2R4GA

The high resolution structure of the rna-binding domain of telomerase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
261
structure length
250
Chain Sequence
KVIQEKLKPDHPQTIIKKTLLKEYQSKNFSCQEERDLFLEFTEKIVQNFHNINFNYLLKKFCKLPENYQSLKSQVKQIVQSENKANQQSCENLFNSLYDTEISYKQITNFLRQIIQNCVPNQLLGKKNFKVFLEKLYEFVQMKRFENQKVLDYICFMDVFDVEWFVDLKNQKFTQKRKYISDKRKILGDLIVFIINKIVIPVLRYNFYITEKHKEGSQIFYYRKPIWKLVSKLTIVKLEEENLEKVEEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Telomerase reverse transcriptase
publication title Structure of the RNA-Binding Domain of Telomerase: Implications for RNA Recognition and Binding.
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 89
structure length 250
sequence length 261
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1970 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2r4gA02
1.10.132.70 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 2r4gA01
4LMOA 3KYLA 2R4GA 5C9HA 4O26A 3DU6A 3DU5A 5CQGA
chains in the Genus database with same CATH superfamily
2W84A 1I3AA 2GXBA 4XLCA 2GOMA 5HLIA 4N9HA 2HR3A 3LFKA 1E0EA 2XDVA 5DS9A 3W2AA 4XORA 4XRSG 1E17A 1ZTRA 3ABMH 4OIRF 1XGOA 2CV1A 1JKOC 3HTUA 1TT0A 4RB1A 4IHVA 4P55A 3SZTA 2NVUB 4A0ZA 3U2RA 2CWEA 2AXTC 1U6GA 3MCZA 4FX0A 2ELJA 3OYDA 1LB2A 2WV1A 2IS2A 2M9HA 2EFOA 1W36C 3HSRA 4FE4A 4ETSA 2LF8A 4EM0B 2L7KA 1HQMD 2P5KA 1ON1A 2XASA 1SFXA 4E4HA 2CQ7A 5F64A 1X19A 3DKYA 2XAQA 5ICCA 3OYGA 1R9TJ 1H9TA 4PZJA 5J47A 3S15J 3F8MA 3HG9A 1MD0A 1QA6A 4PJMA 3BZCA 1JE8A 2EZIA 2GQQA 2RC4A 4I7HA 1ZG1A 2VONA 2JA5A 2K9SA 2Y0SN 3Q3SA 1OCPA 3OYKA 2R5ZB 4XSZF 4XLHA 5ICGA 2M3AA 2VB6A 5M5XJ 1ZQ3P 5K5QA 4M9SA 2EIKH 4ENMA 2M30A 4KN7X 1H88C 2CH0A 1R1TA 3S1MJ 4PSXA 4KB4A 2E2IA 3CUQB 4B1RA 2X4HA 5FGMA 2LR8A 3FXQA 2R5YA 3BT9A 2XRLA 3ASOH 3DKXA 2HQRA 3GW2A 1W7PB 4AN8A 1YS7A 1EV7A 3GTOA 1GUUA 3ZMVA 3EUHA 2X48A 5FO5A 2HOSA 1W5TA 5HLGA 5LFAA 4U87A 1W4MA 4XRSA 1NG6A 2HQAA 2LOOA 2IGOA 2DFFA 3SFZA 3NWTA 4EJUA 3F8BA 3FISA 1KA8A 1S7EA 2XIGA 5F08A 3BC8A 4KUMA 5F1JA 4BL0B 2BY2A 1U3EM 2KLOA 4II2A 2JA7J 4BE0A 1IN4A 2A05A 4MQVA 4S04A 1X1AA 2UZKA 2OA4A 1V4RA 2YSRA 1UJ8A 3CQZA 2DOAA 1VZ0A 5BMZA 1IXSB 3PM1A 2LKXA 3PL8A 3EETA 2E60A 2GIVA 1FP1D 3AKZA 5HS7A 3K5LA 2HFHA 3JRFA 4DOZA 2HKXA 2WBMA 1KYWA 2EFQA 4UV9A 1ZYRF 1SFOA 4C30A 5F1RA 2BOLA 1E3PA 4L0YB 4YIFA 4BBRJ 4ZDOA 4XLNF 4EGYA 1FYMA 1EF4A 2HZDA 4CYCA 3VEPA 1TTYA 4OMYA 1ULYA 2TRTA 1ISEA 4AIJA 2DTRA 2A6TA 1MMSA 3A0BC 2DAOA 2H8RA 2OU2A 3KYCB 1HBXG 5KVRA 1TQPA 5E3LA 3SJRA 4AIDA 4ANJA 3OYFA 2QVOA 2QQBA 5EG0B 1MIUA 2XKPA 3LQQA 5E18F 2ZJQF 2Y48A 1ORKA 2D1VA 3FDYA 2R5ZA 2Q1ZB 4OMZA 5C44J 2E34A 2QM3A 4A3MJ 4LG0A 3WU1B 2UXNA 5DCMB 2JA6J 5FFXA 2D1HA 3CUQA 2AQEA 2VE8A 1S9HA 2HS5A 2VQCA 4IF4A 1I50A 4FX4A 1U78A 3CTAA 2ZXJA 2JTVA 2OQRA 3I71A 4BDYA 2V6EA 2O9LA 1W7PA 5DUKA 4JP0A 3E6MA 3IKTA 3I3LA 5D6FA 5D4RA 1FOYA 4CCKA 1Y1WJ 5IT9Z 1QHGA 5LGNA 4UY8I 1FJLA 2L7MP 3H5NA 3IH2A 2CG4A 3J81Z 1PJRA 2F6CA 2JPCA 2ZMEB 3DPLC 1HW2A 5DD4A 2EPFA 1FLIA 2FJ1A 1Y1VA 2R93A 2M1BA 1BC7C 1IGNA 2MC3A 2WA0A 4NQWA 5HDGA 3KEOA 1VQKI 3H9GA 2JMWA 1AU7A 2BY1A 4D5FA 2R7UA 4B09A 4BEHA 2CV0A 2QENA 2IGNA 5HVQC 4L5EA 5DD8A 3BR5A 1ZREA 4OWRB 2KPMA 3OV8A 4WXCA 4XN0A 1J09A 3PQJA 4G12A 5CVUA 2VBZA 2KZGA 2JRTA 3RKXA 3D1NI 1YW9A 4IO9F 4NC8A 2WADA 2P7VB 4I98B 3ROUA 2DI3A 3ZGKA 1XG1A 4KFCA 2DDBA 4GFBA 4D7NA 3MEXA 1HKTA 2V9KA 1A5JA 3W2VA 4MFDA 3CDIA 3HRUA 3KPHA 2DT5A 5F0HA 1WI3A 1K6OA 4OIOF 1XGMA 2KISA 2BEOA 3OMYA 5CYVA 2HEOA 3J80K 4HEA2 3L09A 3OYMA 3GZ6A 2DYSH 4P9UA 2FQ3A 4M6XA 2XVCA 3IL2A 1VQ4I 2DQRA 2ICWG 1DP7P 3WU2C 3OYBA 2ZJRF 2NVQJ 3E5XA 2XGCA 3UR3C 3FK6A 1GHCA 2DA5A 1TGOA 5DCMA 3IP4B 2XAUA 1D3YA 2R92J 4A0YA 2HVRA 1GLNA 4BYYA 3GTKA 4E7KA 3F6OA 5JFRA 2DK5A 4A3DJ 4MHGA 3ABUA 1AA7A 2W25A 5IP6A 5L3GA 1RIOH 3JTHA 2LG4A 1B72A 1P92A 1VQ7I 3GTQA 4C9YA 2WY7Q 2KDZA 1BL0A 4HQEA 2OBPA 2A69D 3L2UA 1O57A 3EUAA 4F7ZA 2GXAA 4Y15A 1TQIA 2DYRH 2IJLA 3JRBA 1B9MA 4HX8A 1HQCA 2QSHX 3EDPA 2FE3A 2O3FA 5FROA 3FM5A 4BNCA 3V8KA 4BY1J 3S3OA 4L9NA 4A0XA 2FUG2 3QU6A 2E1CA 1AOYA 2LK2A 3OIQA 2RDPA 3PIOF 2EK5A 1IJWC 5E79C 4Q5GA 2J5PA 3O3KA 4G7OF 1T08B 5ILSA 3WGHA 5J6XA 5L3EA 4CDGA 2DJNA 1XC5A 3LNQA 1G3SA 5DM7F 5K5OA 2K4JA 2K40A 1YLFA 4HYEA 1E3HA 3P7NA 1FMWA 1BOAA 3EUHC 1U9OA 3PUFA 1UELB 5ERIA 1JKRC 2RV8A 1P9QC 3SDGA 2IBDA 3FKIJ 3S1NJ 1RZ4A 5TISC 2UWMA 3M07A 2HU9A 3A03A 1EH8A 2VJJA 4BS9A 2HYGD 3BR6A 2MH9A 2JVHA 3HZJA 4IPAA 5IYDJ 4M71A 1MMNA 3RIRA 5LBQA 4LGWA 2STTA 2Q0OA 4ESJA 1YITI 3D5RC 3FXMA 1XGSA 1S6LA 1XX5A 5B5EC 3PSFA 2EZKA 4QWQA 3PFYA 2HWVA 1TQMA 3LHPS 2VC1A 5HLTA 4DQ2A 4J19A 1N77A 2EV0A 2XAHA 2PJRA 2KMUA 4J00A 3CJQB 2O61A 1D1CA 2CW0F 3BZKA 5FRMA 2A6EF 3HL2A 3FXOA 3CD6I 1T6SA 2ZC2A 4II3A 5HNHA 5D5WB 3GTJA 5LRSA 1A04A 4FE7A 4I99C 4UXNA 2RVCA 1IO2A 4Q4ZF 5HDKA 2KIMA 5LHIA 1ZRFA 4AM3A 1ZKGA 4LK1F 2ZB9A 3HGGA 1BW6A 4AD9A 4GDFA 5D5XB 4AYBA 3OYJA 3QPLA 3GBGA 5D6EA 4GGGA 2IA0A 2RREA 4OU0A 4EGZA 2X9DA 1P6RA 3K70D 4Z6YA 3QODA 4BHCA 3N97A 1MDMB 4DJAA 3DEWA 2DN0A 1TP4A 1X1PA 3BG7A 5M3FJ 2HQ5A 1WQ2A 3CESA 2HTJA 2NXNB 4YIIA 3LAJA 1ETKA 4O5VA 1QHHD 4C2TA 1R6RA 2EB7A 3N05A 4AHCA 3F72A 2LY9A 3R61A 4EJVA 3M9AA 1V5EA 2F5EA 4P9FA 2ME0A 2F5VA 4G9YA 3CUQC 1D0YA 3BJ6A 3DFGA 2JA6A 1ZH5A 5JVTA 3K2ZA 1YRNB 1L0OC 5BNGA 1AKHA 4PFOA 3GX4X 1B1BA 3CLQA 1H89C 2UXXA 1KQ9A 4MIMA 5TRDA 5JVGF 2VJ5A 1K83A 1GXPA 3HRTA 2ME6A 4UUSB 3S93A 2P7CB 2HPIA 2K4BA 3ABKH 2IS4A 2Z3YA 1UFMA 2FMYA 3GTPJ 3BCBA 2FBHA 3GTLJ 2GIZA 2I5UA 4XRMA 2X1DA 1ZLJA 1T2KA 3GXOA 4JX5A 2QYOA 4FT8A 1YS6A 3D0SA 2WAFA 2V79A 1Q8IA 3SFIA 3K4MA 3LSMA 9ANTA 4EATA 1T8IA 2XRNA 1VQNI 1FP2A 5L3FA 3M8JA 3DPTA 2PLYA 3VB2A 4LLLA 2JUGA 1ETOA 3LL7A 5DDGA 2O5RA 2QQ8A 5FRNA 4KA4A 1OR7C 4QSHA 3IRQA 3G4SI 3JRAA 2L5QA 1F5TA 2F5CA 3QYBA 4Y4RA 3ZXSA 3MD2A 5FD6A 2LC2A 3K59A 2PJPA 4V19K 1FT9A 2KL4A 2DPDA 3CDLA 1F1ZA 1T95A 2DPUA 4XSXF 4LK0F 2BBYA 1MZBA 5B66C 3AL0C 3G73A 1S7AA 1TWFJ 1TWHA 2XF6A 1MMDA 5KAIC 4FGUA 5KNLA 1JTXA 1G4DA 4IL6C 2NNYA 1P4WA 1T56A 3W6VA 3E0JB 3KP6A 4B44A 2OTJI 2ECBA 2X85A 2GBYA 3GEZA 2GLOA 2RQPA 1WGXA 4AIKA 3TP3A 1T0FA 1ZR2A 4BJ6C 1YQAA 1QGPA 1YJ9I 3IV5A 5H6QA 2K7LA 4KNYA 3MWMA 4JK1X 3RZDJ 2QA4I 1Z77A 4HV6A 2ZNZA 3FF5A 4AWXB 4H3TA 5F0CA 1Y0NA 2FD5A 1U8BA 4DZJA 4MTEA 3ISPA 5K5RA 2CFXA 1CF7A 4IHWA 1T33A 1SVMA 3RTRA 2L9NA 2VE9A 1VQLI 3M1EA 3I4MJ 2E71A 1FZPB 1OFCX 1Z21A 2ZMEC 3HRMA 4G8XA 4IOAF 2QWWA 3HOUJ 2E1MB 2ZFWA 3FBNB 3UNGC 4P1WA 1ZARA 3DEUA 5C4JJ 2O0YA 3WTZA 2IA2A 1HOMA 4DYCA 4FCYA 4D9JA 1LKXA 1LQ1A 1ODDA 2GZWA 3IC7A 2QLZA 3OYIA 3V4GA 2AO9A 1SMYF 3HM5A 2XGEA 3SYTA 4HG2A 2D2WA 5EEHA 1FC3A 2KIFA 1FEXA 4I0AA 4PJ0C 3OYEA 1DU0A 4BQQA 4ENJA 2V1DA 4FYDA 2XUBA 1RC9A 1Y8QB 3RSNA 2EJRA 2KT0A 2P6SA 1QRYA 4BKXA 1YNJD 2VQLA 2XF5A 3BTLA 2XKOA 5CKTA 5TJJA 5F04A 1X1BA 2CJJA 2FMLA 2HQNA 2R7ZA 3HOYJ 3O8GA 2KKOA 2LBFA 4J01A 4GRIA 4KB2A 2COMA 3DTKA 1R5GA 3MMYB 2H1KA 4HW0A 4FTHA 3FKIA 5FFZA 1Y6IA 3DP7A 2O6GE 4HPQA 5IY5H 5IYCJ 4G6QA 1R5ID 2Y75A 3C18A 3GLLA 3S16J 5L3DA 4WK8F 2JSPA 4JOMA 1P4XA 1RUOA 1VQ5I 1IRGA 2XAJA 3K58A 2R5YB 1VNDA 1Y56A 2E1NA 2FOKA 3E6CC 1VQ9I 2STWA 2A6HD 4CA0A 4Z2YA 4B47A 5IT9K 3S17J 4I02A 4KIGA 1EK8A 3UKGA 1PDNC 4XQFA 3JW4A 3J81K 2NOGA 4NOMA 4MO7A 2Y9YA 4A3IJ 1JKQC 3BG5A 2Z2SB 2H09A 3K1MA 1HLVA 3ZMZA 4KDDA 2DT7B 2DTZA 3WG9A 2E2JJ 1FSHA 3RCOA 1IRXA 3FXRA 1LVAA 1UG0A 3QPHA 2JWTA 1J59A 4C2UA 3N4MA 1BW5A 5GADJ 3P9AA 4D5CA 2OV7A 2DMQA 2IT0A 3U9GA 1TWCJ 2Z1DA 3AG4H 3LA7A 2G7UA 2K9QA 3VYTB 4QCLA 1FBUA 2QQAA 2M87A 3K5MA 1MJBA 3WODF 3WG7H 1USSA 5FD5A 2LKPA 4NOLA 1BBYA 1FTTA 5JHUA 4HAMA 3LAPA 3HSFA 3JRHA 4C3IJ 2HXOA 2XPUA 5L3CA 3J7YJ 3MZYA 3KX2A 2EIJH 2M5WA 1ETQA 4CYCB 1SAXA 2Y2ZA 3NQOA 2VBXA 4KICA 4PGHA 3JR9A 2YX7A 1IDZA 3ZQFA 4JYKA 3REOA 4EJOA 2DA4A 3TBIA 1ZK8A 4QTRA 3O8HA 5GAHJ 2R7OA 2NVYA 1MJ9A 2F4MB 2RNGA 4HX4A 1X1CA 5GPCA 5D5UB 1N25A 2JJ7A 1FYKA 2NOJB 3L7WA 2IAIA 2IS6A 3LFUA 4HSTA 2HXIA 3FXKA 3K1PA 4ZZLA 2CV2A 3O2PE 2AQFA 2NS8A 2X6YA 2CGPA 4BH9A 4LG0B 3HHGA 2I10A 3ZMUA 1PYVA 1IC8A 4Q5VA 3KP2A 1BJAA 1VQ6I 4ZYEA 5HOOA 2JK3A 3DXJF 4XL9A 3U1KA 1IAWA 3ZQLA 2HYJA 3H0GJ 1WPKA 2EZHA 4Q47A 4OYDB 2H1LA 4HA8A 5E8GA 1T38A 3OYNA 3KYDB 3R4KA 2FNAA 1Z67A 3EUKL 2VOPA 3C3WA 2M8GX 1N75A 2CMPA 2IP2A 2JPBA 2VOOA 2NAZA 1MIJA 4ZC3A 3S1QJ 3Q9SA 5ICEA 1WJBA 4ZYGA 1MNDA 3CCJI 4IHTA 1EKEA 2L54A 4DW6A 1JI8A 1WSUA 2V6CA 4U0WA 3S2DJ 2E5ZA 4NQWB 1O3RA 1POGA 1TWGJ 1HCRA 1Z3YA 5GAGJ 3M4OJ 2RQQA 1J2XA 3SZGA 2Z5UA 2PMZA 1MBJA 3M8EA 4GFQA 1IW7D 4CHUA 4S05A 4BEHB 3ELKA 1WQGA 3C7JA 1FOKA 2OQGA 2OAZA 4M3GA 3C2BA 4FHTA 4RS8A 1JGSA 2KIQA 3K0LA 3CO7C 1GVDA 3JAMZ 2ISZA 3BP8A 5AONA 2DMUA 2IXSA 1XDUA 3DV8A 4HSRA 4MLOA 3FHNA 2L2OA 1TWFA 1FTZA 4L9TA 1J5YA 2YU9J 1QPMA 4N4OB 1FIAA 3F6VA 1RR7A 1ZRCA 3JSPA 4IP9A 3NARA 2G7HA 1DPUA 1FX7A 2KRHA 4L5IA 3X2QH 2CSOA 5ED4A 2Q2EA 5CQGA 3OIOA 2M34A 1P2FA 1O7FA 3K2AA 3SHFA 1BR1A 3BDDA 2HVSA 3JTGA 1X3WB 2MG4A 1K79A 4BXFA 3OSFA 5KCMA 3ZQIA 3AL0B 1R1UA 1U5TB 2P81A 1J7KA 3TP0A 3HXLA 2RN7A 1U2WA 2RKHA 3IHUA 3T1BA 4B43A 4D3YA 1TWAJ 5FKMA 2ZJPF 3G71I 1O4XA 2GOXB 4OOIA 4DIQA 1YW7A 1MH3A 2EA2A 3RKWA 4I09A 4D1QA 2ETHA 2AS5F 3CCYA 3MZHA 2YS9A 1D8KA 1RESA 4E7HA 1QVUA 5BS6A 3S3MA 4XM3A 4PJJA 4G7HF 4XNFA 3VSLA 4BGDA 2HVQA 3CJTB 3A01A 3E7LA 3QRFF 1Z6RA 2M0CA 3GTGJ 4CCMA 2COBA 3TOBA 1B72B 2MFZA 2XF7A 1YIOA 2VASA 2A5WA 2XAFA 3TKYA 1FWZA 2K02A 3OY9A 1Z6TA 5B1AH 4YIRX 5DUIA 1ZR4A 3KLNA 4NC6A 1UG2A 2EA4A 4E7SA 4M3DA 1XCVA 3KYLA 3HOVJ 4C2MA 2VI6A 4RB2C 4N4NB 2B63A 2X6OA 2MD0A 2LD5A 3QYEA 2VBWA 4V2FA 2H94A 3ABLH 4LG3A 3BWGA 2RGVA 4XLPF 2VJ4A 2A68D 1RUNA 5CVIA 2QSFX 3S32A 4E70A 5FLMJ 2G9WA 4W97A 2CO5A 3J7AY 1MBEA 2VKEA 1YW8A 3WTXC 1DP3A 1IN5A 5A2QK 2VC0A 1J0RA 3K70C 4RM2A 3PFIA 3T5XA 2JZYA 5LHGA 3CCUI 3BR3A 1Y0UA 2P8TA 4KIFA 2FQ4A 5EEAA 1VQ8I 1XPXA 2YUSA 1ZG5A 2E2HJ 1LFBA 4A69C 2Z33A 1XTAA 1YO5C 4UUVA 2BHYA 2XHKA 1E3OC 3GFJA 1LFPA 4NHJA 4GO1A 3OL3A 4A3GJ 4E7LA 3LWFA 4CCOA 1EH6A 1U5TA 2XB0X 4QIWN 1G3TA 1BA5A 4HF2A 2I8DA 4ASNA 1GDTA 1D1AA 2PX9A 4FASD 5DYMA 3ZOBA 2LH9A 3S2WA 3BR2A 6PAXA 1UAAA 2E1MC 3BQYA 3ULQB 4BE2A 3EQLF 3K7AJ 4XOPA 2EBIA 3L2QA 3ZMTA 2DMPA 3CO6C 2XPVA 2ZSIB 2PJRB 5E20A 3IUOA 1H9GA 4FXDA 1K61A 1K7AA 1NTCA 1LJ9A 2P6TA 2JSCA 4AYBN 2K9MA 1OYIA 1U9NA 4Y13A 1QO0D 2A69F 2KRFA 2NVXJ 1LDKB 4PJNA 2NS0A 1ETYA 2PG4A 4ZZDA 4IRIA 2ZXWH 3IWFA 2VKDA 2HOTA 1I39A 4ESBA 2FNPA 3KP3A 4H0EA 1W1WE 1MH4A 2W4SA 4GXOA 2FU4A 3OYHA 3ZQHA 2WB1A 3IH4A 4E7ZA 5GTHC 1VFCA 4XOTA 2DK8A 4XKWA 1L3LA 1R9TA 2O7OA 1FBSA 4GYIA 1YG2A 1HKQA 1LPQA 4CXFA 1HW5A 1UB9A 5J4YA 1FIPA 2K5CA 1TNSA 2L7ZA 2IPQX 4NB5A 3PSIA 3JRGA 2NYXA 2WV0A 3CCMI 3WTWC 4RLFA 4F3QA 4B48A 2NVTJ 1JT0A 5IP9J 4CZZA 2WWYA 1ZG3A 2Y31A 1WVRA 2Q8KA 2LVSA 4ZYAA 1OYWA 3BTCA 1A6QA 5EYRA 3VSKA 1FSEA 2EFNA 3BZ6A 5HODA 2HPMA 1K6YA 5LGUA 2BY0A 5C9HA 4BACA 1S29A 1AKHB 4UV8A 2QKMB 3L9FA 2W82A 4M3EA 3LSHA 2E36A 4LIUA 4RM3A 3QU3A 2YU3A 4B8XA 2JQ7A 1S8NA 5M5WJ 1IUFA 5BPIA 1I3QJ 4IKFA 2E7XA 1PP8F 4M6YA 3SEQA 1W0UA 4NNJA 1WJFA 1R36A 2K3FA 3NAUA 1YFHA 2DLLA 3CLOA 4HLYA 2QBYA 4KT6A 1B8IA 4IVNA 1NHAA 3KP7A 4BAYA 4EJWA 1A35A 4L18B 1TNTA 4N9IA 3IAYA 3COAC 1WJAA 2A5YB 4QPOA 4A6EA 2VUMJ 1Z05A 2E19A 2MYSA 3MZ8A 4YEJA 4KITB 2F4QA 2G0EA 1TWGA 3ECHA 3MFKA 4QIWA 3I64A 3HYIA 1I5ZA 4HX7A 1OCTC 5E3OA 2JA7A 4PK4A 1ITYA 3BPXA 4WXDA 2CUJA 1D5YA 4YFNF 1R4MB 4WX9A 1V55H 2MSYA 3AAFA 2W00A 5HDNA 5LEKA 2E35A 5M3MJ 2R7XA 2LFBA 1ZGJA 3FXJA 4UVBA 1MBGA 5DCFA 2X0LA 1R00A 1D1BA 5FKLA 4A3LJ 2R3SA 3G1OA 1FMVA 4IJAA 4EM2A 2OPTA 1SC7A 1S72I 4WXHA 2QGUA 3PQKA 4I76A 2YU9A 1Z9CA 4OIPF 1RR8C 1WH7A 2B7EA 2OJED 1HW1A 2B9SB 4XBFA 2GXGA 1HSJA 2QCOA 2KJCA 4Y7NJ 1I6HJ 3GFLA 2DW4A 3P9KA 5JI6A 4WCGA 3ZQGA 3EPZA 3RPUA 4IX7A 4RAFA 4UB6C 1JXSA 3H1CA 1Y8RB 1N78A 2X1EA 3DPUA 2BE5D 4M74A 2W85A 4G6TB 4A5NA 2K85A 2PBIA 3DU6A 1X3UA 3GFIA 1ERDA 2Y9ZA 2MC4A 3F22A 1R23A 3P5JA 2LRDA 5A2QZ 2FX0A 4EEFG 5KK1A 4PJLA 3ERED 1JJ8C 4NBQA 4NOKA 3FMQA 3BCAA 1DPRA 1R4NB 2M8EA 3KZYA 4HNVA 3BJAA 3LA2A 4F91B 1XB4A 2EV6A 3E5QA 1BOBA 4IRGA 5E1XA 1CF7B 1PVEA 5B3SH 1ZGWA 2CUEA 3HGYA 2MLKA 4G7ZF 3F8CA 3PNVA 1F36A 1IDYA 1KU7A 2VT2A 3H5RA 4E6KG 1Y1WA 3GTMJ 4F92B 1UZCA 3QPTA 3L2CA 1SD7A 2DA7A 3QPSA 3MKYB 1KZHA 2GAUA 2VT3A 2L9SA 2M7AA 4U0YA 3LA3A 3L2RA 2JA2A 2LREA 4B3XA 2PFBA 5GP9A 4AU7A 1CQTA 5EGOA 2CW7A 1R22A 5BQTA 4HBLA 2ZSHB 5E3NA 1PUFA 3Q0VA 5HS8A 2W7NA 4ZH4F 1HDDC 5C4XJ 5K7FA 4ZDPA 4XKBA 4MFEA 3FBIB 2V9VA 2E2IJ 5FB2A 2X6WA 3B6CA 4EV0A 3R0JA 3CMMA 4MNUA 3W3CA 1J75A 3MAQA 3CDHA 2M2EA 4HF0A 3L00A 2CFOA 1USTA 1A36A 2YPRA 3GTOJ 2HGCA 2L02A 3CZ6A 1Z7UA 3CF2A 4PFPA 4G6DA 3RDIA 2E2HA 2LBFB 4RAYA 2B9SA 2Z16A 3M7GA 4I01A 1XMXA 4OAZA 1QU3A 4LMYA 3RYPA 2OD5A 5DV5A 1YJWI 2BYVE 3AG3H 2DA2A 3LSRA 1TLHB 4RA2A 3PO2J 1U5TC 3CCRI 1HA8A 2M4GA 4MEYF 4XICA 4A93J 3E97A 1XMAA 4IHSA 1CGPA 3TQNA 3V8JA 3CCLI 4CSWA 2VN2A 3CQZJ 3WTVC 3K4LA 2H6BA 1WJDA 3T8RA 4IRHA 5B1BH 2VODA 3S1RJ 1SFEA 2CW8A 2R92A 5JLWA 1OCRH 3J7ZI 3H0DA 1I1GA 4F3EA 1G8XA 3K4NA 5JLXA 4Y33A 2CU7A 1SFOJ 2OCEA 3NRVA 1IS1A 2GWRA 1QBJA 1BM9A 2MGQA 3KZZA 3QQAA 3A2KA 4RGUA 1FNNA 2WC2A 5E3MA 2R7VA 3V42A 1SD5A 2MA3A 4BJTA 3EYYA 3I0TA 2HNHA 1TL8A 3RKYA 2PEXA 4BU2A 2K9LA 3DLLF 5ICFA 3U21A 4CCNA 3WU0A 3JAMK 2P0WA 1H0MA 1DDNA 3HPHA 4KMFA 1ZAOA 4BQOA 2F5FA 1UCRA 3HBLA 5J8FA 3E1SA 5DM6F 2DBBA 4LLGF 1JUSA 2H6CA 5FLVA 1J9IA 1DUXC 2O8XA 2W48A 2EIMH 1O3SA 3J7AO 5JHFA 1V9MA 5BOXA 3D5LA 2X1CA 4IXAA 3C1DA 2QEXI 1VQOI 5E1ZB 4LD5A 3LOCA 3OR2C 3OSGA 2HI3A 2MABA 1I50J 3HKZA 3CC2I 2DA1A 5J4VA 4AC0A 2GM4A 3FHZA 5JSNB 1ZGAA 4DNCA 5IPAA 1U0JA 2X51A 5FKOA 3JREA 2DMTA 2P4WA 2XAGA 2A3SA 2UV1A 3ZRGA 4ITVA 2H8WA 2QZ8A 3OR1C 4N0BA 1D0XA 1NG7A 1Y1VJ 3MQ0A 4WWCA 1NH3A 3A0HC 2LP0A 4EMSA 4JBAA 4F93B 5ILVA 3K69A 3OOPA 2FRHA 4GYGA 4LOCA 1D8JA 2A61A 2NS7A 3C2GA 3KEYA 1I3QA 1X3ZB 1BJZA 1JTYA 2DCEA 2OCCH 2ISYA 3BG3A 3F0CA 5FKKA 3HOTA 1LEAA 1WI9A 1WKMA 3H5AA 3WHCA 2A6HF 3P9CA 4CYDA 2A07F 3V7CA 4E7JA 2QSGX 4Q48A 3G3ZA 2DOFA 2KIUA 4KJZA 4RDUA 2MBFA 1G2HA 4XN3A 1K4SA 4DGWB 2LNBA 1YIJI 4PDKA 2W1OA 5MLC9 4HQMA 2ESHA 3OS0A 1P7JA 2PMZN 2TCTA 3I59A 3CC7I 4A3FJ 1YHQI 3RZOJ 1IXCA 4Y52J 2R7RA 3TEDA 3RQIA 1RNLA 3AFHA 4DBRA 3OL4A 2L7FP 4W1UA 3GYHX 1I1SA 3FWEA 1EH7A 4BUPA 2VPRA 2Y69H 2FOWA 2BXYA 5C3EJ 2V1NA 1SVLA 3GWZA 4BXUA 1X4PA 4XKVA 4HNTA 4ESFA 4O6JA 2R7FA 2V1UA 4L9JA 3V7SA 3M4AA 2QKLB 3O6BB 1LDDA 1WFXA 2EFWA 1TT5B 2EV5A 2L4MA 1OQYA 3HB9A 2K27A 4X6AJ 2Z99A 5GAEJ 3FK7A 5AIPA 3ASNH 2KP6A 1FOWA 3BQZA 5DEQA 3PO3J 4XONA 4K2EA 1TBXA 3T8TA 3GTKJ 2R7SA 1WJ5A 3Q0UA 3OS2A 3GMEA 5J1YA 2Q2EB 4BXXJ 1G3YA 2ZKZA 1QVTA 4XLAA 1W5SA 1B59A 4KMUX 3BJOA 1YTYA 3OYAA 2ELKA 2VJIA 4XIDA 2E5NA 1F4KA 1OCZH 1E2XA 3BG6A 3I58A 3GTQJ 1ONVA 1EA3A 2CQKA 3NEUA 1QZEA 3GZNB 5KHDA 4M6VA 1T98A 3WTUC 4CGZA 3BR1A 3BTJA 3GLXA 3A1YA 3Q5FA 2LKSA 1MNEA 4X1EA 3FX3A 3RPQA 2K86A 1TC3C 4M3FA 2EWNA 2O03A 3BY6A 3H3UA 3WHBA 3GTMA 4BHBA 2YX4A 5L3BA 1PP7U 2ZNYA 3GTPA 3GTLA 3G2BA 2WAQN 3M1CA 3VFZA 1MBKA 1SFUA 4HLXA 3ZPLA 4IOCF 2DU9A 3A01B 1IV8A 3WE3A 3E3VA 3ONQA 3SEZA 2HDWA 1QNTA 3OOUA 1Z0XA 3LSTA 3CJNA 3FMRA 3QAHA 4ON0A 4ENKA 4NUBA 2LSOA 1MW7A 3QOEA 2W57A 4ZDLA 1GVJA 1BI2A 1JHHA 1V3FA 1YX5A 4LB6B 3K57A 2EINH 2F2EA 2KRCA 1WQHA 1IW7F 4JLRC 1K78A 3DU5A 1X4OA 1GV5A 1IN7A 1HSTA 1LUJB 4A3JJ 1KQ0A 3Q9VA 1QZZA 1LE8B 4X0GA 4KYWA 1UHWA 2ZXHA 2VXDA 4V2GA 3IWZA 1F43A 4WF2A 5FKNA 4OIQF 1UMQA 3WVOA 2EFPA 1BC8C 2CQXA 2HYFA 5LLQA 2VLAA 1R71A 3S2HJ 2ID3A 1ETXA 4KC6A 4C3HJ 4D7MA 1SFKA 4XRFA 2D5VA 5FJ8J 2IW5A 3L1PA 3JCUC 1Z7LA 2L3DA 3FZVA 2MD5A 1ZLKA 2HDCA 3LSKA 1T0FC 4Q5SF 3ESWB 2BV6A 2M0MA 2BGCA 1KYZA 3IAM2 1D0ZA 3HSEA 2DA6A 3IAS2 4JX4A 4RAZA 4RAGA 5F0FA 4IHXA 1OYYA 3HOXJ 3BLYA 3GTJJ 4S0HB 3CP2A 4CO8A 5EF6A 3KETA 1DD5A 4HV5A 3KLOA 5D8LB 1SAUA 4B3AA 1NK2P 3E5UA 2EQRA 1RRJA 2R7WA 3GUDA 3CMEI 1FY7A 5CVVA 2LMDA 1ZYRD 1KONA 1LFUP 4KN4X 1R58A 3ZMDA 2DFHA 3E6DA 3M8FA 3K5NA 1XD7A 4XLEA 1BIAA 2M45A 2DOEA 3FXLA 1MSEC 4KT5C 1OKRA 4BBSJ 2NNNA 2OC6A 1I27A 1VF9A 3GZ5A 3VYUB 2F4IA 5E8IA 1HC8A 3HIFA 2DFIA 2KHMA 1B6AA 2CQQA 5K7HA 1UHMA 3MN2A 3ECOA 2JA8J 3SDBA 3ZCOA 4G94A 2E1OA 3HRSA 4PUSA 2L9VA 4OAYA 1LNWA 2W24A 2WAQA 2EILH 2CYYA 2WB1N 5FLXZ 1OPCA 1QQIA 4M9ZA 1G59A 1X1DA 2JRMA 2Y0SA 2VKVA 3DKWA 3B6AA 1U8RA 4BQAA 4UVCA 5LRRA 3G1LA 1RETA 3PNYA 4IZZA 2D45A 4RGXA 2A68F 4D0PA 1MBFA 3RPUD 4DBQA 2E7WA 4IP8A 1K83J 2C6YA 3WE2A 1LE8A 1SMTA 3PNTA 1P7IA 1ACIA 2PQ8A 1W0TA 3DBRB 1ETWA 4PCQA 4ZTJA 1VQMI 2RAEA 1HF0A 4JX6A 4M73A 1YJNI 3TO7A 1S5LC 1M1EB 4YRVA 4Y3OA 1I6XA 3VPRA 2FA5A 2ID6A 2JUCA 1S3JA 2LTPA 3F9KA 3WGIA 1YOVB 1BI1A 3GVAA 1R5HA 2WTEA 5LD2C 4UHTA 1IRZA 1IZ1A 2QF7A 1IRFA 3W2WA 1IN8A 1RKTA 5F27A 2H27A 4AIHA 1YE9A 2R7QA 2XB5A 3I4PA 4LIVA 4UB8C 3L2WA 3OYCA 3F8FA 2XV4S 3KCCA 2EH3A 3KFWX 3LQRA 4MGRA 1W36D 3K5OA 1OR7A 4DZPA 2ECCA 5J1UA 4RB0A 1OCCH 2ZBKA 3F21A 2XSJC 4IQJA 3EYIA 1GT0C 3HHHA 3R60A 1V5FA 2QBYB 3ZP5A 1B8IB 2HDDA 1LDJA 2VIXA 1Q1VA 3F8NA 1BI0A 5GPAA 3L2VA 3DQVC 3KZIC 5EEGA 3ZQCA 1WQFA 4LB5A 2P5LC 1G6NA 1R7JA 5ILUA 2IGKA 1WH5A 4A12A 5CVJA 3GFMA 1DGWY 2O8KA 2OZ6A 1IN6A 3PJRA 3F3XA 1O3TA 3I55I 3FIWA 2FF4A 3B02A 4YFXF 4BE1A 5LGTA 1TWCA 1TWHJ 1MGTA 3M3YJ 2FBKA 3R0AA 5EG0A 3R6SA 1B9NA 3TO9A 4I0BA 3LF9A 1A6IA 2FXAA 3CUOA 3RI4A 3QOPA 3VOEA 5IT3A 3RKQA 4CICA 5JR3A 3CCVI 1V5GA 3FMSA 3NWSA 3LSPA 1EH1A 3TGNA 3G1MA 2DA3A 1O3QA 4LJZF 3RJPA 1JKPC 5EDNA 1BR2A 3IH3A 5IYBJ 5HLHA 4HNUA 4NDLA 2EZLA 2OUMA 3F23A 2O5JD 1KGSA 1XS9A 3MKLA 4BDZA 2BZTA 1XSXA 1FYLA 1XDSA 1TW3A 1QZYA 5BPDA 1GXQA 2M7BA 1KU3A 3OWTA 2KZVA 4A3BJ 1XGNA 1BI3A 1Q1HA 2Y30A 2ZMEA 3IRRA 3MVPA 2B0LA 1W5CC 5GTIC 1MMAA 4O3MA 3HC7A 1REPC 5DTDA 1R5ZA 3D5SC 3DBHB 5TGTA 1YNND 2ADUA 3B73A 3CCSI 4A3KJ 3HOWJ 3QYFA 1X2NA 1RPWA 4RLQA 4XK4A 5H2FC 4KDPA 2IRFG 2DQLA 3H0GA 2UUZA 4O26A 4XLFA 4MQ9F 3ZR8X 2XC7A 1A31A 3DWLE 4JQFA 4KAWX 1KU9A 1WRJA 2DO7A 4A2UA 3LSIA 5IP7J 1OMIA 1SD4A 3H36A 1RKWA 4H4KC 3SXYA 4R79A 5CVRA 1RI7A 3BG9A 2R7ZJ 1OJLA 4AUXA 1ZHFA 3CMAI 1JHFA 3QP5A 3QWLA 2YR2A 4M3BA 1DU6A 4L9VA 5CJ9A 5H6RA 5E17F 4L5JA 1BR4A 5EGOB 1MJAA 1PUFB 3CCEI 3BOQA 3K10A 5IOYA 1QPIA 2L01A 1GV2A 4BHPA 3S3NA 3H3ZA 3V8LA 4FQGA 1R49A 3RQ4A 3K1NA 3WGGA 5LEJA 3LSGA 1ZRDA 1KU2A 3BR0A 4BY7J 3VWBA 3H9QA 2K9NA 4XR6A 3S14J 2QQ9A 2BXZA 1GE9A 4U7DA 1Z91A 4QPQA 1S7OA 3GCMA 2CQNA 2J5OA 5EZHA 1O7LA 4ZTFA 4HDVA 1WCMJ 4PGGA 2GA2A 4U88A 5K1YA 3I5UA 3MKZA 2HTSA 1PUEE 4F52A 2KFDA 5J3LA 1IV6A 2PMUA 3FKJA 4ZYHA 3HJEA 2CW0D 2A6ED 4IHYA 2BE5F 3I4NJ 2PMHA 4ZYDA 2DMNA 2HZTA 1MSFC 2KQRA 3K4BA 4LMOA 3HOZJ 2X6XA 3I54A 4P5OA 2HOEA 5HNFA 2IEKA 2V26A 1TWAA 2JVGA 3C2HA 1JGGA 1TZLA 2TDXA 4YFKF 1BIBA 2VL8A 2VPLA 1MBHA 4CUGA 4TV7A 3ZQ7A 4R8HA 2XSDC 4UNOA 3VYRB 2LLKA 3KP4A 4I6ZA 4UVAA 1FOXA 1K4TA 1FBQA 1WWXA 4A6DA 2L4AA 2V9PA 4DYRA 3GTGA 2L9RA 2V7FA 1ON2A 4YG2F 1VTNC 2KDOA 3RYRA 4LITA 1JUPA 2ZJ2A 2AXLA 2NVYJ 2DDAA 1JUMA 2LDUA 2NRAC 2XROA 3H3VK 4ABZA 4EJ3A 1IG7A 3DCFA 1IF1A 5J8CA 4L8IA 2JA5J 3LSJA 5D4SA 4KIBA 3WTTC 4EQQA 4HRIA 2BVMA 3AG2H 3ZMSA 3HKZN 1HKSA 2AHQA 4CCJA 4FETA 3ML6A 3TDZC 3JRDA 4I2OA 3K6GA 2JT1A 3CP8A 5CPRB 2PN6A 1LEBA 4AVPA 3I9V2 3HUGB 2XGDA 3J80Z 2IVMA 2XGXA 4MTDA 1MNMC 5F6FA 2CS3A 2P5VA 1VQPI 2L0KA 3LMMA 1WZ2A 2OTLI 4M72A 3CF5F 1UHSA 1XMKA 1X58A 2DODA 1MKMA 3DTIA 5CLSA 5J1RA 4LLNA 1XN7A 1V54H 1YYVA 2VKHA 2IGMA 5E1WA 2ACJA 3KIOA 4DYQA 1XSDA 2R7TA 3TW6A 3I56I 3SQNA 4CCLA 1BN5A 2FEZA 1EJ9A 3W6KB 2KJBA 1SANA 1AHDP 4A5MA 3GO5A 2ESNA 3K4KA 2R4GA 3A4CA 4YELA 4BQNA 2BHZA 3CJRB 1I6VD 1P4AA 1IXRC 4RMNA 4EM1A 3JSOA 5LHHA 3A02A 2XPWA 4UUTA 3VDXA 5JSBB 1YI2I 3OYLA 3FM3A 5IOZA 4ENNA 4D3ZA 1MDMA 2ZFUA 3MKWB 3E6BA 5HS9A 4XKCA 3BTIA 2CUFA 3I59B 2IS1A 5KAFC 2CUZA 4BJ5C 3AG1H 1IUYA 5D5VB 1Y698 3OS1A 5EZGA 2NVXA 2LYCA 3QP6A 4B4CA 4HF1A 2N8GA 1ETVA 3CCQI 4P96A 4KISA 4GCVA 3PUBA 2BW3B 3HTSB 3BROA 1ENHA 2FBIA 1AWCA 1KQ8A 1Z3XA 4U7BA 1YRNA 4F55A 2ZCWA 2BY3A 4RGSA 4CZCA 3TL4X 3OIPA 3HOSA 1STZA 3GF2A 3SJMA 3T0YA 2DT6A 1WHUA 3DLAA 3TDUC 4RB3C 2V1XA 2R7DA 1T39A 3TOAA 5M5YJ 3TW7A 4UUSA 3K4JA 2F4OB 2OF7A 3SZPA 2ZO4A 5H20A 1Y39A 2DXIA 3HUGA 3IKVA 3KE2A 2VQGA 2M4KA 2GA1A 4U0VA 4RGRA 1B4AA 1WJCA 3BPVA 4LFUA 3MAJA 2VXZA 2K3PA 2WY8Q 3ZN1A 4PSWA 2MLGA 1HXDA 3HPGA 5AIQA 1JT6A 3S8PA 4RBOA 2ZXIA 1R1VA 4OINF 4IQ4A 3ZQQA 4CH7A 3ABTA 3H35A 1APLC 2Z9OA 1SMYD 4HZFA 2WAEA 2QUFA 3VYSB 2R93J 1NK3P 2VQHA 4C2MJ 1VI0A 3G6EI 1HDPA 4L0ZB 1SVOA 1MMGA 1JJ6C 2B63J 2DFEA 2MH2A 3DBLB 2MW8A 4Y17A 3I53A 1FPQA 4A3CJ 4ZJZA 1SEUA 1OISA 2Y0MA 4QLCU 2F5DA 3HEFA 3ZN0A 1TW2A 1XSVA 3V7RA 1G3WA 3K9TA 2JN6A 4E7IA 1DGRM 2VUMA 3FXUA 3K4CA 3KEQA 5EJCA 2HKOA 2LY1A 4HOBA 1C0WA 3TO6A 3U1DA 3WTSC 1ZN2A 5D8KB 1SD6A 4A3EJ 4HDUA 3W6JB 3Q0WA 4MEXF 5FLXK 2LF7A 3H92A 3H9JA 4EVIA 4AVZA 4IEJA 3PIPF 3DF8A 2LY2A 3KP5A 3ERMA 4FISA 1ZELA 1XCBA 1DQUA 1LVKA 2OZUA 4R1HA 3WTYC 3TMOA 3JRIA 2RNJA 1H8AC 3P9IA 1W7PD 2F48A 5K7ZA 3HDDA 2VBYA 1K78B 2HOAA 2R0QC 2IA1A 2FSWA 1YX3A 2BW3A 4EJTA 5J40A 2DJIA 1D5VA 3DTEA 2ELHA 4M9XA 3JRCA 2PI0A 1WJEA 1Z1DA 5CQEA 1WCMA 1OLTA 4C3JJ 4XMYA 3CC4I 3CMYA 1X2MA 2V4JC 4NC7A 3VODA 1OCOH 2CRGA 1F9NA 3DEEA 2BVLA
chains in the Genus database with same CATH topology
4OAYA 2WAQA 3LSHA 4XLCA 2GOMA 4LIUA 1T95A 4RM3A 1E0EA 2XDVA 4IKFA 3W2AA 4XORA 3SEQA 1G59A 4NNJA 1WJFA 1X1DA 2Y0SA 4KT6A 3AL0C 2CV1A 1A35A 3PNYA 4IZZA 1TWHA 1TT0A 1WJAA 2XF6A 1MMDA 3IAYA 4QPOA 4FGUA 5KNLA 2F4QA 3RPUD 2MYSA 4YEJA 4DBQA 4KITB 3E0JB 4IP8A 4B44A 2X85A 1TWGA 4QIWA 3PNTA 3OYDA 2ELJA 4BJ6C 4ZTJA 4PK4A 2JA7A 2IS2A 1W36C 2L7KA 1HQMD 2CUJA 4E4HA 4YRVA 2W00A 4Y3OA 1X19A 3DKYA 3OYGA 4H3TA 3F9KA 2R7XA 3HG9A 1D1BA 4PJMA 5LD2C 4PUSA 1FMVA 3RTRA 2L9NA 1SC7A 2JA5A 3W2WA 2YU9A 1YE9A 2R7QA 4LIVA 3L2WA 1RR8C 3OYKA 1Z21A 3OYCA 2E1MB 4XLHA 3FBNB 3UNGC 1W36D 2B9SB 4P1WA 3K5OA 2M3AA 2VB6A 2XSJC 4IQJA 2CH0A 4D9JA 1LKXA 1V5FA 4PSXA 4KB4A 2E2IA 2VIXA 3EPZA 4IX7A 3L2VA 3OYIA 3DQVC 1N78A 3DKXA 2X1EA 3DPUA 1WQFA 2BE5D 4AN8A 3GTOA 4G6TB 2IGKA 3SYTA 3DU6A 4HG2A 1ERDA 1DGWY 2MC4A 3PJRA 2LRDA 5LFAA 3OYEA 4BE1A 4BQQA 1TWCA 4NOKA 4PJLA 4FYDA 4U87A 3BCAA 1NG6A 2HQAA 2LOOA 3RSNA 2IGOA 4F91B 3NWTA 1YNJD 2VQLA 2XF5A 5CKTA 3LF9A 1BOBA 1X1BA 3BC8A 2R7ZA 4BL0B 2KLOA 4II2A 1V5GA 2LBFA 4J01A 3NWSA 4BE0A 3PNVA 4GRIA 1EH1A 3DTKA 1X1AA 4KB2A 3H5RA 4E6KG 1Y1WA 4F92B 3MMYB 3CQZA 2DOAA 1VZ0A 1BR2A 3FKIA 4HNUA 1Y6IA 2OUMA 3PL8A 2O5JD 2E60A 4HPQA 4BDZA 3AKZA 3K5LA 3MKYB 4DOZA 2L9SA 2WBMA 2JSPA 2M7AA 4JOMA 2JA2A 3L2RA 2LREA 3K58A 2M7BA 4B3XA 3OWTA 1SFOA 1Y56A 4C30A 2BOLA 2KZVA 4AU7A 4ZDOA 2A6HD 2CW7A 4CA0A 2ZSHB 4B47A 2HZDA 1EK8A 2W7NA 1ISEA 4XQFA 2A6TA 4ZDPA 4XKBA 4NOMA 3FBIB 2X6WA 1MMAA 3CMMA 3SJRA 3W3CA 2Z2SB 3HC7A 4ANJA 3OYFA 1R5ZA 3MAQA 3D5SC 4KDDA 5TGTA 1YNND 2CFOA 2DT7B 3QYFA 1A36A 3RCOA 1MIUA 1IRXA 4RLQA 1UG0A 4C2UA 3CZ6A 3H0GA 3CF2A 3FDYA 2UUZA 3P9AA 4PFPA 4O26A 4XLFA 2E2HA 2Q1ZB 2LBFB 3ZR8X 2OV7A 2Z16A 2XC7A 2Z1DA 3DWLE 4JQFA 4OAZA 1QU3A 4KAWX 1A31A 4QCLA 3VYTB 3LSIA 3K5MA 2AQEA 1S9HA 2VQCA 4H4KC 4R79A 1I50A 1HA8A 2M4GA 4BDYA 2V6EA 4NOLA 3I3LA 4CCKA 4CSWA 1QHGA 3K4LA 1BR4A 3KX2A 1WJDA 3H5NA 1PJRA 2F6CA 1Y1VA 3DPLC 3K10A 3S3NA 2R93A 2CW8A 2R92A 3TBIA 4F3EA 1R49A 2R7OA 3RQ4A 3H0DA 1G8XA 3K4NA 2NVYA 3LSGA 2RNGA 2WA0A 1X1CA 4Y33A 3H9GA 3H9QA 3VWBA 1IS1A 4XR6A 1GE9A 3A2KA 2R7UA 2NOJB 4QPQA 4BEHA 2CV0A 2IGNA 5HVQC 2IS6A 3LFUA 4HSTA 2R7VA 3V42A 4BJTA 4OWRB 2KPMA 2HNHA 2CV2A 4ZTFA 2AQFA 1J09A 2X6YA 4XN0A 1TL8A 4BU2A 3MKZA 2K9LA 1PYVA 4NC8A 4Q5VA 2WADA 4F52A 3U21A 4CCNA 5HOOA 2P0WA 3FKJA 2CW0D 3HPHA 2A6ED 4BQOA 4XL9A 3ZGKA 3E1SA 4OYDB 2KQRA 3K4BA 4LMOA 2V9KA 5JHFA 1V9MA 3OYNA 2X6XA 4P5OA 5HNFA 3D5LA 3W2VA 2X1CA 2V26A 1TWAA 3EUKL 2JVGA 3C2HA 1N75A 1TZLA 2CMPA 3OR2C 4ZC3A 2MABA 2VL8A 3HKZA 2VPLA 4CUGA 1WJBA 1MNDA 3OMYA 4HEA2 3OYMA 1JI8A 5JSNB 3VYRB 2E5ZA 1U0JA 2X51A 4NQWB 1Z3YA 3OYBA 2RQQA 3SZGA 1K4TA 3UR3C 2PMZA 2UV1A 4GFQA 3ZRGA 4ITVA 3GTGA 1IW7D 3OR1C 2V7FA 4BEHB 1D0XA 1WQGA 1NG7A 1TGOA 1NH3A 3IP4B 2XAUA 2KDOA 4F93B 4LITA 2HVRA 1GLNA 3GTKA 3C2GA 3KEYA 4E7KA 1I3QA 4EJ3A 1AA7A 2DCEA 2IXSA 4HSRA 4MLOA 3HOTA 3FHNA 2L2OA 2LG4A 3H5AA 1TWFA 4L8IA 3GTQA 4E7JA 4N4OB 4C9YA 2BVMA 2WY7Q 4HRIA 4IP9A 4KJZA 2KRHA 2A69D 4CCJA 3L2UA 4FETA 3EUAA 3K6GA 4XN3A 1K4SA 4DGWB 3CP8A 5CQGA 5CPRB 2W1OA 5MLC9 1BR1A 2HVSA 3I9V2 3HUGB 3OS0A 4BXFA 5KCMA 3AL0B 2CS3A 3LMMA 5FROA 3S3OA 3HXLA 2R7RA 3DTIA 2FUG2 4B43A 3AFHA 4D3YA 4DBRA 3OL4A 2GOXB 4DIQA 3OIQA 4BUPA 2V1NA 4Q5GA 2VKHA 1X4PA 4D1QA 2IGMA 4XKVA 4HNTA 2R7TA 4CCLA 1EJ9A 4E7HA 3S3MA 3M4AA 4XM3A 2QKLB 4PJJA 4XNFA 1WFXA 3VSLA 4BGDA 2HVQA 4CCMA 3K4KA 2R4GA 2MFZA 2XF7A 3A4CA 4YELA 2VASA 1FMWA 4BQNA 3CJRB 2A5WA 3EUHC 2KP6A 1I6VD 1UELB 4XONA 3OY9A 1P9QC 4RMNA 2R7SA 2UWMA 1WJ5A 3OS2A 4E7SA 2Q2EB 3VDXA 2HU9A 5JSBB 3KYLA 3OYLA 4C2MA 2VJJA 4XLAA 4BS9A 4D3ZA 2JVHA 3OYAA 2ZFUA 3MKWB 2VJIA 4N4NB 2E5NA 2B63A 1MMNA 2MD0A 4XKCA 3BG6A 3QYEA 4LG3A 1EA3A 2VJ4A 2IS1A 3D5RC 2A68D 2CUZA 3PSFA 4BJ5C 3PFYA 3S32A 5KHDA 3LHPS 1Y698 3OS1A 2NVXA 5HLTA 2LYCA 3A1YA 1N77A 1MNEA 4KISA 2PJRA 3PUBA 2BW3B 3J7AY 2KMUA 3GTMA 4J00A 3CJQB 1DP3A 1D1CA 5FRMA 3HL2A 1Z3XA 4U7BA 4F55A 3K70C 3GTPA 4RM2A 3GTLA 3G2BA 4CZCA 3M1CA 3TL4X 3OIPA 4II3A 5HNHA 3HOSA 3GTJA 2DT6A 3DLAA 3ONQA 3SEZA 2HDWA 3OOUA 3K4JA 4NUBA 4AYBA 1MW7A 1LFPA 3OYJA 3QOEA 2DXIA 3GBGA 2VQGA 2M4KA 4ZDLA 3OL3A 4E7LA 2RREA 4CCOA 1WJCA 1YX5A 3K70D 2I8DA 3QODA 2VXZA 4DJAA 3K57A 2K3PA 2WY8Q 1D1AA 4PSWA 4FASD 2KRCA 1WQHA 3HPGA 4JLRC 3DU5A 1X4OA 2LH9A 3BG7A 2ZXIA 3S8PA 3CESA 4IQ4A 4C2TA 1QHHD 1R6RA 3N05A 3ZQQA 1UAAA 2E1MC 4CH7A 3H35A 4BE2A 1SMYD 4AHCA 4X0GA 4XOPA 2WAEA 2ZXHA 2VXDA 3L2QA 3VYSB 1V5EA 2VQHA 2ZSIB 2PJRB 2F5VA 3IUOA 3WVOA 1D0YA 1MMGA 4FXDA 2JA6A 2VLAA 4KC6A 4ZJZA 1SEUA 1SFKA 4PFOA 2K9MA 4E7IA 1Z7LA 1DGRM 2VUMA 1LDKB 3K4CA 4PJNA 3LSKA 2LY1A 2VJ5A 1T0FC 1K83A 2VKDA 2M0MA 3S93A 2HPIA 2IS4A 3H9JA 3IAM2 1D0ZA 3IAS2 4AVZA 3BCBA 2W4SA 2LY2A 2X1DA 3BLYA 3OYHA 3CP2A 4E7ZA 2WB1A 1DD5A 1R9TA 1ZELA 4XOTA 4XKWA 1DQUA 1LVKA 3TMOA 1LPQA 1SAUA 2WAFA 1Q8IA 3K4MA 3LSMA 1RRJA 4EATA 2R7WA 1T8IA 3M8JA 3DPTA 2K5CA 1ZYRD 2JUGA 1KONA 3LL7A 3PSIA 1YX3A 2BW3A 2O5RA 2DJIA 3DTEA 3K5NA 4RLFA 4XLEA 4F3QA 4B48A 1WJEA 5FRNA 1OR7C 2OC6A 5CQEA 1WCMA 1OLTA 3VYUB 2F4IA 4ZYAA 4XMYA 2KHMA 2L5QA 3VSKA 2HPMA 3QYBA 1K6YA 4Y4RA 2V4JC 4NC7A 3ZXSA 3MD2A 2LC2A 5C9HA 4BACA 3K59A 3SDBA 3ZCOA 2QKMB 2KL4A 3DEEA 2W82A 2BVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMO A;  3KYL A;  2R4G A;  5C9H A;  4O26 A;  3DU6 A;  3DU5 A;  5CQG A; 
#chains in the Genus database with same CATH topology
 2W84 A;  1I3A A;  2GXB A;  4XLC A;  2GOM A;  5HLI A;  4N9H A;  2HR3 A;  3LFK A;  1E0E A;  2XDV A;  5DS9 A;  3W2A A;  4XOR A;  4XRS G;  1E17 A;  1ZTR A;  3ABM H;  4OIR F;  1XGO A;  2CV1 A;  1JKO C;  3HTU A;  1TT0 A;  4RB1 A;  4IHV A;  4P55 A;  3SZT A;  2NVU B;  4A0Z A;  3U2R A;  2CWE A;  2AXT C;  1U6G A;  3MCZ A;  4FX0 A;  2ELJ A;  3OYD A;  1LB2 A;  2WV1 A;  2IS2 A;  2M9H A;  2EFO A;  1W36 C;  3HSR A;  4FE4 A;  4ETS A;  2LF8 A;  4EM0 B;  2L7K A;  1HQM D;  2P5K A;  1ON1 A;  2XAS A;  1SFX A;  4E4H A;  2CQ7 A;  5F64 A;  1X19 A;  3DKY A;  2XAQ A;  5ICC A;  3OYG A;  1R9T J;  1H9T A;  4PZJ A;  5J47 A;  3S15 J;  3F8M A;  3HG9 A;  1MD0 A;  1QA6 A;  4PJM A;  3BZC A;  1JE8 A;  2EZI A;  2GQQ A;  2RC4 A;  4I7H A;  1ZG1 A;  2VON A;  2JA5 A;  2K9S A;  2Y0S N;  3Q3S A;  1OCP A;  3OYK A;  2R5Z B;  4XSZ F;  4XLH A;  5ICG A;  2M3A A;  2VB6 A;  5M5X J;  1ZQ3 P;  5K5Q A;  4M9S A;  2EIK H;  4ENM A;  2M30 A;  4KN7 X;  1H88 C;  2CH0 A;  1R1T A;  3S1M J;  4PSX A;  4KB4 A;  2E2I A;  3CUQ B;  4B1R A;  2X4H A;  5FGM A;  2LR8 A;  3FXQ A;  2R5Y A;  3BT9 A;  2XRL A;  3ASO H;  3DKX A;  2HQR A;  3GW2 A;  1W7P B;  4AN8 A;  1YS7 A;  1EV7 A;  3GTO A;  1GUU A;  3ZMV A;  3EUH A;  2X48 A;  5FO5 A;  2HOS A;  1W5T A;  5HLG A;  5LFA A;  4U87 A;  1W4M A;  4XRS A;  1NG6 A;  2HQA A;  2LOO A;  2IGO A;  2DFF A;  3SFZ A;  3NWT A;  4EJU A;  3F8B A;  3FIS A;  1KA8 A;  1S7E A;  2XIG A;  5F08 A;  3BC8 A;  4KUM A;  5F1J A;  4BL0 B;  2BY2 A;  1U3E M;  2KLO A;  4II2 A;  2JA7 J;  4BE0 A;  1IN4 A;  2A05 A;  4MQV A;  4S04 A;  1X1A A;  2UZK A;  2OA4 A;  1V4R A;  2YSR A;  1UJ8 A;  3CQZ A;  2DOA A;  1VZ0 A;  5BMZ A;  1IXS B;  3PM1 A;  2LKX A;  3PL8 A;  3EET A;  2E60 A;  2GIV A;  1FP1 D;  3AKZ A;  5HS7 A;  3K5L A;  2HFH A;  3JRF A;  4DOZ A;  2HKX A;  2WBM A;  1KYW A;  2EFQ A;  4UV9 A;  1ZYR F;  1SFO A;  4C30 A;  5F1R A;  2BOL A;  1E3P A;  4L0Y B;  4YIF A;  4BBR J;  4ZDO A;  4XLN F;  4EGY A;  1FYM A;  1EF4 A;  2HZD A;  4CYC A;  3VEP A;  1TTY A;  4OMY A;  1ULY A;  2TRT A;  1ISE A;  4AIJ A;  2DTR A;  2A6T A;  1MMS A;  3A0B C;  2DAO A;  2H8R A;  2OU2 A;  3KYC B;  1HBX G;  5KVR A;  1TQP A;  5E3L A;  3SJR A;  4AID A;  4ANJ A;  3OYF A;  2QVO A;  2QQB A;  5EG0 B;  1MIU A;  2XKP A;  3LQQ A;  5E18 F;  2ZJQ F;  2Y48 A;  1ORK A;  2D1V A;  3FDY A;  2R5Z A;  2Q1Z B;  4OMZ A;  5C44 J;  2E34 A;  2QM3 A;  4A3M J;  4LG0 A;  3WU1 B;  2UXN A;  5DCM B;  2JA6 J;  5FFX A;  2D1H A;  3CUQ A;  2AQE A;  2VE8 A;  1S9H A;  2HS5 A;  2VQC A;  4IF4 A;  1I50 A;  4FX4 A;  1U78 A;  3CTA A;  2ZXJ A;  2JTV A;  2OQR A;  3I71 A;  4BDY A;  2V6E A;  2O9L A;  1W7P A;  5DUK A;  4JP0 A;  3E6M A;  3IKT A;  3I3L A;  5D6F A;  5D4R A;  1FOY A;  4CCK A;  1Y1W J;  5IT9 Z;  1QHG A;  5LGN A;  4UY8 I;  1FJL A;  2L7M P;  3H5N A;  3IH2 A;  2CG4 A;  3J81 Z;  1PJR A;  2F6C A;  2JPC A;  2ZME B;  3DPL C;  1HW2 A;  5DD4 A;  2EPF A;  1FLI A;  2FJ1 A;  1Y1V A;  2R93 A;  2M1B A;  1BC7 C;  1IGN A;  2MC3 A;  2WA0 A;  4NQW A;  5HDG A;  3KEO A;  1VQK I;  3H9G A;  2JMW A;  1AU7 A;  2BY1 A;  4D5F A;  2R7U A;  4B09 A;  4BEH A;  2CV0 A;  2QEN A;  2IGN A;  5HVQ C;  4L5E A;  5DD8 A;  3BR5 A;  1ZRE A;  4OWR B;  2KPM A;  3OV8 A;  4WXC A;  4XN0 A;  1J09 A;  3PQJ A;  4G12 A;  5CVU A;  2VBZ A;  2KZG A;  2JRT A;  3RKX A;  3D1N I;  1YW9 A;  4IO9 F;  4NC8 A;  2WAD A;  2P7V B;  4I98 B;  3ROU A;  2DI3 A;  3ZGK A;  1XG1 A;  4KFC A;  2DDB A;  4GFB A;  4D7N A;  3MEX A;  1HKT A;  2V9K A;  1A5J A;  3W2V A;  4MFD A;  3CDI A;  3HRU A;  3KPH A;  2DT5 A;  5F0H A;  1WI3 A;  1K6O A;  4OIO F;  1XGM A;  2KIS A;  2BEO A;  3OMY A;  5CYV A;  2HEO A;  3J80 K;  4HEA 2;  3L09 A;  3OYM A;  3GZ6 A;  2DYS H;  4P9U A;  2FQ3 A;  4M6X A;  2XVC A;  3IL2 A;  1VQ4 I;  2DQR A;  2ICW G;  1DP7 P;  3WU2 C;  3OYB A;  2ZJR F;  2NVQ J;  3E5X A;  2XGC A;  3UR3 C;  3FK6 A;  1GHC A;  2DA5 A;  1TGO A;  5DCM A;  3IP4 B;  2XAU A;  1D3Y A;  2R92 J;  4A0Y A;  2HVR A;  1GLN A;  4BYY A;  3GTK A;  4E7K A;  3F6O A;  5JFR A;  2DK5 A;  4A3D J;  4MHG A;  3ABU A;  1AA7 A;  2W25 A;  5IP6 A;  5L3G A;  1RIO H;  3JTH A;  2LG4 A;  1B72 A;  1P92 A;  1VQ7 I;  3GTQ A;  4C9Y A;  2WY7 Q;  2KDZ A;  1BL0 A;  4HQE A;  2OBP A;  2A69 D;  3L2U A;  1O57 A;  3EUA A;  4F7Z A;  2GXA A;  4Y15 A;  1TQI A;  2DYR H;  2IJL A;  3JRB A;  1B9M A;  4HX8 A;  1HQC A;  2QSH X;  3EDP A;  2FE3 A;  2O3F A;  5FRO A;  3FM5 A;  4BNC A;  3V8K A;  4BY1 J;  3S3O A;  4L9N A;  4A0X A;  2FUG 2;  3QU6 A;  2E1C A;  1AOY A;  2LK2 A;  3OIQ A;  2RDP A;  3PIO F;  2EK5 A;  1IJW C;  5E79 C;  4Q5G A;  2J5P A;  3O3K A;  4G7O F;  1T08 B;  5ILS A;  3WGH A;  5J6X A;  5L3E A;  4CDG A;  2DJN A;  1XC5 A;  3LNQ A;  1G3S A;  5DM7 F;  5K5O A;  2K4J A;  2K40 A;  1YLF A;  4HYE A;  1E3H A;  3P7N A;  1FMW A;  1BOA A;  3EUH C;  1U9O A;  3PUF A;  1UEL B;  5ERI A;  1JKR C;  2RV8 A;  1P9Q C;  3SDG A;  2IBD A;  3FKI J;  3S1N J;  1RZ4 A;  5TIS C;  2UWM A;  3M07 A;  2HU9 A;  3A03 A;  1EH8 A;  2VJJ A;  4BS9 A;  2HYG D;  3BR6 A;  2MH9 A;  2JVH A;  3HZJ A;  4IPA A;  5IYD J;  4M71 A;  1MMN A;  3RIR A;  5LBQ A;  4LGW A;  2STT A;  2Q0O A;  4ESJ A;  1YIT I;  3D5R C;  3FXM A;  1XGS A;  1S6L A;  1XX5 A;  5B5E C;  3PSF A;  2EZK A;  4QWQ A;  3PFY A;  2HWV A;  1TQM A;  3LHP S;  2VC1 A;  5HLT A;  4DQ2 A;  4J19 A;  1N77 A;  2EV0 A;  2XAH A;  2PJR A;  2KMU A;  4J00 A;  3CJQ B;  2O61 A;  1D1C A;  2CW0 F;  3BZK A;  5FRM A;  2A6E F;  3HL2 A;  3FXO A;  3CD6 I;  1T6S A;  2ZC2 A;  4II3 A;  5HNH A;  5D5W B;  3GTJ A;  5LRS A;  1A04 A;  4FE7 A;  4I99 C;  4UXN A;  2RVC A;  1IO2 A;  4Q4Z F;  5HDK A;  2KIM A;  5LHI A;  1ZRF A;  4AM3 A;  1ZKG A;  4LK1 F;  2ZB9 A;  3HGG A;  1BW6 A;  4AD9 A;  4GDF A;  5D5X B;  4AYB A;  3OYJ A;  3QPL A;  3GBG A;  5D6E A;  4GGG A;  2IA0 A;  2RRE A;  4OU0 A;  4EGZ A;  2X9D A;  1P6R A;  3K70 D;  4Z6Y A;  3QOD A;  4BHC A;  3N97 A;  1MDM B;  4DJA A;  3DEW A;  2DN0 A;  1TP4 A;  1X1P A;  3BG7 A;  5M3F J;  2HQ5 A;  1WQ2 A;  3CES A;  2HTJ A;  2NXN B;  4YII A;  3LAJ A;  1ETK A;  4O5V A;  1QHH D;  4C2T A;  1R6R A;  2EB7 A;  3N05 A;  4AHC A;  3F72 A;  2LY9 A;  3R61 A;  4EJV A;  3M9A A;  1V5E A;  2F5E A;  4P9F A;  2ME0 A;  2F5V A;  4G9Y A;  3CUQ C;  1D0Y A;  3BJ6 A;  3DFG A;  2JA6 A;  1ZH5 A;  5JVT A;  3K2Z A;  1YRN B;  1L0O C;  5BNG A;  1AKH A;  4PFO A;  3GX4 X;  1B1B A;  3CLQ A;  1H89 C;  2UXX A;  1KQ9 A;  4MIM A;  5TRD A;  5JVG F;  2VJ5 A;  1K83 A;  1GXP A;  3HRT A;  2ME6 A;  4UUS B;  3S93 A;  2P7C B;  2HPI A;  2K4B A;  3ABK H;  2IS4 A;  2Z3Y A;  1UFM A;  2FMY A;  3GTP J;  3BCB A;  2FBH A;  3GTL J;  2GIZ A;  2I5U A;  4XRM A;  2X1D A;  1ZLJ A;  1T2K A;  3GXO A;  4JX5 A;  2QYO A;  4FT8 A;  1YS6 A;  3D0S A;  2WAF A;  2V79 A;  1Q8I A;  3SFI A;  3K4M A;  3LSM A;  9ANT A;  4EAT A;  1T8I A;  2XRN A;  1VQN I;  1FP2 A;  5L3F A;  3M8J A;  3DPT A;  2PLY A;  3VB2 A;  4LLL A;  2JUG A;  1ETO A;  3LL7 A;  5DDG A;  2O5R A;  2QQ8 A;  5FRN A;  4KA4 A;  1OR7 C;  4QSH A;  3IRQ A;  3G4S I;  3JRA A;  2L5Q A;  1F5T A;  2F5C A;  3QYB A;  4Y4R A;  3ZXS A;  3MD2 A;  5FD6 A;  2LC2 A;  3K59 A;  2PJP A;  4V19 K;  1FT9 A;  2KL4 A;  2DPD A;  3CDL A;  1F1Z A;  1T95 A;  2DPU A;  4XSX F;  4LK0 F;  2BBY A;  1MZB A;  5B66 C;  3AL0 C;  3G73 A;  1S7A A;  1TWF J;  1TWH A;  2XF6 A;  1MMD A;  5KAI C;  4FGU A;  5KNL A;  1JTX A;  1G4D A;  4IL6 C;  2NNY A;  1P4W A;  1T56 A;  3W6V A;  3E0J B;  3KP6 A;  4B44 A;  2OTJ I;  2ECB A;  2X85 A;  2GBY A;  3GEZ A;  2GLO A;  2RQP A;  1WGX A;  4AIK A;  3TP3 A;  1T0F A;  1ZR2 A;  4BJ6 C;  1YQA A;  1QGP A;  1YJ9 I;  3IV5 A;  5H6Q A;  2K7L A;  4KNY A;  3MWM A;  4JK1 X;  3RZD J;  2QA4 I;  1Z77 A;  4HV6 A;  2ZNZ A;  3FF5 A;  4AWX B;  4H3T A;  5F0C A;  1Y0N A;  2FD5 A;  1U8B A;  4DZJ A;  4MTE A;  3ISP A;  5K5R A;  2CFX A;  1CF7 A;  4IHW A;  1T33 A;  1SVM A;  3RTR A;  2L9N A;  2VE9 A;  1VQL I;  3M1E A;  3I4M J;  2E71 A;  1FZP B;  1OFC X;  1Z21 A;  2ZME C;  3HRM A;  4G8X A;  4IOA F;  2QWW A;  3HOU J;  2E1M B;  2ZFW A;  3FBN B;  3UNG C;  4P1W A;  1ZAR A;  3DEU A;  5C4J J;  2O0Y A;  3WTZ A;  2IA2 A;  1HOM A;  4DYC A;  4FCY A;  4D9J A;  1LKX A;  1LQ1 A;  1ODD A;  2GZW A;  3IC7 A;  2QLZ A;  3OYI A;  3V4G A;  2AO9 A;  1SMY F;  3HM5 A;  2XGE A;  3SYT A;  4HG2 A;  2D2W A;  5EEH A;  1FC3 A;  2KIF A;  1FEX A;  4I0A A;  4PJ0 C;  3OYE A;  1DU0 A;  4BQQ A;  4ENJ A;  2V1D A;  4FYD A;  2XUB A;  1RC9 A;  1Y8Q B;  3RSN A;  2EJR A;  2KT0 A;  2P6S A;  1QRY A;  4BKX A;  1YNJ D;  2VQL A;  2XF5 A;  3BTL A;  2XKO A;  5CKT A;  5TJJ A;  5F04 A;  1X1B A;  2CJJ A;  2FML A;  2HQN A;  2R7Z A;  3HOY J;  3O8G A;  2KKO A;  2LBF A;  4J01 A;  4GRI A;  4KB2 A;  2COM A;  3DTK A;  1R5G A;  3MMY B;  2H1K A;  4HW0 A;  4FTH A;  3FKI A;  5FFZ A;  1Y6I A;  3DP7 A;  2O6G E;  4HPQ A;  5IY5 H;  5IYC J;  4G6Q A;  1R5I D;  2Y75 A;  3C18 A;  3GLL A;  3S16 J;  5L3D A;  4WK8 F;  2JSP A;  4JOM A;  1P4X A;  1RUO A;  1VQ5 I;  1IRG A;  2XAJ A;  3K58 A;  2R5Y B;  1VND A;  1Y56 A;  2E1N A;  2FOK A;  3E6C C;  1VQ9 I;  2STW A;  2A6H D;  4CA0 A;  4Z2Y A;  4B47 A;  5IT9 K;  3S17 J;  4I02 A;  4KIG A;  1EK8 A;  3UKG A;  1PDN C;  4XQF A;  3JW4 A;  3J81 K;  2NOG A;  4NOM A;  4MO7 A;  2Y9Y A;  4A3I J;  1JKQ C;  3BG5 A;  2Z2S B;  2H09 A;  3K1M A;  1HLV A;  3ZMZ A;  4KDD A;  2DT7 B;  2DTZ A;  3WG9 A;  2E2J J;  1FSH A;  3RCO A;  1IRX A;  3FXR A;  1LVA A;  1UG0 A;  3QPH A;  2JWT A;  1J59 A;  4C2U A;  3N4M A;  1BW5 A;  5GAD J;  3P9A A;  4D5C A;  2OV7 A;  2DMQ A;  2IT0 A;  3U9G A;  1TWC J;  2Z1D A;  3AG4 H;  3LA7 A;  2G7U A;  2K9Q A;  3VYT B;  4QCL A;  1FBU A;  2QQA A;  2M87 A;  3K5M A;  1MJB A;  3WOD F;  3WG7 H;  1USS A;  5FD5 A;  2LKP A;  4NOL A;  1BBY A;  1FTT A;  5JHU A;  4HAM A;  3LAP A;  3HSF A;  3JRH A;  4C3I J;  2HXO A;  2XPU A;  5L3C A;  3J7Y J;  3MZY A;  3KX2 A;  2EIJ H;  2M5W A;  1ETQ A;  4CYC B;  1SAX A;  2Y2Z A;  3NQO A;  2VBX A;  4KIC A;  4PGH A;  3JR9 A;  2YX7 A;  1IDZ A;  3ZQF A;  4JYK A;  3REO A;  4EJO A;  2DA4 A;  3TBI A;  1ZK8 A;  4QTR A;  3O8H A;  5GAH J;  2R7O A;  2NVY A;  1MJ9 A;  2F4M B;  2RNG A;  4HX4 A;  1X1C A;  5GPC A;  5D5U B;  1N25 A;  2JJ7 A;  1FYK A;  2NOJ B;  3L7W A;  2IAI A;  2IS6 A;  3LFU A;  4HST A;  2HXI A;  3FXK A;  3K1P A;  4ZZL A;  2CV2 A;  3O2P E;  2AQF A;  2NS8 A;  2X6Y A;  2CGP A;  4BH9 A;  4LG0 B;  3HHG A;  2I10 A;  3ZMU A;  1PYV A;  1IC8 A;  4Q5V A;  3KP2 A;  1BJA A;  1VQ6 I;  4ZYE A;  5HOO A;  2JK3 A;  3DXJ F;  4XL9 A;  3U1K A;  1IAW A;  3ZQL A;  2HYJ A;  3H0G J;  1WPK A;  2EZH A;  4Q47 A;  4OYD B;  2H1L A;  4HA8 A;  5E8G A;  1T38 A;  3OYN A;  3KYD B;  3R4K A;  2FNA A;  1Z67 A;  3EUK L;  2VOP A;  3C3W A;  2M8G X;  1N75 A;  2CMP A;  2IP2 A;  2JPB A;  2VOO A;  2NAZ A;  1MIJ A;  4ZC3 A;  3S1Q J;  3Q9S A;  5ICE A;  1WJB A;  4ZYG A;  1MND A;  3CCJ I;  4IHT A;  1EKE A;  2L54 A;  4DW6 A;  1JI8 A;  1WSU A;  2V6C A;  4U0W A;  3S2D J;  2E5Z A;  4NQW B;  1O3R A;  1POG A;  1TWG J;  1HCR A;  1Z3Y A;  5GAG J;  3M4O J;  2RQQ A;  1J2X A;  3SZG A;  2Z5U A;  2PMZ A;  1MBJ A;  3M8E A;  4GFQ A;  1IW7 D;  4CHU A;  4S05 A;  4BEH B;  3ELK A;  1WQG A;  3C7J A;  1FOK A;  2OQG A;  2OAZ A;  4M3G A;  3C2B A;  4FHT A;  4RS8 A;  1JGS A;  2KIQ A;  3K0L A;  3CO7 C;  1GVD A;  3JAM Z;  2ISZ A;  3BP8 A;  5AON A;  2DMU A;  2IXS A;  1XDU A;  3DV8 A;  4HSR A;  4MLO A;  3FHN A;  2L2O A;  1TWF A;  1FTZ A;  4L9T A;  1J5Y A;  2YU9 J;  1QPM A;  4N4O B;  1FIA A;  3F6V A;  1RR7 A;  1ZRC A;  3JSP A;  4IP9 A;  3NAR A;  2G7H A;  1DPU A;  1FX7 A;  2KRH A;  4L5I A;  3X2Q H;  2CSO A;  5ED4 A;  2Q2E A;  5CQG A;  3OIO A;  2M34 A;  1P2F A;  1O7F A;  3K2A A;  3SHF A;  1BR1 A;  3BDD A;  2HVS A;  3JTG A;  1X3W B;  2MG4 A;  1K79 A;  4BXF A;  3OSF A;  5KCM A;  3ZQI A;  3AL0 B;  1R1U A;  1U5T B;  2P81 A;  1J7K A;  3TP0 A;  3HXL A;  2RN7 A;  1U2W A;  2RKH A;  3IHU A;  3T1B A;  4B43 A;  4D3Y A;  1TWA J;  5FKM A;  2ZJP F;  3G71 I;  1O4X A;  2GOX B;  4OOI A;  4DIQ A;  1YW7 A;  1MH3 A;  2EA2 A;  3RKW A;  4I09 A;  4D1Q A;  2ETH A;  2AS5 F;  3CCY A;  3MZH A;  2YS9 A;  1D8K A;  1RES A;  4E7H A;  1QVU A;  5BS6 A;  3S3M A;  4XM3 A;  4PJJ A;  4G7H F;  4XNF A;  3VSL A;  4BGD A;  2HVQ A;  3CJT B;  3A01 A;  3E7L A;  3QRF F;  1Z6R A;  2M0C A;  3GTG J;  4CCM A;  2COB A;  3TOB A;  1B72 B;  2MFZ A;  2XF7 A;  1YIO A;  2VAS A;  2A5W A;  2XAF A;  3TKY A;  1FWZ A;  2K02 A;  3OY9 A;  1Z6T A;  5B1A H;  4YIR X;  5DUI A;  1ZR4 A;  3KLN A;  4NC6 A;  1UG2 A;  2EA4 A;  4E7S A;  4M3D A;  1XCV A;  3KYL A;  3HOV J;  4C2M A;  2VI6 A;  4RB2 C;  4N4N B;  2B63 A;  2X6O A;  2MD0 A;  2LD5 A;  3QYE A;  2VBW A;  4V2F A;  2H94 A;  3ABL H;  4LG3 A;  3BWG A;  2RGV A;  4XLP F;  2VJ4 A;  2A68 D;  1RUN A;  5CVI A;  2QSF X;  3S32 A;  4E70 A;  5FLM J;  2G9W A;  4W97 A;  2CO5 A;  3J7A Y;  1MBE A;  2VKE A;  1YW8 A;  3WTX C;  1DP3 A;  1IN5 A;  5A2Q K;  2VC0 A;  1J0R A;  3K70 C;  4RM2 A;  3PFI A;  3T5X A;  2JZY A;  5LHG A;  3CCU I;  3BR3 A;  1Y0U A;  2P8T A;  4KIF A;  2FQ4 A;  5EEA A;  1VQ8 I;  1XPX A;  2YUS A;  1ZG5 A;  2E2H J;  1LFB A;  4A69 C;  2Z33 A;  1XTA A;  1YO5 C;  4UUV A;  2BHY A;  2XHK A;  1E3O C;  3GFJ A;  1LFP A;  4NHJ A;  4GO1 A;  3OL3 A;  4A3G J;  4E7L A;  3LWF A;  4CCO A;  1EH6 A;  1U5T A;  2XB0 X;  4QIW N;  1G3T A;  1BA5 A;  4HF2 A;  2I8D A;  4ASN A;  1GDT A;  1D1A A;  2PX9 A;  4FAS D;  5DYM A;  3ZOB A;  2LH9 A;  3S2W A;  3BR2 A;  6PAX A;  1UAA A;  2E1M C;  3BQY A;  3ULQ B;  4BE2 A;  3EQL F;  3K7A J;  4XOP A;  2EBI A;  3L2Q A;  3ZMT A;  2DMP A;  3CO6 C;  2XPV A;  2ZSI B;  2PJR B;  5E20 A;  3IUO A;  1H9G A;  4FXD A;  1K61 A;  1K7A A;  1NTC A;  1LJ9 A;  2P6T A;  2JSC A;  4AYB N;  2K9M A;  1OYI A;  1U9N A;  4Y13 A;  1QO0 D;  2A69 F;  2KRF A;  2NVX J;  1LDK B;  4PJN A;  2NS0 A;  1ETY A;  2PG4 A;  4ZZD A;  4IRI A;  2ZXW H;  3IWF A;  2VKD A;  2HOT A;  1I39 A;  4ESB A;  2FNP A;  3KP3 A;  4H0E A;  1W1W E;  1MH4 A;  2W4S A;  4GXO A;  2FU4 A;  3OYH A;  3ZQH A;  2WB1 A;  3IH4 A;  4E7Z A;  5GTH C;  1VFC A;  4XOT A;  2DK8 A;  4XKW A;  1L3L A;  1R9T A;  2O7O A;  1FBS A;  4GYI A;  1YG2 A;  1HKQ A;  1LPQ A;  4CXF A;  1HW5 A;  1UB9 A;  5J4Y A;  1FIP A;  2K5C A;  1TNS A;  2L7Z A;  2IPQ X;  4NB5 A;  3PSI A;  3JRG A;  2NYX A;  2WV0 A;  3CCM I;  3WTW C;  4RLF A;  4F3Q A;  4B48 A;  2NVT J;  1JT0 A;  5IP9 J;  4CZZ A;  2WWY A;  1ZG3 A;  2Y31 A;  1WVR A;  2Q8K A;  2LVS A;  4ZYA A;  1OYW A;  3BTC A;  1A6Q A;  5EYR A;  3VSK A;  1FSE A;  2EFN A;  3BZ6 A;  5HOD A;  2HPM A;  1K6Y A;  5LGU A;  2BY0 A;  5C9H A;  4BAC A;  1S29 A;  1AKH B;  4UV8 A;  2QKM B;  3L9F A;  2W82 A;  4M3E A;  3LSH A;  2E36 A;  4LIU A;  4RM3 A;  3QU3 A;  2YU3 A;  4B8X A;  2JQ7 A;  1S8N A;  5M5W J;  1IUF A;  5BPI A;  1I3Q J;  4IKF A;  2E7X A;  1PP8 F;  4M6Y A;  3SEQ A;  1W0U A;  4NNJ A;  1WJF A;  1R36 A;  2K3F A;  3NAU A;  1YFH A;  2DLL A;  3CLO A;  4HLY A;  2QBY A;  4KT6 A;  1B8I A;  4IVN A;  1NHA A;  3KP7 A;  4BAY A;  4EJW A;  1A35 A;  4L18 B;  1TNT A;  4N9I A;  3IAY A;  3COA C;  1WJA A;  2A5Y B;  4QPO A;  4A6E A;  2VUM J;  1Z05 A;  2E19 A;  2MYS A;  3MZ8 A;  4YEJ A;  4KIT B;  2F4Q A;  2G0E A;  1TWG A;  3ECH A;  3MFK A;  4QIW A;  3I64 A;  3HYI A;  1I5Z A;  4HX7 A;  1OCT C;  5E3O A;  2JA7 A;  4PK4 A;  1ITY A;  3BPX A;  4WXD A;  2CUJ A;  1D5Y A;  4YFN F;  1R4M B;  4WX9 A;  1V55 H;  2MSY A;  3AAF A;  2W00 A;  5HDN A;  5LEK A;  2E35 A;  5M3M J;  2R7X A;  2LFB A;  1ZGJ A;  3FXJ A;  4UVB A;  1MBG A;  5DCF A;  2X0L A;  1R00 A;  1D1B A;  5FKL A;  4A3L J;  2R3S A;  3G1O A;  1FMV A;  4IJA A;  4EM2 A;  2OPT A;  1SC7 A;  1S72 I;  4WXH A;  2QGU A;  3PQK A;  4I76 A;  2YU9 A;  1Z9C A;  4OIP F;  1RR8 C;  1WH7 A;  2B7E A;  2OJE D;  1HW1 A;  2B9S B;  4XBF A;  2GXG A;  1HSJ A;  2QCO A;  2KJC A;  4Y7N J;  1I6H J;  3GFL A;  2DW4 A;  3P9K A;  5JI6 A;  4WCG A;  3ZQG A;  3EPZ A;  3RPU A;  4IX7 A;  4RAF A;  4UB6 C;  1JXS A;  3H1C A;  1Y8R B;  1N78 A;  2X1E A;  3DPU A;  2BE5 D;  4M74 A;  2W85 A;  4G6T B;  4A5N A;  2K85 A;  2PBI A;  3DU6 A;  1X3U A;  3GFI A;  1ERD A;  2Y9Z A;  2MC4 A;  3F22 A;  1R23 A;  3P5J A;  2LRD A;  5A2Q Z;  2FX0 A;  4EEF G;  5KK1 A;  4PJL A;  3ERE D;  1JJ8 C;  4NBQ A;  4NOK A;  3FMQ A;  3BCA A;  1DPR A;  1R4N B;  2M8E A;  3KZY A;  4HNV A;  3BJA A;  3LA2 A;  4F91 B;  1XB4 A;  2EV6 A;  3E5Q A;  1BOB A;  4IRG A;  5E1X A;  1CF7 B;  1PVE A;  5B3S H;  1ZGW A;  2CUE A;  3HGY A;  2MLK A;  4G7Z F;  3F8C A;  3PNV A;  1F36 A;  1IDY A;  1KU7 A;  2VT2 A;  3H5R A;  4E6K G;  1Y1W A;  3GTM J;  4F92 B;  1UZC A;  3QPT A;  3L2C A;  1SD7 A;  2DA7 A;  3QPS A;  3MKY B;  1KZH A;  2GAU A;  2VT3 A;  2L9S A;  2M7A A;  4U0Y A;  3LA3 A;  3L2R A;  2JA2 A;  2LRE A;  4B3X A;  2PFB A;  5GP9 A;  4AU7 A;  1CQT A;  5EGO A;  2CW7 A;  1R22 A;  5BQT A;  4HBL A;  2ZSH B;  5E3N A;  1PUF A;  3Q0V A;  5HS8 A;  2W7N A;  4ZH4 F;  1HDD C;  5C4X J;  5K7F A;  4ZDP A;  4XKB A;  4MFE A;  3FBI B;  2V9V A;  2E2I J;  5FB2 A;  2X6W A;  3B6C A;  4EV0 A;  3R0J A;  3CMM A;  4MNU A;  3W3C A;  1J75 A;  3MAQ A;  3CDH A;  2M2E A;  4HF0 A;  3L00 A;  2CFO A;  1UST A;  1A36 A;  2YPR A;  3GTO J;  2HGC A;  2L02 A;  3CZ6 A;  1Z7U A;  3CF2 A;  4PFP A;  4G6D A;  3RDI A;  2E2H A;  2LBF B;  4RAY A;  2B9S A;  2Z16 A;  3M7G A;  4I01 A;  1XMX A;  4OAZ A;  1QU3 A;  4LMY A;  3RYP A;  2OD5 A;  5DV5 A;  1YJW I;  2BYV E;  3AG3 H;  2DA2 A;  3LSR A;  1TLH B;  4RA2 A;  3PO2 J;  1U5T C;  3CCR I;  1HA8 A;  2M4G A;  4MEY F;  4XIC A;  4A93 J;  3E97 A;  1XMA A;  4IHS A;  1CGP A;  3TQN A;  3V8J A;  3CCL I;  4CSW A;  2VN2 A;  3CQZ J;  3WTV C;  3K4L A;  2H6B A;  1WJD A;  3T8R A;  4IRH A;  5B1B H;  2VOD A;  3S1R J;  1SFE A;  2CW8 A;  2R92 A;  5JLW A;  1OCR H;  3J7Z I;  3H0D A;  1I1G A;  4F3E A;  1G8X A;  3K4N A;  5JLX A;  4Y33 A;  2CU7 A;  1SFO J;  2OCE A;  3NRV A;  1IS1 A;  2GWR A;  1QBJ A;  1BM9 A;  2MGQ A;  3KZZ A;  3QQA A;  3A2K A;  4RGU A;  1FNN A;  2WC2 A;  5E3M A;  2R7V A;  3V42 A;  1SD5 A;  2MA3 A;  4BJT A;  3EYY A;  3I0T A;  2HNH A;  1TL8 A;  3RKY A;  2PEX A;  4BU2 A;  2K9L A;  3DLL F;  5ICF A;  3U21 A;  4CCN A;  3WU0 A;  3JAM K;  2P0W A;  1H0M A;  1DDN A;  3HPH A;  4KMF A;  1ZAO A;  4BQO A;  2F5F A;  1UCR A;  3HBL A;  5J8F A;  3E1S A;  5DM6 F;  2DBB A;  4LLG F;  1JUS A;  2H6C A;  5FLV A;  1J9I A;  1DUX C;  2O8X A;  2W48 A;  2EIM H;  1O3S A;  3J7A O;  5JHF A;  1V9M A;  5BOX A;  3D5L A;  2X1C A;  4IXA A;  3C1D A;  2QEX I;  1VQO I;  5E1Z B;  4LD5 A;  3LOC A;  3OR2 C;  3OSG A;  2HI3 A;  2MAB A;  1I50 J;  3HKZ A;  3CC2 I;  2DA1 A;  5J4V A;  4AC0 A;  2GM4 A;  3FHZ A;  5JSN B;  1ZGA A;  4DNC A;  5IPA A;  1U0J A;  2X51 A;  5FKO A;  3JRE A;  2DMT A;  2P4W A;  2XAG A;  2A3S A;  2UV1 A;  3ZRG A;  4ITV A;  2H8W A;  2QZ8 A;  3OR1 C;  4N0B A;  1D0X A;  1NG7 A;  1Y1V J;  3MQ0 A;  4WWC A;  1NH3 A;  3A0H C;  2LP0 A;  4EMS A;  4JBA A;  4F93 B;  5ILV A;  3K69 A;  3OOP A;  2FRH A;  4GYG A;  4LOC A;  1D8J A;  2A61 A;  2NS7 A;  3C2G A;  3KEY A;  1I3Q A;  1X3Z B;  1BJZ A;  1JTY A;  2DCE A;  2OCC H;  2ISY A;  3BG3 A;  3F0C A;  5FKK A;  3HOT A;  1LEA A;  1WI9 A;  1WKM A;  3H5A A;  3WHC A;  2A6H F;  3P9C A;  4CYD A;  2A07 F;  3V7C A;  4E7J A;  2QSG X;  4Q48 A;  3G3Z A;  2DOF A;  2KIU A;  4KJZ A;  4RDU A;  2MBF A;  1G2H A;  4XN3 A;  1K4S A;  4DGW B;  2LNB A;  1YIJ I;  4PDK A;  2W1O A;  5MLC 9;  4HQM A;  2ESH A;  3OS0 A;  1P7J A;  2PMZ N;  2TCT A;  3I59 A;  3CC7 I;  4A3F J;  1YHQ I;  3RZO J;  1IXC A;  4Y52 J;  2R7R A;  3TED A;  3RQI A;  1RNL A;  3AFH A;  4DBR A;  3OL4 A;  2L7F P;  4W1U A;  3GYH X;  1I1S A;  3FWE A;  1EH7 A;  4BUP A;  2VPR A;  2Y69 H;  2FOW A;  2BXY A;  5C3E J;  2V1N A;  1SVL A;  3GWZ A;  4BXU A;  1X4P A;  4XKV A;  4HNT A;  4ESF A;  4O6J A;  2R7F A;  2V1U A;  4L9J A;  3V7S A;  3M4A A;  2QKL B;  3O6B B;  1LDD A;  1WFX A;  2EFW A;  1TT5 B;  2EV5 A;  2L4M A;  1OQY A;  3HB9 A;  2K27 A;  4X6A J;  2Z99 A;  5GAE J;  3FK7 A;  5AIP A;  3ASN H;  2KP6 A;  1FOW A;  3BQZ A;  5DEQ A;  3PO3 J;  4XON A;  4K2E A;  1TBX A;  3T8T A;  3GTK J;  2R7S A;  1WJ5 A;  3Q0U A;  3OS2 A;  3GME A;  5J1Y A;  2Q2E B;  4BXX J;  1G3Y A;  2ZKZ A;  1QVT A;  4XLA A;  1W5S A;  1B59 A;  4KMU X;  3BJO A;  1YTY A;  3OYA A;  2ELK A;  2VJI A;  4XID A;  2E5N A;  1F4K A;  1OCZ H;  1E2X A;  3BG6 A;  3I58 A;  3GTQ J;  1ONV A;  1EA3 A;  2CQK A;  3NEU A;  1QZE A;  3GZN B;  5KHD A;  4M6V A;  1T98 A;  3WTU C;  4CGZ A;  3BR1 A;  3BTJ A;  3GLX A;  3A1Y A;  3Q5F A;  2LKS A;  1MNE A;  4X1E A;  3FX3 A;  3RPQ A;  2K86 A;  1TC3 C;  4M3F A;  2EWN A;  2O03 A;  3BY6 A;  3H3U A;  3WHB A;  3GTM A;  4BHB A;  2YX4 A;  5L3B A;  1PP7 U;  2ZNY A;  3GTP A;  3GTL A;  3G2B A;  2WAQ N;  3M1C A;  3VFZ A;  1MBK A;  1SFU A;  4HLX A;  3ZPL A;  4IOC F;  2DU9 A;  3A01 B;  1IV8 A;  3WE3 A;  3E3V A;  3ONQ A;  3SEZ A;  2HDW A;  1QNT A;  3OOU A;  1Z0X A;  3LST A;  3CJN A;  3FMR A;  3QAH A;  4ON0 A;  4ENK A;  4NUB A;  2LSO A;  1MW7 A;  3QOE A;  2W57 A;  4ZDL A;  1GVJ A;  1BI2 A;  1JHH A;  1V3F A;  1YX5 A;  4LB6 B;  3K57 A;  2EIN H;  2F2E A;  2KRC A;  1WQH A;  1IW7 F;  4JLR C;  1K78 A;  3DU5 A;  1X4O A;  1GV5 A;  1IN7 A;  1HST A;  1LUJ B;  4A3J J;  1KQ0 A;  3Q9V A;  1QZZ A;  1LE8 B;  4X0G A;  4KYW A;  1UHW A;  2ZXH A;  2VXD A;  4V2G A;  3IWZ A;  1F43 A;  4WF2 A;  5FKN A;  4OIQ F;  1UMQ A;  3WVO A;  2EFP A;  1BC8 C;  2CQX A;  2HYF A;  5LLQ A;  2VLA A;  1R71 A;  3S2H J;  2ID3 A;  1ETX A;  4KC6 A;  4C3H J;  4D7M A;  1SFK A;  4XRF A;  2D5V A;  5FJ8 J;  2IW5 A;  3L1P A;  3JCU C;  1Z7L A;  2L3D A;  3FZV A;  2MD5 A;  1ZLK A;  2HDC A;  3LSK A;  1T0F C;  4Q5S F;  3ESW B;  2BV6 A;  2M0M A;  2BGC A;  1KYZ A;  3IAM 2;  1D0Z A;  3HSE A;  2DA6 A;  3IAS 2;  4JX4 A;  4RAZ A;  4RAG A;  5F0F A;  4IHX A;  1OYY A;  3HOX J;  3BLY A;  3GTJ J;  4S0H B;  3CP2 A;  4CO8 A;  5EF6 A;  3KET A;  1DD5 A;  4HV5 A;  3KLO A;  5D8L B;  1SAU A;  4B3A A;  1NK2 P;  3E5U A;  2EQR A;  1RRJ A;  2R7W A;  3GUD A;  3CME I;  1FY7 A;  5CVV A;  2LMD A;  1ZYR D;  1KON A;  1LFU P;  4KN4 X;  1R58 A;  3ZMD A;  2DFH A;  3E6D A;  3M8F A;  3K5N A;  1XD7 A;  4XLE A;  1BIA A;  2M45 A;  2DOE A;  3FXL A;  1MSE C;  4KT5 C;  1OKR A;  4BBS J;  2NNN A;  2OC6 A;  1I27 A;  1VF9 A;  3GZ5 A;  3VYU B;  2F4I A;  5E8I A;  1HC8 A;  3HIF A;  2DFI A;  2KHM A;  1B6A A;  2CQQ A;  5K7H A;  1UHM A;  3MN2 A;  3ECO A;  2JA8 J;  3SDB A;  3ZCO A;  4G94 A;  2E1O A;  3HRS A;  4PUS A;  2L9V A;  4OAY A;  1LNW A;  2W24 A;  2WAQ A;  2EIL H;  2CYY A;  2WB1 N;  5FLX Z;  1OPC A;  1QQI A;  4M9Z A;  1G59 A;  1X1D A;  2JRM A;  2Y0S A;  2VKV A;  3DKW A;  3B6A A;  1U8R A;  4BQA A;  4UVC A;  5LRR A;  3G1L A;  1RET A;  3PNY A;  4IZZ A;  2D45 A;  4RGX A;  2A68 F;  4D0P A;  1MBF A;  3RPU D;  4DBQ A;  2E7W A;  4IP8 A;  1K83 J;  2C6Y A;  3WE2 A;  1LE8 A;  1SMT A;  3PNT A;  1P7I A;  1ACI A;  2PQ8 A;  1W0T A;  3DBR B;  1ETW A;  4PCQ A;  4ZTJ A;  1VQM I;  2RAE A;  1HF0 A;  4JX6 A;  4M73 A;  1YJN I;  3TO7 A;  1S5L C;  1M1E B;  4YRV A;  4Y3O A;  1I6X A;  3VPR A;  2FA5 A;  2ID6 A;  2JUC A;  1S3J A;  2LTP A;  3F9K A;  3WGI A;  1YOV B;  1BI1 A;  3GVA A;  1R5H A;  2WTE A;  5LD2 C;  4UHT A;  1IRZ A;  1IZ1 A;  2QF7 A;  1IRF A;  3W2W A;  1IN8 A;  1RKT A;  5F27 A;  2H27 A;  4AIH A;  1YE9 A;  2R7Q A;  2XB5 A;  3I4P A;  4LIV A;  4UB8 C;  3L2W A;  3OYC A;  3F8F A;  2XV4 S;  3KCC A;  2EH3 A;  3KFW X;  3LQR A;  4MGR A;  1W36 D;  3K5O A;  1OR7 A;  4DZP A;  2ECC A;  5J1U A;  4RB0 A;  1OCC H;  2ZBK A;  3F21 A;  2XSJ C;  4IQJ A;  3EYI A;  1GT0 C;  3HHH A;  3R60 A;  1V5F A;  2QBY B;  3ZP5 A;  1B8I B;  2HDD A;  1LDJ A;  2VIX A;  1Q1V A;  3F8N A;  1BI0 A;  5GPA A;  3L2V A;  3DQV C;  3KZI C;  5EEG A;  3ZQC A;  1WQF A;  4LB5 A;  2P5L C;  1G6N A;  1R7J A;  5ILU A;  2IGK A;  1WH5 A;  4A12 A;  5CVJ A;  3GFM A;  1DGW Y;  2O8K A;  2OZ6 A;  1IN6 A;  3PJR A;  3F3X A;  1O3T A;  3I55 I;  3FIW A;  2FF4 A;  3B02 A;  4YFX F;  4BE1 A;  5LGT A;  1TWC A;  1TWH J;  1MGT A;  3M3Y J;  2FBK A;  3R0A A;  5EG0 A;  3R6S A;  1B9N A;  3TO9 A;  4I0B A;  3LF9 A;  1A6I A;  2FXA A;  3CUO A;  3RI4 A;  3QOP A;  3VOE A;  5IT3 A;  3RKQ A;  4CIC A;  5JR3 A;  3CCV I;  1V5G A;  3FMS A;  3NWS A;  3LSP A;  1EH1 A;  3TGN A;  3G1M A;  2DA3 A;  1O3Q A;  4LJZ F;  3RJP A;  1JKP C;  5EDN A;  1BR2 A;  3IH3 A;  5IYB J;  5HLH A;  4HNU A;  4NDL A;  2EZL A;  2OUM A;  3F23 A;  2O5J D;  1KGS A;  1XS9 A;  3MKL A;  4BDZ A;  2BZT A;  1XSX A;  1FYL A;  1XDS A;  1TW3 A;  1QZY A;  5BPD A;  1GXQ A;  2M7B A;  1KU3 A;  3OWT A;  2KZV A;  4A3B J;  1XGN A;  1BI3 A;  1Q1H A;  2Y30 A;  2ZME A;  3IRR A;  3MVP A;  2B0L A;  1W5C C;  5GTI C;  1MMA A;  4O3M A;  3HC7 A;  1REP C;  5DTD A;  1R5Z A;  3D5S C;  3DBH B;  5TGT A;  1YNN D;  2ADU A;  3B73 A;  3CCS I;  4A3K J;  3HOW J;  3QYF A;  1X2N A;  1RPW A;  4RLQ A;  4XK4 A;  5H2F C;  4KDP A;  2IRF G;  2DQL A;  3H0G A;  2UUZ A;  4O26 A;  4XLF A;  4MQ9 F;  3ZR8 X;  2XC7 A;  1A31 A;  3DWL E;  4JQF A;  4KAW X;  1KU9 A;  1WRJ A;  2DO7 A;  4A2U A;  3LSI A;  5IP7 J;  1OMI A;  1SD4 A;  3H36 A;  1RKW A;  4H4K C;  3SXY A;  4R79 A;  5CVR A;  1RI7 A;  3BG9 A;  2R7Z J;  1OJL A;  4AUX A;  1ZHF A;  3CMA I;  1JHF A;  3QP5 A;  3QWL A;  2YR2 A;  4M3B A;  1DU6 A;  4L9V A;  5CJ9 A;  5H6R A;  5E17 F;  4L5J A;  1BR4 A;  5EGO B;  1MJA A;  1PUF B;  3CCE I;  3BOQ A;  3K10 A;  5IOY A;  1QPI A;  2L01 A;  1GV2 A;  4BHP A;  3S3N A;  3H3Z A;  3V8L A;  4FQG A;  1R49 A;  3RQ4 A;  3K1N A;  3WGG A;  5LEJ A;  3LSG A;  1ZRD A;  1KU2 A;  3BR0 A;  4BY7 J;  3VWB A;  3H9Q A;  2K9N A;  4XR6 A;  3S14 J;  2QQ9 A;  2BXZ A;  1GE9 A;  4U7D A;  1Z91 A;  4QPQ A;  1S7O A;  3GCM A;  2CQN A;  2J5O A;  5EZH A;  1O7L A;  4ZTF A;  4HDV A;  1WCM J;  4PGG A;  2GA2 A;  4U88 A;  5K1Y A;  3I5U A;  3MKZ A;  2HTS A;  1PUE E;  4F52 A;  2KFD A;  5J3L A;  1IV6 A;  2PMU A;  3FKJ A;  4ZYH A;  3HJE A;  2CW0 D;  2A6E D;  4IHY A;  2BE5 F;  3I4N J;  2PMH A;  4ZYD A;  2DMN A;  2HZT A;  1MSF C;  2KQR A;  3K4B A;  4LMO A;  3HOZ J;  2X6X A;  3I54 A;  4P5O A;  2HOE A;  5HNF A;  2IEK A;  2V26 A;  1TWA A;  2JVG A;  3C2H A;  1JGG A;  1TZL A;  2TDX A;  4YFK F;  1BIB A;  2VL8 A;  2VPL A;  1MBH A;  4CUG A;  4TV7 A;  3ZQ7 A;  4R8H A;  2XSD C;  4UNO A;  3VYR B;  2LLK A;  3KP4 A;  4I6Z A;  4UVA A;  1FOX A;  1K4T A;  1FBQ A;  1WWX A;  4A6D A;  2L4A A;  2V9P A;  4DYR A;  3GTG A;  2L9R A;  2V7F A;  1ON2 A;  4YG2 F;  1VTN C;  2KDO A;  3RYR A;  4LIT A;  1JUP A;  2ZJ2 A;  2AXL A;  2NVY J;  2DDA A;  1JUM A;  2LDU A;  2NRA C;  2XRO A;  3H3V K;  4ABZ A;  4EJ3 A;  1IG7 A;  3DCF A;  1IF1 A;  5J8C A;  4L8I A;  2JA5 J;  3LSJ A;  5D4S A;  4KIB A;  3WTT C;  4EQQ A;  4HRI A;  2BVM A;  3AG2 H;  3ZMS A;  3HKZ N;  1HKS A;  2AHQ A;  4CCJ A;  4FET A;  3ML6 A;  3TDZ C;  3JRD A;  4I2O A;  3K6G A;  2JT1 A;  3CP8 A;  5CPR B;  2PN6 A;  1LEB A;  4AVP A;  3I9V 2;  3HUG B;  2XGD A;  3J80 Z;  2IVM A;  2XGX A;  4MTD A;  1MNM C;  5F6F A;  2CS3 A;  2P5V A;  1VQP I;  2L0K A;  3LMM A;  1WZ2 A;  2OTL I;  4M72 A;  3CF5 F;  1UHS A;  1XMK A;  1X58 A;  2DOD A;  1MKM A;  3DTI A;  5CLS A;  5J1R A;  4LLN A;  1XN7 A;  1V54 H;  1YYV A;  2VKH A;  2IGM A;  5E1W A;  2ACJ A;  3KIO A;  4DYQ A;  1XSD A;  2R7T A;  3TW6 A;  3I56 I;  3SQN A;  4CCL A;  1BN5 A;  2FEZ A;  1EJ9 A;  3W6K B;  2KJB A;  1SAN A;  1AHD P;  4A5M A;  3GO5 A;  2ESN A;  3K4K A;  2R4G A;  3A4C A;  4YEL A;  4BQN A;  2BHZ A;  3CJR B;  1I6V D;  1P4A A;  1IXR C;  4RMN A;  4EM1 A;  3JSO A;  5LHH A;  3A02 A;  2XPW A;  4UUT A;  3VDX A;  5JSB B;  1YI2 I;  3OYL A;  3FM3 A;  5IOZ A;  4ENN A;  4D3Z A;  1MDM A;  2ZFU A;  3MKW B;  3E6B A;  5HS9 A;  4XKC A;  3BTI A;  2CUF A;  3I59 B;  2IS1 A;  5KAF C;  2CUZ A;  4BJ5 C;  3AG1 H;  1IUY A;  5D5V B;  1Y69 8;  3OS1 A;  5EZG A;  2NVX A;  2LYC A;  3QP6 A;  4B4C A;  4HF1 A;  2N8G A;  1ETV A;  3CCQ I;  4P96 A;  4KIS A;  4GCV A;  3PUB A;  2BW3 B;  3HTS B;  3BRO A;  1ENH A;  2FBI A;  1AWC A;  1KQ8 A;  1Z3X A;  4U7B A;  1YRN A;  4F55 A;  2ZCW A;  2BY3 A;  4RGS A;  4CZC A;  3TL4 X;  3OIP A;  3HOS A;  1STZ A;  3GF2 A;  3SJM A;  3T0Y A;  2DT6 A;  1WHU A;  3DLA A;  3TDU C;  4RB3 C;  2V1X A;  2R7D A;  1T39 A;  3TOA A;  5M5Y J;  3TW7 A;  4UUS A;  3K4J A;  2F4O B;  2OF7 A;  3SZP A;  2ZO4 A;  5H20 A;  1Y39 A;  2DXI A;  3HUG A;  3IKV A;  3KE2 A;  2VQG A;  2M4K A;  2GA1 A;  4U0V A;  4RGR A;  1B4A A;  1WJC A;  3BPV A;  4LFU A;  3MAJ A;  2VXZ A;  2K3P A;  2WY8 Q;  3ZN1 A;  4PSW A;  2MLG A;  1HXD A;  3HPG A;  5AIQ A;  1JT6 A;  3S8P A;  4RBO A;  2ZXI A;  1R1V A;  4OIN F;  4IQ4 A;  3ZQQ A;  4CH7 A;  3ABT A;  3H35 A;  1APL C;  2Z9O A;  1SMY D;  4HZF A;  2WAE A;  2QUF A;  3VYS B;  2R93 J;  1NK3 P;  2VQH A;  4C2M J;  1VI0 A;  3G6E I;  1HDP A;  4L0Z B;  1SVO A;  1MMG A;  1JJ6 C;  2B63 J;  2DFE A;  2MH2 A;  3DBL B;  2MW8 A;  4Y17 A;  3I53 A;  1FPQ A;  4A3C J;  4ZJZ A;  1SEU A;  1OIS A;  2Y0M A;  4QLC U;  2F5D A;  3HEF A;  3ZN0 A;  1TW2 A;  1XSV A;  3V7R A;  1G3W A;  3K9T A;  2JN6 A;  4E7I A;  1DGR M;  2VUM A;  3FXU A;  3K4C A;  3KEQ A;  5EJC A;  2HKO A;  2LY1 A;  4HOB A;  1C0W A;  3TO6 A;  3U1D A;  3WTS C;  1ZN2 A;  5D8K B;  1SD6 A;  4A3E J;  4HDU A;  3W6J B;  3Q0W A;  4MEX F;  5FLX K;  2LF7 A;  3H92 A;  3H9J A;  4EVI A;  4AVZ A;  4IEJ A;  3PIP F;  3DF8 A;  2LY2 A;  3KP5 A;  3ERM A;  4FIS A;  1ZEL A;  1XCB A;  1DQU A;  1LVK A;  2OZU A;  4R1H A;  3WTY C;  3TMO A;  3JRI A;  2RNJ A;  1H8A C;  3P9I A;  1W7P D;  2F48 A;  5K7Z A;  3HDD A;  2VBY A;  1K78 B;  2HOA A;  2R0Q C;  2IA1 A;  2FSW A;  1YX3 A;  2BW3 A;  4EJT A;  5J40 A;  2DJI A;  1D5V A;  3DTE A;  2ELH A;  4M9X A;  3JRC A;  2PI0 A;  1WJE A;  1Z1D A;  5CQE A;  1WCM A;  1OLT A;  4C3J J;  4XMY A;  3CC4 I;  3CMY A;  1X2M A;  2V4J C;  4NC7 A;  3VOD A;  1OCO H;  2CRG A;  1F9N A;  3DEE A;  2BVL A; 
#chains in the Genus database with same CATH homology
 4OAY A;  2WAQ A;  3LSH A;  4XLC A;  2GOM A;  4LIU A;  1T95 A;  4RM3 A;  1E0E A;  2XDV A;  4IKF A;  3W2A A;  4XOR A;  3SEQ A;  1G59 A;  4NNJ A;  1WJF A;  1X1D A;  2Y0S A;  4KT6 A;  3AL0 C;  2CV1 A;  1A35 A;  3PNY A;  4IZZ A;  1TWH A;  1TT0 A;  1WJA A;  2XF6 A;  1MMD A;  3IAY A;  4QPO A;  4FGU A;  5KNL A;  2F4Q A;  3RPU D;  2MYS A;  4YEJ A;  4DBQ A;  4KIT B;  3E0J B;  4IP8 A;  4B44 A;  2X85 A;  1TWG A;  4QIW A;  3PNT A;  3OYD A;  2ELJ A;  4BJ6 C;  4ZTJ A;  4PK4 A;  2JA7 A;  2IS2 A;  1W36 C;  2L7K A;  1HQM D;  2CUJ A;  4E4H A;  4YRV A;  2W00 A;  4Y3O A;  1X19 A;  3DKY A;  3OYG A;  4H3T A;  3F9K A;  2R7X A;  3HG9 A;  1D1B A;  4PJM A;  5LD2 C;  4PUS A;  1FMV A;  3RTR A;  2L9N A;  1SC7 A;  2JA5 A;  3W2W A;  2YU9 A;  1YE9 A;  2R7Q A;  4LIV A;  3L2W A;  1RR8 C;  3OYK A;  1Z21 A;  3OYC A;  2E1M B;  4XLH A;  3FBN B;  3UNG C;  1W36 D;  2B9S B;  4P1W A;  3K5O A;  2M3A A;  2VB6 A;  2XSJ C;  4IQJ A;  2CH0 A;  4D9J A;  1LKX A;  1V5F A;  4PSX A;  4KB4 A;  2E2I A;  2VIX A;  3EPZ A;  4IX7 A;  3L2V A;  3OYI A;  3DQV C;  1N78 A;  3DKX A;  2X1E A;  3DPU A;  1WQF A;  2BE5 D;  4AN8 A;  3GTO A;  4G6T B;  2IGK A;  3SYT A;  3DU6 A;  4HG2 A;  1ERD A;  1DGW Y;  2MC4 A;  3PJR A;  2LRD A;  5LFA A;  3OYE A;  4BE1 A;  4BQQ A;  1TWC A;  4NOK A;  4PJL A;  4FYD A;  4U87 A;  3BCA A;  1NG6 A;  2HQA A;  2LOO A;  3RSN A;  2IGO A;  4F91 B;  3NWT A;  1YNJ D;  2VQL A;  2XF5 A;  5CKT A;  3LF9 A;  1BOB A;  1X1B A;  3BC8 A;  2R7Z A;  4BL0 B;  2KLO A;  4II2 A;  1V5G A;  2LBF A;  4J01 A;  3NWS A;  4BE0 A;  3PNV A;  4GRI A;  1EH1 A;  3DTK A;  1X1A A;  4KB2 A;  3H5R A;  4E6K G;  1Y1W A;  4F92 B;  3MMY B;  3CQZ A;  2DOA A;  1VZ0 A;  1BR2 A;  3FKI A;  4HNU A;  1Y6I A;  2OUM A;  3PL8 A;  2O5J D;  2E60 A;  4HPQ A;  4BDZ A;  3AKZ A;  3K5L A;  3MKY B;  4DOZ A;  2L9S A;  2WBM A;  2JSP A;  2M7A A;  4JOM A;  2JA2 A;  3L2R A;  2LRE A;  3K58 A;  2M7B A;  4B3X A;  3OWT A;  1SFO A;  1Y56 A;  4C30 A;  2BOL A;  2KZV A;  4AU7 A;  4ZDO A;  2A6H D;  2CW7 A;  4CA0 A;  2ZSH B;  4B47 A;  2HZD A;  1EK8 A;  2W7N A;  1ISE A;  4XQF A;  2A6T A;  4ZDP A;  4XKB A;  4NOM A;  3FBI B;  2X6W A;  1MMA A;  3CMM A;  3SJR A;  3W3C A;  2Z2S B;  3HC7 A;  4ANJ A;  3OYF A;  1R5Z A;  3MAQ A;  3D5S C;  4KDD A;  5TGT A;  1YNN D;  2CFO A;  2DT7 B;  3QYF A;  1A36 A;  3RCO A;  1MIU A;  1IRX A;  4RLQ A;  1UG0 A;  4C2U A;  3CZ6 A;  3H0G A;  3CF2 A;  3FDY A;  2UUZ A;  3P9A A;  4PFP A;  4O26 A;  4XLF A;  2E2H A;  2Q1Z B;  2LBF B;  3ZR8 X;  2OV7 A;  2Z16 A;  2XC7 A;  2Z1D A;  3DWL E;  4JQF A;  4OAZ A;  1QU3 A;  4KAW X;  1A31 A;  4QCL A;  3VYT B;  3LSI A;  3K5M A;  2AQE A;  1S9H A;  2VQC A;  4H4K C;  4R79 A;  1I50 A;  1HA8 A;  2M4G A;  4BDY A;  2V6E A;  4NOL A;  3I3L A;  4CCK A;  4CSW A;  1QHG A;  3K4L A;  1BR4 A;  3KX2 A;  1WJD A;  3H5N A;  1PJR A;  2F6C A;  1Y1V A;  3DPL C;  3K10 A;  3S3N A;  2R93 A;  2CW8 A;  2R92 A;  3TBI A;  4F3E A;  1R49 A;  2R7O A;  3RQ4 A;  3H0D A;  1G8X A;  3K4N A;  2NVY A;  3LSG A;  2RNG A;  2WA0 A;  1X1C A;  4Y33 A;  3H9G A;  3H9Q A;  3VWB A;  1IS1 A;  4XR6 A;  1GE9 A;  3A2K A;  2R7U A;  2NOJ B;  4QPQ A;  4BEH A;  2CV0 A;  2IGN A;  5HVQ C;  2IS6 A;  3LFU A;  4HST A;  2R7V A;  3V42 A;  4BJT A;  4OWR B;  2KPM A;  2HNH A;  2CV2 A;  4ZTF A;  2AQF A;  1J09 A;  2X6Y A;  4XN0 A;  1TL8 A;  4BU2 A;  3MKZ A;  2K9L A;  1PYV A;  4NC8 A;  4Q5V A;  2WAD A;  4F52 A;  3U21 A;  4CCN A;  5HOO A;  2P0W A;  3FKJ A;  2CW0 D;  3HPH A;  2A6E D;  4BQO A;  4XL9 A;  3ZGK A;  3E1S A;  4OYD B;  2KQR A;  3K4B A;  4LMO A;  2V9K A;  5JHF A;  1V9M A;  3OYN A;  2X6X A;  4P5O A;  5HNF A;  3D5L A;  3W2V A;  2X1C A;  2V26 A;  1TWA A;  3EUK L;  2JVG A;  3C2H A;  1N75 A;  1TZL A;  2CMP A;  3OR2 C;  4ZC3 A;  2MAB A;  2VL8 A;  3HKZ A;  2VPL A;  4CUG A;  1WJB A;  1MND A;  3OMY A;  4HEA 2;  3OYM A;  1JI8 A;  5JSN B;  3VYR B;  2E5Z A;  1U0J A;  2X51 A;  4NQW B;  1Z3Y A;  3OYB A;  2RQQ A;  3SZG A;  1K4T A;  3UR3 C;  2PMZ A;  2UV1 A;  4GFQ A;  3ZRG A;  4ITV A;  3GTG A;  1IW7 D;  3OR1 C;  2V7F A;  4BEH B;  1D0X A;  1WQG A;  1NG7 A;  1TGO A;  1NH3 A;  3IP4 B;  2XAU A;  2KDO A;  4F93 B;  4LIT A;  2HVR A;  1GLN A;  3GTK A;  3C2G A;  3KEY A;  4E7K A;  1I3Q A;  4EJ3 A;  1AA7 A;  2DCE A;  2IXS A;  4HSR A;  4MLO A;  3HOT A;  3FHN A;  2L2O A;  2LG4 A;  3H5A A;  1TWF A;  4L8I A;  3GTQ A;  4E7J A;  4N4O B;  4C9Y A;  2BVM A;  2WY7 Q;  4HRI A;  4IP9 A;  4KJZ A;  2KRH A;  2A69 D;  4CCJ A;  3L2U A;  4FET A;  3EUA A;  3K6G A;  4XN3 A;  1K4S A;  4DGW B;  3CP8 A;  5CQG A;  5CPR B;  2W1O A;  5MLC 9;  1BR1 A;  2HVS A;  3I9V 2;  3HUG B;  3OS0 A;  4BXF A;  5KCM A;  3AL0 B;  2CS3 A;  3LMM A;  5FRO A;  3S3O A;  3HXL A;  2R7R A;  3DTI A;  2FUG 2;  4B43 A;  3AFH A;  4D3Y A;  4DBR A;  3OL4 A;  2GOX B;  4DIQ A;  3OIQ A;  4BUP A;  2V1N A;  4Q5G A;  2VKH A;  1X4P A;  4D1Q A;  2IGM A;  4XKV A;  4HNT A;  2R7T A;  4CCL A;  1EJ9 A;  4E7H A;  3S3M A;  3M4A A;  4XM3 A;  2QKL B;  4PJJ A;  4XNF A;  1WFX A;  3VSL A;  4BGD A;  2HVQ A;  4CCM A;  3K4K A;  2R4G A;  2MFZ A;  2XF7 A;  3A4C A;  4YEL A;  2VAS A;  1FMW A;  4BQN A;  3CJR B;  2A5W A;  3EUH C;  2KP6 A;  1I6V D;  1UEL B;  4XON A;  3OY9 A;  1P9Q C;  4RMN A;  2R7S A;  2UWM A;  1WJ5 A;  3OS2 A;  4E7S A;  2Q2E B;  3VDX A;  2HU9 A;  5JSB B;  3KYL A;  3OYL A;  4C2M A;  2VJJ A;  4XLA A;  4BS9 A;  4D3Z A;  2JVH A;  3OYA A;  2ZFU A;  3MKW B;  2VJI A;  4N4N B;  2E5N A;  2B63 A;  1MMN A;  2MD0 A;  4XKC A;  3BG6 A;  3QYE A;  4LG3 A;  1EA3 A;  2VJ4 A;  2IS1 A;  3D5R C;  2A68 D;  2CUZ A;  3PSF A;  4BJ5 C;  3PFY A;  3S32 A;  5KHD A;  3LHP S;  1Y69 8;  3OS1 A;  2NVX A;  5HLT A;  2LYC A;  3A1Y A;  1N77 A;  1MNE A;  4KIS A;  2PJR A;  3PUB A;  2BW3 B;  3J7A Y;  2KMU A;  3GTM A;  4J00 A;  3CJQ B;  1DP3 A;  1D1C A;  5FRM A;  3HL2 A;  1Z3X A;  4U7B A;  4F55 A;  3K70 C;  3GTP A;  4RM2 A;  3GTL A;  3G2B A;  4CZC A;  3M1C A;  3TL4 X;  3OIP A;  4II3 A;  5HNH A;  3HOS A;  3GTJ A;  2DT6 A;  3DLA A;  3ONQ A;  3SEZ A;  2HDW A;  3OOU A;  3K4J A;  4NUB A;  4AYB A;  1MW7 A;  1LFP A;  3OYJ A;  3QOE A;  2DXI A;  3GBG A;  2VQG A;  2M4K A;  4ZDL A;  3OL3 A;  4E7L A;  2RRE A;  4CCO A;  1WJC A;  1YX5 A;  3K70 D;  2I8D A;  3QOD A;  2VXZ A;  4DJA A;  3K57 A;  2K3P A;  2WY8 Q;  1D1A A;  4PSW A;  4FAS D;  2KRC A;  1WQH A;  3HPG A;  4JLR C;  3DU5 A;  1X4O A;  2LH9 A;  3BG7 A;  2ZXI A;  3S8P A;  3CES A;  4IQ4 A;  4C2T A;  1QHH D;  1R6R A;  3N05 A;  3ZQQ A;  1UAA A;  2E1M C;  4CH7 A;  3H35 A;  4BE2 A;  1SMY D;  4AHC A;  4X0G A;  4XOP A;  2WAE A;  2ZXH A;  2VXD A;  3L2Q A;  3VYS B;  1V5E A;  2VQH A;  2ZSI B;  2PJR B;  2F5V A;  3IUO A;  3WVO A;  1D0Y A;  1MMG A;  4FXD A;  2JA6 A;  2VLA A;  4KC6 A;  4ZJZ A;  1SEU A;  1SFK A;  4PFO A;  2K9M A;  4E7I A;  1Z7L A;  1DGR M;  2VUM A;  1LDK B;  3K4C A;  4PJN A;  3LSK A;  2LY1 A;  2VJ5 A;  1T0F C;  1K83 A;  2VKD A;  2M0M A;  3S93 A;  2HPI A;  2IS4 A;  3H9J A;  3IAM 2;  1D0Z A;  3IAS 2;  4AVZ A;  3BCB A;  2W4S A;  2LY2 A;  2X1D A;  3BLY A;  3OYH A;  3CP2 A;  4E7Z A;  2WB1 A;  1DD5 A;  1R9T A;  1ZEL A;  4XOT A;  4XKW A;  1DQU A;  1LVK A;  3TMO A;  1LPQ A;  1SAU A;  2WAF A;  1Q8I A;  3K4M A;  3LSM A;  1RRJ A;  4EAT A;  2R7W A;  1T8I A;  3M8J A;  3DPT A;  2K5C A;  1ZYR D;  2JUG A;  1KON A;  3LL7 A;  3PSI A;  1YX3 A;  2BW3 A;  2O5R A;  2DJI A;  3DTE A;  3K5N A;  4RLF A;  4XLE A;  4F3Q A;  4B48 A;  1WJE A;  5FRN A;  1OR7 C;  2OC6 A;  5CQE A;  1WCM A;  1OLT A;  3VYU B;  2F4I A;  4ZYA A;  4XMY A;  2KHM A;  2L5Q A;  3VSK A;  2HPM A;  3QYB A;  1K6Y A;  4Y4R A;  2V4J C;  4NC7 A;  3ZXS A;  3MD2 A;  2LC2 A;  5C9H A;  4BAC A;  3K59 A;  3SDB A;  3ZCO A;  2QKM B;  2KL4 A;  3DEE A;  2W82 A;  2BVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...