 A;  2V1N A;  4PUS A;  3PNV A;  4E7S A;  4KT6 A;  2I8D A;  4XNF A;  1MMG A;  5TGT A;  2V7F A;  4NOL A;  3ZGK A;  2QKM B;  4IKF A;  4XLE A;  4DBR A;  1HQM D;  2OUM A;  4XMY A;  1QHH D;  2CMP A;  2XDV A;  4XQF A;  2V26 A;  3DU6 A;  2OV7 A;  2IGM A;  3VYU B;  2JA6 A;  1OR7 C;  4CCJ A;  1WCM A;  4YEL A;  5FRO A;  4HST A;  5HLT A;  1D0X A;  3CZ6 A;  4XR6 A;  1DGW Y;  4ZC3 A;  2F4Q A;  4JLR C;  2VJ4 A;  2MAB A;  2VL8 A;  2F5V A;  1AA7 A;  1ERD A;  5KHD A;  1EJ9 A;  2JA7 A;  2KDO A;  2VAS A;  4NOK A;  4JOM A;  3U21 A;  2KZV A;  3C2H A;  1IS1 A;  4D3Z A;  2JSP A;  1WJB A;  4YRV A;  2XC7 A;  2R7O A;  2WAQ A;  5JSN B;  1Y1V A;  1W36 D;  1TT0 A;  4E7Z A;  2KRC A;  3RCO A;  1WQH A;  4R79 A;  3FKI A;  4PSX A;  1IRX A;  5CQG A;  2R4G A;  3SYT A;  4XL9 A;  2MFZ A;  3HKZ A;  2M3A A;  2CW7 A;  4F52 A;  2XSJ C;  1X4P A;  1MMN A;  3K4M A;  4XOR A;  3QOD A;  5FRN A;  3KX2 A;  3RTR A;  4DOZ A;  2YU9 A;  2JUG A;  3MKZ A;  3RQ4 A;  3OWT A;  2LC2 A;  1J09 A;  2ZXI A;  1BR4 A;  2HVQ A;  2KP6 A;  1X1B A;  3CP8 A;  4XKB A;  2CV0 A;  4JQF A;  2VXZ A;  3OIP A;  1V5F A;  4O26 A;  2JVG A;  2MYS A;  2R7S A;  4XKV A;  4Y33 A;  3S32 A;  3IP4 B;  2Z2S B;  4P1W A;  1SFK A;  4D3Y A;  2BVM A;  3LL7 A;  1TWC A;  4PK4 A;  3I9V 2;  3PNT A;  3V42 A;  3OL3 A;  2HPM A;  4C2U A;  4HNT A;  2E5Z A;  2HPI A;  1X1C A;  4CCK A;  1Y1W A;  4QPO A;  2X85 A;  4OYD B;  1E0E A;  4EJ3 A;  2M4G A;  2Z1D A;  4RM2 A;  1EA3 A;  3K4C A;  3TL4 X;  1TL8 A;  3OR2 C;  2BVL A;  4NQW B;  1D1C A;  2R7Z A;  3HG9 A;  2CUJ A;  3K4L A;  4NC7 A;  4Q5V A;  3H9J A;  4PFP A;  2W1O A;  4AU7 A;  2PMZ A;  3FBN B;  3H5A A;  2CH0 A;  2NOJ B;  3K58 A;  3DEE A;  4DJA A;  3D5L A;  2KPM A;  2KMU A;  2LOO A;  2E60 A;  3H35 A;  3PSI A;  2IS2 A;  2XF7 A;  1VZ0 A;  4HEA 2;  2IS6 A;  1LFP A;  4H3T A;  3OYJ A;  3BCB A;  2R92 A;  2WAE A;  1KON A;  4NUB A;  2CFO A;  1TWG A;  4F93 B;  3L2U A;  3K70 D;  4BUP A;  4FYD A;  3CP2 A;  1LKX A;  2AQE A;  3ZQQ A;  4XLA A;  3RPU D;  4PJN A;  1DGR M;  1BOB A;  2VKH A;  5CPR B;  4C30 A;  5KNL A;  1LPQ A;  1I3Q A;  4YEJ A;  4RMN A;  2RNG A;  3SZG A;  2Q2E B;  4HPQ A;  1Y56 A;  2M0M A;  3MMY B;  4ZDO A;  1WQG A;  4KB4 A;  4XLC A;  3DWL E;  1PJR A;  4BE1 A;  2PJR A;  2KHM A;  2R7V A;  4PJL A;  1ISE A;  3LMM A;  2RQQ A;  1K6Y A;  4CSW A;  3OY9 A;  4LIV A;  3CMM A;  3OS2 A;  2BOL A;  4NC8 A;  4J00 A;  2B9S B;  2ZXH A;  2LRE A;  5HNH A;  4XLH A;  4PFO A;  3VYS B;  4RLQ A;  2OC6 A;  3C2G A;  2L9S A;  1SC7 A;  4ZDL A;  3H5N A;  3PJR A;  2BW3 A;  4II3 A;  2X6W A;  2X6Y A;  3HXL A;  3SEZ A;  4XKC A;  4BXF A;  2V9K A;  1V9M A;  3IAS 2;  4Q5G A;  3PSF A;  2LYC A;  3H9G A;  3BLY A;  3OYK A;  4FET A;  5HOO A;  4E6K G;  1FMW A;  3LSK A;  1N78 A;  1HA8 A;  1V5G A;  4IX7 A;  2HZD A;  2IGO A;  3QYE A;  3OYH A;  4BAC A;  2LY2 A;  1Y69 8;  3S3O A;  4C2T A;  3OYD A;  3H0G A;  2IGN A;  4AVZ A;  1YX3 A;  1RRJ A;  2DT6 A;  3WVO A;  1N75 A;  2IS1 A;  3DKY A;  4P5O A;  3HPH A;  2R7Q A;  2WB1 A;  4ANJ A;  1ZYR D;  4FAS D;  2W4S A;  1S9H A;  3W3C A;  2VJJ A;  3GTM A;  2WA0 A;  2HVR A;  3E0J B;  3HOS A;  1YX5 A;  4IP9 A;  1T0F C;  3FHN A;  4KDD A;  4F92 B;  4CCO A;  2KRH A;  1YNJ D;  1U0J A;  4DGW B;  3K57 A;  1DP3 A;  2CV2 A;  3OYG A;  1G8X A;  3L2V A;  1MW7 A;  2VQG A;  2HNH A;  2QKL B;  3IUO A;  2R7W A;  4ZTJ A;  2VKD A;  3N05 A;  1QU3 A;  3LSG A;  3GTL A;  2UWM A;  4B43 A;  3H0D A;  2R93 A;  3NWS A;  2VUM A;  4CCM A;  2VQC A;  1OLT A;  3PUB A;  3PNY A;  1K4T A;  3VYR B;  1UEL B;  4G6T B;  2VXD A;  3VYT B;  4B3X A;  1X1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...