1ISEA

Crystal structure of a mutant of ribosome recycling factor from escherichia coli, arg132gly
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
ISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVGRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a mutant of ribosome recycling factor from Escherichia coli, Arg132Gly
rcsb
source organism Escherichia coli
molecule tags Translation
molecule keywords Ribosome Recycling Factor
total genus 65
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1iseA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1iseA02
3OEPA 4GFQA 4KC6A 3FOFA 4G0VA 3L4JA 1EK8A 3ERED 4JLRC 3L4KA 5MLC9 1WQGA 2RGRA 4OYDB 1GE9A 1B4AA 4KB2A 1ISEA 1XXCA 2Y3PA 3BUEA 3MMLB 5JVOA 3VA7A 4L8IA 2P5MA 3LHPS 1WIHA 2PHCB 3FHZA 4KAWX 4KB4A 3LAPA 1DD5A 5JSNB 5JSBB 1F9NA 3CAGA 1Y698 3QX3A 3NUHA 1BJTA 2XCRB 1XXBA 1EH1A 1IS1A 3LAJA 4KDDA 4G0WA 1AB4A 3V4GA 1WQFA 3OPFA 4J3NA 5CJ9A 4FM9A 3FOEA 1BGWA 1B4BA 3OREA 2XCQA 1XXAA 2KWAA 2XCOA 3LPXA 1ZVUA 4G0UA 1WQHA 4DDQA 3LF9A 2ZFZA
chains in the Genus database with same CATH superfamily
2NVYA 3S1MC 4Y7NC 3L4JA 4Y52K 3DU6A 1T8IA 4BBSC 3WODA 1I50A 1YCLA 2Y3PA 3BUEA 4FYDA 4YFXA 2E2HK 4KAWX 4BY7C 1HQMD 2WAQL 3NUHA 4BBRC 1R9TK 2FQTA 4A3IK 4WJ3M 5CJ9A 2JA5C 5IYDK 2PPBA 1TWHA 4WJ4A 1WORA 4GTAA 3TTGA 1ZXOA 1WQHA 2E2JC 4OIPA 1R5ZA 2NVYC 1IQ0A 5FJ8K 5IYBK 5C44C 2W7VA 5MLC9 2E2IA 3JSTA 1EFWA 3S17C 2R7ZA 5E68A 2Y0SL 4H3TA 4G7OA 1RRJA 1L0WA 4EJ3A 3GTOK 1DCOA 4MEXA 1EH1A 3M3YC 2EBBA 1I6HC 5M5XK 1B4BA 1HI9A 2A68D 4QJVB 4DDQA 3GTQK 3GTGA 4A3CK 3HKZA 3I4NC 4OINA 1EK8A 4XSZA 1A35A 4BBRK 1R9TC 4KARA 3DU5A 3K59A 3DXJA 4P9SA 3HOUC 4QIWL 5JVOA 4KASA 3GTLC 4C3JC 4BXXK 4X6AK 3M4AA 5CQGA 3HOVK 5HL8A 4C3IK 1WQFA 3OREA 2GAGC 1SFOA 1IW7A 3GTKK 1Y1WA 5IYCC 1WSRA 4FXDA 5TMCA 3BP8C 1VLOA 1VJEA 4C45A 2A69D 1USOA 1XZPB 3K7AC 2B63C 3S14C 3KYLA 1UV7A 4O2DA 4XLNA 3SZYA 2JA5A 1X31C 3BP3A 1WOPA 1WSVA 2PHCB 1EJ9A 3HOVC 4C3IC 1Q8IA 1F9NA 3HXAA 5D4DA 4LK0A 1R49A 1INNA 1BS2A 5JFEA 4OIQA 1Y1VK 4QIWD 2Y0SA 3GTKC 3S1NK 1IBAA 1XZQB 1VRQC 4AYBA 1PJ6A 4QJVA 2VUMA 3GSIA 4OIRA 4LMOA 4QCLA 4KN7A 1DCHA 3HOYK 3GDZA 1B4AA 3LHPS 4AHCA 2JA7K 5C44K 1TWGK 5IYBC 4LK1A 3LAPA 5C4XK 1K4TA 2R92C 3A8JA 3TFHA 4A3DC 1BJTA 3ADAC 1XXBA 4A3IC 2NVQC 1SMYD 4KDDA 4AN8A 3GTPA 5IYDC 5IP9C 2A6HD 3SZZA 1TWCK 3HOWC 1JQWA 1XXAA 3GTJA 3M4OC 2XCOA 5M5YK 2GSUA 2NVYK 3AD9C 3K5OA 3H3VL 4JK1A 5EGEA 5IP7K 3S2HC 1I3QC 3CQZA 1F93A 3FKIA 1I3QA 5CHPA 3L4KA 3H0GK 1KQ4A 1GE9A 1RR8C 5C3EC 1TWFA 2JA7C 4Q5GA 3S17K 2CW0D 4KMDA 4MEYA 3K58A 3S1NC 1V9MA 2R92K 2CFAB 3A8KA 5JSBB 2V6UA 3QX3A 2R93A 3GEHA 2O5JD 3T02A 4NOKA 2NVXK 3LF9A 3CQZC 4BY1C 3AH5A 3TFIA 4C3HC 3FOFA 2YU9C 5C3EK 2CW0A 4O26A 1K83C 1PJ5A 5IYCK 1XXCA 2R7ZK 2PA8L 3GTLK 3GTPC 2O5IA 3AD8C 4G7HA 4KN4A 4BKWA 3CAGA 5IP7C 3S2HK 4GTLA 2A6ED 4LLGA 2WAQD 4LJZA 4G0VA 3K7AK 1EI6A 2A6HA 4KMUA 2VUMC 1TL8A 1JOEA 4JLRC 4OYDB 4KB2A 3GIRA 3MMLB 2E2JK 4A3LC 1XPPA 1YX2A 3FHZA 4NOMA 2PA8D 2RH6A 1NH3A 5FLMK 1AB4A 1Y1VC 2FQOA 1TWGC 4FM9A 1ZYRD 4A3KC 1ZBSA 4M1XA 2E2HA 1O2AA 1RU0A 1Y1WK 1TWHK 4YG2A 1TWAC 2KWAA 4A3BK 3N0BA 4A3GK 3WVOA 3GTMA 4XCHA 3T01A 3GTOC 4GFQA 2V6TA 1R9TA 1O29A 5M3FK 1WCMA 1VGXA 3HOYC 1I6HK 2JA8C 3S1QC 1XZQA 1J6XA 3GTJK 4C2MA 4AH6A 1V5VA 3RZDC 5C4XC 1DD5A 2PMZA 1BDFA 5FLMC 1Y698 4KM9A 1IW7D 2XCRB 4A93C 3S2DC 1J6VA 1TWAK 4A3BC 3FOEA 2A69A 5C4JK 3H3VD 3HOWK 3AQPA 3M4OK 2GSOA 3AQOA 1SEUA 3OEPA 4Y52C 5M5WK 4A3MK 4BBSK 1SC7A 3GTOA 1JVIA 2A6EA 1F7UA 2D6FC 1XZPA 1WCMC 2A68A 3S15K 1I50K 2JA6A 3I4NK 4AYBL 1HQMA 1TWGA 2NVTC 3GTQA 4XLPA 4NOIA 3HOUK 1TWHC 2GSNA 3S2DK 4D3YA 1WOOA 2BE5D 3GTPK 3V4GA 5C4JC 4FZBA 4GTBA 4LOWA 4PABA 3K5LA 4A3MC 2E2IC 1IL2A 4MQ9A 3H0GC 3LPXA 1O27A 4IP8A 2CFAA 2ZFZA 4C3HK 1I50C 3CQZK 4BY1K 3GEEA 3RZDK 3S0XA 2WB1L 3H0GA 2B9SB 1TWFK 4YFKA 3PO2C 2ZUFA 1F7VA 1SFOK 3GTKA 4L8IA 2JA5K 3HOZK 2BE5A 4KB4A 1I6VA 4LQYA 2R93K 5IOTA 3GTGK 4IP9A 1O24A 1USMA 2R4GA 1J6WA 1VH2A 4Q5SA 2YU9K 2PMZD 2V6SA 5C9HA 3GTQC 4FGUA 4QIWA 3HKZD 1K83A 2JA6C 4OIOA 2Y0SD 2B63A 4BLBA 1EQRA 4KC6A 1WOSA 4LR2A 2WB1A 4A3KK 3S1RK 2VUMK 3PO2K 2F4QA 1Y1WC 4C3JK 1I6VD 1WIHA 4NOLA 5IOSA 5JSNB 4P5BA 5IOQA 3LAJA 3I4MK 3S16K 3OPFA 1YNND 1J98A 1TWFC 3MAQA 2JA7A 2XCQA 1TWCA 4F3EA 5IP9K 1O2FB 4G0WA 4PAAA 1G51A 3S1MK 3GTMC 3ERED 4ILDA 3HOXC 1TGOA 1TWAA 3RZOC 1I3QK 2NVXC 3S1QK 1O25A 3TFJA 3VA7A 3GTJC 1A36A 2E2HC 4A3FK 4BLAA 2R92A 1YNNA 1YNJD 1C0AA 1Y1VA 2WAQA 3SJRA 3S1RC 2NVTK 1PJ7A 2PMZL 3PO3C 4A93K 2R7ZC 1K4SA 3K5NA 4Y7NK 2O5JA 4YFNA 1LPQA 3N3YA 3Q3QA 3HOXK 4GTEA 3EQLA 4WILA 1WCMK 3N0CA 2GAHC 1WQGA 2RGRA 4GT9A 3S16C 2P8TA 2WB1D 2P5MA 4ZH4A 4A3EC 1DCPA 1SMYA 1ZYRA 2NVQK 4GTDA 3K5MA 3A8IA 3M3YK 3G4CA 2JH3A 4J3NA 1A31A 4X6AC 4A3LK 2E2IK 5L46A 4KATA 3RZOK 4GZYA 3S15C 4G0UA 4A3CC 4P5AA 4A3JC 3FKIK 2ZUEA 3HKZL 3GEIA 2JA6K 2YU9A 4AYBD 4A3DK 4A3EK 5EGHA 3HOZC 5TMFA 4GTFA 4G7ZA 1SFOC 4BXXC 1TWCC 2B63K 3AD7C 3IPJA 2R93C 1ZQ1C 2JA8K 1IS1A 4XSXA 2NVXA 1BGWA 3T00A 1O26A 4GTCA 1YNJA 4RMFA 4BY7K 3GTLA 1ZVUA 3FKIC 4C2MC 3G4AA 5TJ3A 4A3GC 1O2BA 4D3ZA 4Q5VA 4KMHA 3S14K 5M3MK 3GTGC 1ISEA 5IORA 3K57A 1O28A 4KMAA 3GTMK 1IE0A 3P9AA 1MIUA 3IAYA 4Q4ZA 4A3JK 3I4MC 4A3FC 4C2MK 1K83K 4KM8A 3PO3K
chains in the Genus database with same CATH topology
4GFQA 2NVYA 1R9TA 4LMOA 4QCLA 1O29A 3L4JA 3ERED 1WCMA 4ILDA 3DU6A 1T8IA 1TGOA 1TWAA 1I50A 1B4AA 1O25A 2Y3PA 3BUEA 4C2MA 4FYDA 3VA7A 3LHPS 4AHCA 1A36A 4KAWX 4BLAA 3LAPA 1DD5A 2PMZA 2R92A 1HQMD 1K4TA 1YNJD 1Y698 1Y1VA 4KM9A 2WAQA 1IW7D 3NUHA 1BJTA 2XCRB 1XXBA 3SJRA 1SMYD 4KDDA 4AN8A 1K4SA 3GTPA 5CJ9A 3K5NA 2A6HD 3FOEA 1TWHA 1XXAA 3GTJA 4GTAA 2XCOA 3AQPA 1LPQA 1ZXOA 1WQHA 2GSOA 1SEUA 2GSUA 3AQOA 3N3YA 3K5OA 3OEPA 3Q3QA 1R5ZA 4GTEA 5EGEA 1SC7A 3GTOA 3CQZA 3N0CA 3FKIA 1I3QA 5CHPA 5MLC9 3L4KA 2JA6A 1WQGA 2E2IA 1GE9A 1RR8C 1KQ4A 1TWFA 4GT9A 2RGRA 4Q5GA 2CW0D 4KMDA 1TWGA 2R7ZA 2P5MA 3K58A 1V9MA 3GTQA 4H3TA 2CFAB 1RRJA 2GSNA 4GTDA 5JSBB 4D3YA 4EJ3A 3QX3A 2R93A 3K5MA 2BE5D 1EH1A 2O5JD 3V4GA 3G4CA 2JH3A 4FZBA 4J3NA 1A31A 4GTBA 3K5LA 4KATA 1B4BA 4NOKA 3LPXA 2A68D 4G0UA 1O27A 4IP8A 2CFAA 3LF9A 2ZFZA 4DDQA 3GTGA 4P5AA 3AH5A 4C3HC 3FOFA 3HKZA 3S0XA 1EK8A 3H0GA 4O26A 2B9SB 1A35A 2YU9A 4KARA 3DU5A 3K59A 5EGHA 1XXCA 3GTKA 4GTFA 4KASA 4L8IA 5JVOA 4C3JC 4KB4A 4BKWA 4LQYA 3M4AA 5CQGA 3CAGA 5IOTA 4IP9A 1O24A 1IS1A 2R4GA 1WQFA 4GTLA 2A6ED 2NVXA 1BGWA 3OREA 5C9HA 1O26A 4FGUA 4QIWA 4GTCA 1K83A 1SFOA 3GTLA 1Y1WA 1ZVUA 4C2MC 3G4AA 2B63A 4BLBA 4FXDA 4KC6A 4LR2A 4G0VA 2WB1A 5TJ3A 1O2BA 2A69D 2F4QA 1TL8A 4D3ZA 4Q5VA 4JLRC 3KYLA 4KMHA 4OYDB 1I6VD 4KB2A 1ISEA 2JA5A 3MMLB 5IORA 2PHCB 1WIHA 3K57A 4NOLA 1EJ9A 1O28A 4KMAA 5IOSA 3FHZA 4C3IC 1Q8IA 5JSNB 1F9NA 4NOMA 3P9AA 4P5BA 2RH6A 1R49A 1MIUA 5JFEA 3IAYA 5IOQA 1NH3A 3LAJA 1AB4A 3OPFA 2Y0SA 1YNND 1ZYRD 4FM9A 1ZBSA 4M1XA 2E2HA 3MAQA 2JA7A 1O2AA 2XCQA 1TWCA 4F3EA 2KWAA 4AYBA 3N0BA 4KM8A 4G0WA 3WVOA 3GTMA 2VUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OEP A;  4GFQ A;  4KC6 A;  3FOF A;  4G0V A;  3L4J A;  1EK8 A;  3ERE D;  4JLR C;  3L4K A;  5MLC 9;  1WQG A;  2RGR A;  4OYD B;  1GE9 A;  1B4A A;  4KB2 A;  1ISE A;  1XXC A;  2Y3P A;  3BUE A;  3MML B;  5JVO A;  3VA7 A;  4L8I A;  2P5M A;  3LHP S;  1WIH A;  2PHC B;  3FHZ A;  4KAW X;  4KB4 A;  3LAP A;  1DD5 A;  5JSN B;  5JSB B;  1F9N A;  3CAG A;  1Y69 8;  3QX3 A;  3NUH A;  1BJT A;  2XCR B;  1XXB A;  1EH1 A;  1IS1 A;  3LAJ A;  4KDD A;  4G0W A;  1AB4 A;  3V4G A;  1WQF A;  3OPF A;  4J3N A;  5CJ9 A;  4FM9 A;  3FOE A;  1BGW A;  1B4B A;  3ORE A;  2XCQ A;  1XXA A;  2KWA A;  2XCO A;  3LPX A;  1ZVU A;  4G0U A;  1WQH A;  4DDQ A;  3LF9 A;  2ZFZ A; 
#chains in the Genus database with same CATH topology
 2NVY A;  3S1M C;  4Y7N C;  3L4J A;  4Y52 K;  3DU6 A;  1T8I A;  4BBS C;  3WOD A;  1I50 A;  1YCL A;  2Y3P A;  3BUE A;  4FYD A;  4YFX A;  2E2H K;  4KAW X;  4BY7 C;  1HQM D;  2WAQ L;  3NUH A;  4BBR C;  1R9T K;  2FQT A;  4A3I K;  4WJ3 M;  5CJ9 A;  2JA5 C;  5IYD K;  2PPB A;  1TWH A;  4WJ4 A;  1WOR A;  4GTA A;  3TTG A;  1ZXO A;  1WQH A;  2E2J C;  4OIP A;  1R5Z A;  2NVY C;  1IQ0 A;  5FJ8 K;  5IYB K;  5C44 C;  2W7V A;  5MLC 9;  2E2I A;  3JST A;  1EFW A;  3S17 C;  2R7Z A;  5E68 A;  2Y0S L;  4H3T A;  4G7O A;  1RRJ A;  1L0W A;  4EJ3 A;  3GTO K;  1DCO A;  4MEX A;  1EH1 A;  3M3Y C;  2EBB A;  1I6H C;  5M5X K;  1B4B A;  1HI9 A;  2A68 D;  4QJV B;  4DDQ A;  3GTQ K;  3GTG A;  4A3C K;  3HKZ A;  3I4N C;  4OIN A;  1EK8 A;  4XSZ A;  1A35 A;  4BBR K;  1R9T C;  4KAR A;  3DU5 A;  3K59 A;  3DXJ A;  4P9S A;  3HOU C;  4QIW L;  5JVO A;  4KAS A;  3GTL C;  4C3J C;  4BXX K;  4X6A K;  3M4A A;  5CQG A;  3HOV K;  5HL8 A;  4C3I K;  1WQF A;  3ORE A;  2GAG C;  1SFO A;  1IW7 A;  3GTK K;  1Y1W A;  5IYC C;  1WSR A;  4FXD A;  5TMC A;  3BP8 C;  1VLO A;  1VJE A;  4C45 A;  2A69 D;  1USO A;  1XZP B;  3K7A C;  2B63 C;  3S14 C;  3KYL A;  1UV7 A;  4O2D A;  4XLN A;  3SZY A;  2JA5 A;  1X31 C;  3BP3 A;  1WOP A;  1WSV A;  2PHC B;  1EJ9 A;  3HOV C;  4C3I C;  1Q8I A;  1F9N A;  3HXA A;  5D4D A;  4LK0 A;  1R49 A;  1INN A;  1BS2 A;  5JFE A;  4OIQ A;  1Y1V K;  4QIW D;  2Y0S A;  3GTK C;  3S1N K;  1IBA A;  1XZQ B;  1VRQ C;  4AYB A;  1PJ6 A;  4QJV A;  2VUM A;  3GSI A;  4OIR A;  4LMO A;  4QCL A;  4KN7 A;  1DCH A;  3HOY K;  3GDZ A;  1B4A A;  3LHP S;  4AHC A;  2JA7 K;  5C44 K;  1TWG K;  5IYB C;  4LK1 A;  3LAP A;  5C4X K;  1K4T A;  2R92 C;  3A8J A;  3TFH A;  4A3D C;  1BJT A;  3ADA C;  1XXB A;  4A3I C;  2NVQ C;  1SMY D;  4KDD A;  4AN8 A;  3GTP A;  5IYD C;  5IP9 C;  2A6H D;  3SZZ A;  1TWC K;  3HOW C;  1JQW A;  1XXA A;  3GTJ A;  3M4O C;  2XCO A;  5M5Y K;  2GSU A;  2NVY K;  3AD9 C;  3K5O A;  3H3V L;  4JK1 A;  5EGE A;  5IP7 K;  3S2H C;  1I3Q C;  3CQZ A;  1F93 A;  3FKI A;  1I3Q A;  5CHP A;  3L4K A;  3H0G K;  1KQ4 A;  1GE9 A;  1RR8 C;  5C3E C;  1TWF A;  2JA7 C;  4Q5G A;  3S17 K;  2CW0 D;  4KMD A;  4MEY A;  3K58 A;  3S1N C;  1V9M A;  2R92 K;  2CFA B;  3A8K A;  5JSB B;  2V6U A;  3QX3 A;  2R93 A;  3GEH A;  2O5J D;  3T02 A;  4NOK A;  2NVX K;  3LF9 A;  3CQZ C;  4BY1 C;  3AH5 A;  3TFI A;  4C3H C;  3FOF A;  2YU9 C;  5C3E K;  2CW0 A;  4O26 A;  1K83 C;  1PJ5 A;  5IYC K;  1XXC A;  2R7Z K;  2PA8 L;  3GTL K;  3GTP C;  2O5I A;  3AD8 C;  4G7H A;  4KN4 A;  4BKW A;  3CAG A;  5IP7 C;  3S2H K;  4GTL A;  2A6E D;  4LLG A;  2WAQ D;  4LJZ A;  4G0V A;  3K7A K;  1EI6 A;  2A6H A;  4KMU A;  2VUM C;  1TL8 A;  1JOE A;  4JLR C;  4OYD B;  4KB2 A;  3GIR A;  3MML B;  2E2J K;  4A3L C;  1XPP A;  1YX2 A;  3FHZ A;  4NOM A;  2PA8 D;  2RH6 A;  1NH3 A;  5FLM K;  1AB4 A;  1Y1V C;  2FQO A;  1TWG C;  4FM9 A;  1ZYR D;  4A3K C;  1ZBS A;  4M1X A;  2E2H A;  1O2A A;  1RU0 A;  1Y1W K;  1TWH K;  4YG2 A;  1TWA C;  2KWA A;  4A3B K;  3N0B A;  4A3G K;  3WVO A;  3GTM A;  4XCH A;  3T01 A;  3GTO C;  4GFQ A;  2V6T A;  1R9T A;  1O29 A;  5M3F K;  1WCM A;  1VGX A;  3HOY C;  1I6H K;  2JA8 C;  3S1Q C;  1XZQ A;  1J6X A;  3GTJ K;  4C2M A;  4AH6 A;  1V5V A;  3RZD C;  5C4X C;  1DD5 A;  2PMZ A;  1BDF A;  5FLM C;  1Y69 8;  4KM9 A;  1IW7 D;  2XCR B;  4A93 C;  3S2D C;  1J6V A;  1TWA K;  4A3B C;  3FOE A;  2A69 A;  5C4J K;  3H3V D;  3HOW K;  3AQP A;  3M4O K;  2GSO A;  3AQO A;  1SEU A;  3OEP A;  4Y52 C;  5M5W K;  4A3M K;  4BBS K;  1SC7 A;  3GTO A;  1JVI A;  2A6E A;  1F7U A;  2D6F C;  1XZP A;  1WCM C;  2A68 A;  3S15 K;  1I50 K;  2JA6 A;  3I4N K;  4AYB L;  1HQM A;  1TWG A;  2NVT C;  3GTQ A;  4XLP A;  4NOI A;  3HOU K;  1TWH C;  2GSN A;  3S2D K;  4D3Y A;  1WOO A;  2BE5 D;  3GTP K;  3V4G A;  5C4J C;  4FZB A;  4GTB A;  4LOW A;  4PAB A;  3K5L A;  4A3M C;  2E2I C;  1IL2 A;  4MQ9 A;  3H0G C;  3LPX A;  1O27 A;  4IP8 A;  2CFA A;  2ZFZ A;  4C3H K;  1I50 C;  3CQZ K;  4BY1 K;  3GEE A;  3RZD K;  3S0X A;  2WB1 L;  3H0G A;  2B9S B;  1TWF K;  4YFK A;  3PO2 C;  2ZUF A;  1F7V A;  1SFO K;  3GTK A;  4L8I A;  2JA5 K;  3HOZ K;  2BE5 A;  4KB4 A;  1I6V A;  4LQY A;  2R93 K;  5IOT A;  3GTG K;  4IP9 A;  1O24 A;  1USM A;  2R4G A;  1J6W A;  1VH2 A;  4Q5S A;  2YU9 K;  2PMZ D;  2V6S A;  5C9H A;  3GTQ C;  4FGU A;  4QIW A;  3HKZ D;  1K83 A;  2JA6 C;  4OIO A;  2Y0S D;  2B63 A;  4BLB A;  1EQR A;  4KC6 A;  1WOS A;  4LR2 A;  2WB1 A;  4A3K K;  3S1R K;  2VUM K;  3PO2 K;  2F4Q A;  1Y1W C;  4C3J K;  1I6V D;  1WIH A;  4NOL A;  5IOS A;  5JSN B;  4P5B A;  5IOQ A;  3LAJ A;  3I4M K;  3S16 K;  3OPF A;  1YNN D;  1J98 A;  1TWF C;  3MAQ A;  2JA7 A;  2XCQ A;  1TWC A;  4F3E A;  5IP9 K;  1O2F B;  4G0W A;  4PAA A;  1G51 A;  3S1M K;  3GTM C;  3ERE D;  4ILD A;  3HOX C;  1TGO A;  1TWA A;  3RZO C;  1I3Q K;  2NVX C;  3S1Q K;  1O25 A;  3TFJ A;  3VA7 A;  3GTJ C;  1A36 A;  2E2H C;  4A3F K;  4BLA A;  2R92 A;  1YNN A;  1YNJ D;  1C0A A;  1Y1V A;  2WAQ A;  3SJR A;  3S1R C;  2NVT K;  1PJ7 A;  2PMZ L;  3PO3 C;  4A93 K;  2R7Z C;  1K4S A;  3K5N A;  4Y7N K;  2O5J A;  4YFN A;  1LPQ A;  3N3Y A;  3Q3Q A;  3HOX K;  4GTE A;  3EQL A;  4WIL A;  1WCM K;  3N0C A;  2GAH C;  1WQG A;  2RGR A;  4GT9 A;  3S16 C;  2P8T A;  2WB1 D;  2P5M A;  4ZH4 A;  4A3E C;  1DCP A;  1SMY A;  1ZYR A;  2NVQ K;  4GTD A;  3K5M A;  3A8I A;  3M3Y K;  3G4C A;  2JH3 A;  4J3N A;  1A31 A;  4X6A C;  4A3L K;  2E2I K;  5L46 A;  4KAT A;  3RZO K;  4GZY A;  3S15 C;  4G0U A;  4A3C C;  4P5A A;  4A3J C;  3FKI K;  2ZUE A;  3HKZ L;  3GEI A;  2JA6 K;  2YU9 A;  4AYB D;  4A3D K;  4A3E K;  5EGH A;  3HOZ C;  5TMF A;  4GTF A;  4G7Z A;  1SFO C;  4BXX C;  1TWC C;  2B63 K;  3AD7 C;  3IPJ A;  2R93 C;  1ZQ1 C;  2JA8 K;  1IS1 A;  4XSX A;  2NVX A;  1BGW A;  3T00 A;  1O26 A;  4GTC A;  1YNJ A;  4RMF A;  4BY7 K;  3GTL A;  1ZVU A;  3FKI C;  4C2M C;  3G4A A;  5TJ3 A;  4A3G C;  1O2B A;  4D3Z A;  4Q5V A;  4KMH A;  3S14 K;  5M3M K;  3GTG C;  1ISE A;  5IOR A;  3K57 A;  1O28 A;  4KMA A;  3GTM K;  1IE0 A;  3P9A A;  1MIU A;  3IAY A;  4Q4Z A;  4A3J K;  3I4M C;  4A3F C;  4C2M K;  1K83 K;  4KM8 A;  3PO3 K; 
#chains in the Genus database with same CATH homology
 4GFQ A;  2NVY A;  1R9T A;  4LMO A;  4QCL A;  1O29 A;  3L4J A;  3ERE D;  1WCM A;  4ILD A;  3DU6 A;  1T8I A;  1TGO A;  1TWA A;  1I50 A;  1B4A A;  1O25 A;  2Y3P A;  3BUE A;  4C2M A;  4FYD A;  3VA7 A;  3LHP S;  4AHC A;  1A36 A;  4KAW X;  4BLA A;  3LAP A;  1DD5 A;  2PMZ A;  2R92 A;  1HQM D;  1K4T A;  1YNJ D;  1Y69 8;  1Y1V A;  4KM9 A;  2WAQ A;  1IW7 D;  3NUH A;  1BJT A;  2XCR B;  1XXB A;  3SJR A;  1SMY D;  4KDD A;  4AN8 A;  1K4S A;  3GTP A;  5CJ9 A;  3K5N A;  2A6H D;  3FOE A;  1TWH A;  1XXA A;  3GTJ A;  4GTA A;  2XCO A;  3AQP A;  1LPQ A;  1ZXO A;  1WQH A;  2GSO A;  1SEU A;  2GSU A;  3AQO A;  3N3Y A;  3K5O A;  3OEP A;  3Q3Q A;  1R5Z A;  4GTE A;  5EGE A;  1SC7 A;  3GTO A;  3CQZ A;  3N0C A;  3FKI A;  1I3Q A;  5CHP A;  5MLC 9;  3L4K A;  2JA6 A;  1WQG A;  2E2I A;  1GE9 A;  1RR8 C;  1KQ4 A;  1TWF A;  4GT9 A;  2RGR A;  4Q5G A;  2CW0 D;  4KMD A;  1TWG A;  2R7Z A;  2P5M A;  3K58 A;  1V9M A;  3GTQ A;  4H3T A;  2CFA B;  1RRJ A;  2GSN A;  4GTD A;  5JSB B;  4D3Y A;  4EJ3 A;  3QX3 A;  2R93 A;  3K5M A;  2BE5 D;  1EH1 A;  2O5J D;  3V4G A;  3G4C A;  2JH3 A;  4FZB A;  4J3N A;  1A31 A;  4GTB A;  3K5L A;  4KAT A;  1B4B A;  4NOK A;  3LPX A;  2A68 D;  4G0U A;  1O27 A;  4IP8 A;  2CFA A;  3LF9 A;  2ZFZ A;  4DDQ A;  3GTG A;  4P5A A;  3AH5 A;  4C3H C;  3FOF A;  3HKZ A;  3S0X A;  1EK8 A;  3H0G A;  4O26 A;  2B9S B;  1A35 A;  2YU9 A;  4KAR A;  3DU5 A;  3K59 A;  5EGH A;  1XXC A;  3GTK A;  4GTF A;  4KAS A;  4L8I A;  5JVO A;  4C3J C;  4KB4 A;  4BKW A;  4LQY A;  3M4A A;  5CQG A;  3CAG A;  5IOT A;  4IP9 A;  1O24 A;  1IS1 A;  2R4G A;  1WQF A;  4GTL A;  2A6E D;  2NVX A;  1BGW A;  3ORE A;  5C9H A;  1O26 A;  4FGU A;  4QIW A;  4GTC A;  1K83 A;  1SFO A;  3GTL A;  1Y1W A;  1ZVU A;  4C2M C;  3G4A A;  2B63 A;  4BLB A;  4FXD A;  4KC6 A;  4LR2 A;  4G0V A;  2WB1 A;  5TJ3 A;  1O2B A;  2A69 D;  2F4Q A;  1TL8 A;  4D3Z A;  4Q5V A;  4JLR C;  3KYL A;  4KMH A;  4OYD B;  1I6V D;  4KB2 A;  1ISE A;  2JA5 A;  3MML B;  5IOR A;  2PHC B;  1WIH A;  3K57 A;  4NOL A;  1EJ9 A;  1O28 A;  4KMA A;  5IOS A;  3FHZ A;  4C3I C;  1Q8I A;  5JSN B;  1F9N A;  4NOM A;  3P9A A;  4P5B A;  2RH6 A;  1R49 A;  1MIU A;  5JFE A;  3IAY A;  5IOQ A;  1NH3 A;  3LAJ A;  1AB4 A;  3OPF A;  2Y0S A;  1YNN D;  1ZYR D;  4FM9 A;  1ZBS A;  4M1X A;  2E2H A;  3MAQ A;  2JA7 A;  1O2A A;  2XCQ A;  1TWC A;  4F3E A;  2KWA A;  4AYB A;  3N0B A;  4KM8 A;  4G0W A;  3WVO A;  3GTM A;  2VUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...