1ISEA

Crystal structure of a mutant of ribosome recycling factor from escherichia coli, arg132gly
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
b'ISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVGRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome Recycling Factor
publication title Crystal structure of a mutant of ribosome recycling factor from Escherichia coli, Arg132Gly
rcsb
source organism Escherichia coli
molecule tags Translation
total genus 65
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1iseA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1iseA02
1WQFA 3L4JA 4L8IA 3FHZA 1F9NA 1XXCA 2XCOA 4KAWX 1WQHA 4KDDA 5MLC9 5CJ9A 4DDQA 1DD5A 2PHCB 4FM9A 1B4BA 3LHPS 3LF9A 2KWAA 3LAPA 4G0VA 4GFQA 4OYDB 4G0UA 4J3NA 5JSNB 1XXAA 2Y3PA 3BUEA 4KB4A 5JVOA 4JLRC 1Y698 1GE9A 3LPXA 4G0WA 1IS1A 4KB2A 1WQGA 4KC6A 1XXBA 1ZVUA 3OREA 3OPFA 3FOEA 3QX3A 1AB4A 3VA7A 2XCRB 1WIHA 1EH1A 2XCQA 3CAGA 3MMLB 2P5MA 2ZFZA 3V4GA 3NUHA 1ISEA 1B4AA 1BJTA 3OEPA 3LAJA 2RGRA 1EK8A 3ERED 1BGWA 3FOFA 3L4KA 5JSBB
chains in the Genus database with same CATH superfamily
1SMYA 4Y7NC 2R4GA 3K5OA 4EJ3A 2R92K 4BY7C 1TWCK 4KDDA 4A3MC 4QCLA 4OIRA 4GZYA 2R93C 2BE5D 4ZH4A 4D3YA 3AH5A 3G4CA 5IYCC 4RMFA 1TWFA 5M5YK 3AQPA 4JLRC 1Y698 3HOXC 5C4XC 3Q3QA 3S1NC 3I4NK 1B4AA 4C3JC 3M3YK 2V6SA 4KASA 1I3QA 4A3DC 1IE0A 2VUMK 1I50C 2A69A 4OIQA 1O2FB 4BLAA 2JA6K 3RZDK 4XSXA 2E2HK 1YNJD 3FKIA 1PJ7A 3HKZL 1BDFA 5IP9C 1EQRA 1J6WA 1F93A 1T8IA 2A6HA 1YNJA 1DCHA 1K4TA 3H0GK 3VA7A 2CW0D 1XZQA 2P5MA 1BJTA 3S1QC 1YX2A 4WJ3M 2O5JA 5JSBB 3K59A 4C3IC 1A31A 2CW0A 3FHZA 4BXXK 1ZYRD 2R7ZC 4BY1K 4A3IC 3BP8C 1RRJA 3CQZA 3GSIA 1I6HC 3TTGA 4NOKA 4PABA 4OYDB 1WCMC 4KMUA 4C45A 5JSNB 4A3JK 1ZQ1C 1VJEA 5FJ8K 5IP7C 3GTJA 3I4MK 2E2IA 4G7OA 4A3GC 1A36A 3KYLA 3HOYC 1WIHA 4XLNA 2R92A 1TWFK 2NVQK 1O2BA 3PO3C 3NUHA 3OEPA 5C44C 5M5XK 4P9SA 5C3EC 4GTFA 1J6XA 4D3ZA 3GTJC 2NVXA 3A8JA 2GSOA 4A3CC 2ZUFA 1DD5A 2R92C 4O26A 2V6UA 1I3QK 5TMCA 1TWCC 1C0AA 3GTOK 3N0BA 1DCPA 1XXAA 2YU9K 3S17C 3LPXA 1NH3A 3OPFA 1XXBA 1WQGA 2P8TA 3FOEA 2JA7C 2VUMA 3WODA 3FKIK 2V6TA 3GTLK 1HQMD 3CAGA 1ISEA 4MQ9A 4YFXA 4KATA 3S14K 2WB1L 4OINA 5FLMK 3I4NC 2WAQL 3M3YC 3S2DK 2PMZD 1HQMA 4KM8A 4MEYA 3T01A 4Q5GA 4KAWX 4BBSK 3S0XA 2JA6C 1PJ5A 3RZDC 1EFWA 4ILDA 4BBRC 1YCLA 2E2HC 1O24A 4AYBD 4QJVA 5JVOA 1Y1WC 4A93K 1L0WA 1IW7D 2PPBA 1XZQB 1INNA 3H0GC 4A3EK 2B63C 2E2IK 1IW7A 1F9NA 4MEXA 1ZBSA 4AYBL 4BXXC 4GTEA 1F7VA 4BY1C 4LLGA 3MAQA 1VRQC 2NVXK 4GT9A 2ZUEA 4Q5VA 2NVTK 2BE5A 3HKZD 3P9AA 1USMA 3JSTA 2XCRB 4BKWA 3I4MC 3SZZA 3TFIA 1A35A 3S2HC 1K83A 3ADAC 1TWFC 2NVQC 4KMAA 3GTOA 3SJRA 3S15K 3S1RK 4AH6A 4PAAA 2YU9A 4DDQA 1PJ6A 4LQYA 3HOVK 4GTLA 3GTGK 1VGXA 3GTLA 1I3QC 2Y3PA 3GTOC 1TWGK 3RZOC 4H3TA 1EI6A 3OREA 4Y52K 2YU9C 4IP9A 3M4AA 3MMLB 1Y1VA 3FKIC 4C3HC 4A3LK 4X6AK 3GTLC 4FXDA 1I6VD 1MIUA 4L8IA 1Q8IA 1WORA 1ZXOA 1YNND 2JA8C 4F3EA 5FLMC 3AD7C 1B4BA 5TMFA 1TWHK 1XZPA 4NOIA 3HOZK 1YNNA 4FGUA 1ZYRA 4QJVB 3TFJA 1GE9A 2A6ED 3N0CA 3S1MK 1O2AA 4LOWA 3DXJA 4P5BA 3S16K 2RH6A 1JQWA 4A93C 2ZFZA 3CQZC 2A6EA 1EK8A 3PO2K 3H3VL 4LK0A 3AD8C 4A3EC 2E2JK 4LMOA 1WSVA 1WQHA 2WB1D 2E2IC 2Y0SL 4Q4ZA 1R5ZA 1K83K 2WAQD 3LF9A 1O28A 4KM9A 4OIPA 3HOXK 5C4XK 4GFQA 3WVOA 5HL8A 1O26A 4A3KK 2WAQA 2NVXC 1I50K 1WOSA 4GTBA 4C2MK 2NVTC 1RR8C 4GTDA 1TL8A 4GTAA 5D4DA 3HOUK 1K4SA 3L4KA 3GTGA 1EJ9A 4BLBA 1SFOK 1Y1VK 5CJ9A 2VUMC 5C9HA 1TWGA 2FQOA 4A3FK 2PHCB 3GTMA 1VLOA 3LHPS 1WSRA 2PMZA 1IS1A 1ZVUA 4A3BK 4WILA 3GTQK 4IP8A 4XCHA 1KQ4A 2EBBA 2XCQA 3GDZA 4Y52C 4C3IK 2CFAA 2GAGC 4AYBA 4Q5SA 2W7VA 4AHCA 4A3IK 1TWHA 4X6AC 1TWAA 4GTCA 4FZBA 4AN8A 1RU0A 2F4QA 5JFEA 1XZPB 3AQOA 1G51A 3HOWK 3BUEA 4G0VA 3HOYK 4KARA 4KN7A 4XLPA 5C4JK 3HOZC 4QIWL 5TJ3A 3EQLA 2PA8L 4A3JC 3S1MC 3K5NA 4YG2A 2NVYK 4A3CK 1O25A 5EGEA 3HKZA 5L46A 2JH3A 3DU5A 3PO2C 1O27A 1R9TK 2E2JC 4FM9A 4KMDA 3S17K 3K7AK 5IOQA 2FQTA 2JA7K 1I50A 4C2MA 4G7HA 1K83C 1V5VA 1LPQA 4KB4A 2JA5K 3K5MA 2A69D 4KC6A 4XSZA 5E68A 3GTMK 4NOMA 4A3KC 3GEIA 1SFOA 4C2MC 3K57A 5CHPA 1XXCA 3HOUC 3S14C 4BBRK 3GTPK 1DCOA 2A6HD 5IYBK 3S2DC 5IOSA 3H3VD 1JOEA 3GTKK 4KN4A 1I6VA 1Y1WK 1SFOC 2KWAA 1Y1VC 4WJ4A 3LAPA 1HI9A 5IYDK 3GTQA 4BBSC 4A3FC 1TWAK 3HXAA 1SEUA 4J3NA 1V9MA 2GSNA 3GEEA 1IQ0A 2Y0SD 2O5JD 2R7ZA 4KB2A 3M4OK 4OIOA 2B63K 4LR2A 1IL2A 4A3BC 4Y7NK 2CFAB 3GTQC 2Y0SA 1WCMA 4BY7K 1F7UA 4A3MK 4FYDA 2R93K 5EGHA 1USOA 3G4AA 1X31C 4YFKA 4M1XA 5IYCK 1J98A 4O2DA 1VH2A 3IPJA 2D6FC 3SZYA 3S1NK 2GSUA 2WB1A 2NVYA 3IAYA 4YFNA 4C3JK 3HOWC 3K5LA 3S2HK 3TFHA 5C4JC 1TWCA 1EH1A 4A3DK 1JVIA 2O5IA 3BP3A 1R9TA 3AD9C 1O29A 5IORA 2RGRA 3ERED 5IOTA 1WQFA 4LJZA 3L4JA 2NVYC 2JA7A 5M3MK 1J6VA 5MLC9 2JA5A 5IP9K 3N3YA 3S15C 3S1RC 3RZOK 1R9TC 1IBAA 4KMHA 3K7AC 3FOFA 3HOVC 3GTGC 2B9SB 1WOPA 1WOOA 4C3HK 3QX3A 3S1QK 2JA5C 3DU6A 2JA6A 1TWGC 3GTMC 3GTPA 2JA8K 2E2HA 4JK1A 1UV7A 4QIWD 1BGWA 3T02A 3GTKA 2R7ZK 1Y1WA 2PA8D 4A3LC 2XCOA 3GEHA 3T00A 1I6HK 4LK1A 3K58A 4QIWA 1WCMK 1R49A 3A8KA 2GAHC 3H0GA 4G7ZA 1XPPA 3GTPC 2B63A 5IYBC 5M3FK 3GTKC 5IP7K 4G0WA 4A3GK 3GIRA 5IYDC 1TWHC 3CQZK 1TWAC 3PO3K 5M5WK 2A68D 1SMYD 5C44K 1AB4A 4NOLA 2PMZL 2R93A 3V4GA 4G0UA 3LAJA 5CQGA 3A8IA 3M4OC 4P5AA 5C3EK 1TGOA 1SC7A 3S16C 3GTJK 1BS2A 2A68A
chains in the Genus database with same CATH topology
2R4GA 3K5OA 4KM8A 4EJ3A 5CHPA 1XXCA 4Q5GA 4LMOA 4KAWX 1WQHA 4KDDA 3S0XA 4QCLA 2A6HD 2BE5D 5IOSA 1R5ZA 4D3YA 3AH5A 3G4CA 3LF9A 1O28A 2KWAA 4KM9A 3LAPA 3GTQA 4ILDA 4GFQA 1TWFA 3WVOA 1O24A 1SEUA 4J3NA 1V9MA 1O26A 5JVOA 2GSNA 3AQPA 4JLRC 1Y698 2O5JD 2R7ZA 4KB2A 2WAQA 3Q3QA 1IW7D 4GTBA 4LR2A 1RR8C 1B4AA 4C3JC 2CFAB 4GTDA 1TL8A 2Y0SA 1WCMA 4GTAA 4KASA 1I3QA 1K4SA 3L4KA 3GTGA 1EJ9A 4FYDA 4BLAA 5EGHA 1F9NA 3G4AA 4BLBA 1ZBSA 4M1XA 5CJ9A 5C9HA 1TWGA 2PHCB 4GTEA 3GTMA 3LHPS 1YNJD 3FKIA 3MAQA 2PMZA 4GT9A 1T8IA 2GSUA 1IS1A 2WB1A 4Q5VA 2NVYA 1ZVUA 3IAYA 3P9AA 1K4TA 3K5LA 3VA7A 2XCRB 4IP8A 2CW0D 1KQ4A 1TWCA 1EH1A 2XCQA 4BKWA 2P5MA 2CFAA 4AYBA 1BJTA 1R9TA 1A35A 1O29A 5IORA 2RGRA 3ERED 1K83A 5JSBB 4AHCA 5IOTA 3K59A 4KMAA 1WQFA 1TWHA 3SJRA 3GTOA 1A31A 4C3IC 3FHZA 1TWAA 1ZYRD 4GTCA 2JA7A 4FZBA 5MLC9 2YU9A 4DDQA 2JA5A 4AN8A 3N3YA 4LQYA 1RRJA 3CQZA 2F4QA 4GTLA 5JFEA 4NOKA 4KMHA 3GTLA 4OYDB 3AQOA 5JSNB 2Y3PA 3BUEA 3FOFA 4KARA 2B9SB 4G0VA 4H3TA 3OREA 5TJ3A 3GTJA 3QX3A 2E2IA 3DU6A 3KYLA 1A36A 4IP9A 2JA6A 1WIHA 2R92A 3M4AA 3MMLB 1O2BA 1Y1VA 3NUHA 3K5NA 3OEPA 4C3HC 3GTPA 2E2HA 4FXDA 1I6VD 1BGWA 3GTKA 1O25A 1MIUA 5EGEA 1Y1WA 3HKZA 4L8IA 1Q8IA 1ZXOA 3DU5A 1YNND 2JH3A 4GTFA 4D3ZA 4F3EA 2NVXA 2XCOA 2GSOA 1O27A 3L4JA 1DD5A 3K58A 4QIWA 4O26A 4KMDA 4FM9A 1R49A 1B4BA 3H0GA 5IOQA 2B63A 1I50A 4C2MA 4FGUA 3N0BA 1XXAA 1LPQA 4KB4A 4G0WA 3LPXA 1GE9A 1NH3A 2A6ED 3K5MA 2A69D 4KC6A 1WQGA 1XXBA 3N0CA 1O2AA 2A68D 3OPFA 1SMYD 2VUMA 1AB4A 4P5BA 3FOEA 2RH6A 4NOLA 1HQMD 2R93A 3V4GA 4NOMA 3CAGA 4G0UA 2ZFZA 3LAJA 1ISEA 5CQGA 1SFOA 4P5AA 4KATA 1TGOA 1SC7A 1EK8A 4C2MC 3K57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQF A;  3L4J A;  4L8I A;  3FHZ A;  1F9N A;  1XXC A;  2XCO A;  4KAW X;  1WQH A;  4KDD A;  5MLC 9;  5CJ9 A;  4DDQ A;  1DD5 A;  2PHC B;  4FM9 A;  1B4B A;  3LHP S;  3LF9 A;  2KWA A;  3LAP A;  4G0V A;  4GFQ A;  4OYD B;  4G0U A;  4J3N A;  5JSN B;  1XXA A;  2Y3P A;  3BUE A;  4KB4 A;  5JVO A;  4JLR C;  1Y69 8;  1GE9 A;  3LPX A;  4G0W A;  1IS1 A;  4KB2 A;  1WQG A;  4KC6 A;  1XXB A;  1ZVU A;  3ORE A;  3OPF A;  3FOE A;  3QX3 A;  1AB4 A;  3VA7 A;  2XCR B;  1WIH A;  1EH1 A;  2XCQ A;  3CAG A;  3MML B;  2P5M A;  2ZFZ A;  3V4G A;  3NUH A;  1ISE A;  1B4A A;  1BJT A;  3OEP A;  3LAJ A;  2RGR A;  1EK8 A;  3ERE D;  1BGW A;  3FOF A;  3L4K A;  5JSB B; 
#chains in the Genus database with same CATH topology
 1SMY A;  4Y7N C;  2R4G A;  3K5O A;  4EJ3 A;  2R92 K;  4BY7 C;  1TWC K;  4KDD A;  4A3M C;  4QCL A;  4OIR A;  4GZY A;  2R93 C;  2BE5 D;  4ZH4 A;  4D3Y A;  3AH5 A;  3G4C A;  5IYC C;  4RMF A;  1TWF A;  5M5Y K;  3AQP A;  4JLR C;  1Y69 8;  3HOX C;  5C4X C;  3Q3Q A;  3S1N C;  3I4N K;  1B4A A;  4C3J C;  3M3Y K;  2V6S A;  4KAS A;  1I3Q A;  4A3D C;  1IE0 A;  2VUM K;  1I50 C;  2A69 A;  4OIQ A;  1O2F B;  4BLA A;  2JA6 K;  3RZD K;  4XSX A;  2E2H K;  1YNJ D;  3FKI A;  1PJ7 A;  3HKZ L;  1BDF A;  5IP9 C;  1EQR A;  1J6W A;  1F93 A;  1T8I A;  2A6H A;  1YNJ A;  1DCH A;  1K4T A;  3H0G K;  3VA7 A;  2CW0 D;  1XZQ A;  2P5M A;  1BJT A;  3S1Q C;  1YX2 A;  4WJ3 M;  2O5J A;  5JSB B;  3K59 A;  4C3I C;  1A31 A;  2CW0 A;  3FHZ A;  4BXX K;  1ZYR D;  2R7Z C;  4BY1 K;  4A3I C;  3BP8 C;  1RRJ A;  3CQZ A;  3GSI A;  1I6H C;  3TTG A;  4NOK A;  4PAB A;  4OYD B;  1WCM C;  4KMU A;  4C45 A;  5JSN B;  4A3J K;  1ZQ1 C;  1VJE A;  5FJ8 K;  5IP7 C;  3GTJ A;  3I4M K;  2E2I A;  4G7O A;  4A3G C;  1A36 A;  3KYL A;  3HOY C;  1WIH A;  4XLN A;  2R92 A;  1TWF K;  2NVQ K;  1O2B A;  3PO3 C;  3NUH A;  3OEP A;  5C44 C;  5M5X K;  4P9S A;  5C3E C;  4GTF A;  1J6X A;  4D3Z A;  3GTJ C;  2NVX A;  3A8J A;  2GSO A;  4A3C C;  2ZUF A;  1DD5 A;  2R92 C;  4O26 A;  2V6U A;  1I3Q K;  5TMC A;  1TWC C;  1C0A A;  3GTO K;  3N0B A;  1DCP A;  1XXA A;  2YU9 K;  3S17 C;  3LPX A;  1NH3 A;  3OPF A;  1XXB A;  1WQG A;  2P8T A;  3FOE A;  2JA7 C;  2VUM A;  3WOD A;  3FKI K;  2V6T A;  3GTL K;  1HQM D;  3CAG A;  1ISE A;  4MQ9 A;  4YFX A;  4KAT A;  3S14 K;  2WB1 L;  4OIN A;  5FLM K;  3I4N C;  2WAQ L;  3M3Y C;  3S2D K;  2PMZ D;  1HQM A;  4KM8 A;  4MEY A;  3T01 A;  4Q5G A;  4KAW X;  4BBS K;  3S0X A;  2JA6 C;  1PJ5 A;  3RZD C;  1EFW A;  4ILD A;  4BBR C;  1YCL A;  2E2H C;  1O24 A;  4AYB D;  4QJV A;  5JVO A;  1Y1W C;  4A93 K;  1L0W A;  1IW7 D;  2PPB A;  1XZQ B;  1INN A;  3H0G C;  4A3E K;  2B63 C;  2E2I K;  1IW7 A;  1F9N A;  4MEX A;  1ZBS A;  4AYB L;  4BXX C;  4GTE A;  1F7V A;  4BY1 C;  4LLG A;  3MAQ A;  1VRQ C;  2NVX K;  4GT9 A;  2ZUE A;  4Q5V A;  2NVT K;  2BE5 A;  3HKZ D;  3P9A A;  1USM A;  3JST A;  2XCR B;  4BKW A;  3I4M C;  3SZZ A;  3TFI A;  1A35 A;  3S2H C;  1K83 A;  3ADA C;  1TWF C;  2NVQ C;  4KMA A;  3GTO A;  3SJR A;  3S15 K;  3S1R K;  4AH6 A;  4PAA A;  2YU9 A;  4DDQ A;  1PJ6 A;  4LQY A;  3HOV K;  4GTL A;  3GTG K;  1VGX A;  3GTL A;  1I3Q C;  2Y3P A;  3GTO C;  1TWG K;  3RZO C;  4H3T A;  1EI6 A;  3ORE A;  4Y52 K;  2YU9 C;  4IP9 A;  3M4A A;  3MML B;  1Y1V A;  3FKI C;  4C3H C;  4A3L K;  4X6A K;  3GTL C;  4FXD A;  1I6V D;  1MIU A;  4L8I A;  1Q8I A;  1WOR A;  1ZXO A;  1YNN D;  2JA8 C;  4F3E A;  5FLM C;  3AD7 C;  1B4B A;  5TMF A;  1TWH K;  1XZP A;  4NOI A;  3HOZ K;  1YNN A;  4FGU A;  1ZYR A;  4QJV B;  3TFJ A;  1GE9 A;  2A6E D;  3N0C A;  3S1M K;  1O2A A;  4LOW A;  3DXJ A;  4P5B A;  3S16 K;  2RH6 A;  1JQW A;  4A93 C;  2ZFZ A;  3CQZ C;  2A6E A;  1EK8 A;  3PO2 K;  3H3V L;  4LK0 A;  3AD8 C;  4A3E C;  2E2J K;  4LMO A;  1WSV A;  1WQH A;  2WB1 D;  2E2I C;  2Y0S L;  4Q4Z A;  1R5Z A;  1K83 K;  2WAQ D;  3LF9 A;  1O28 A;  4KM9 A;  4OIP A;  3HOX K;  5C4X K;  4GFQ A;  3WVO A;  5HL8 A;  1O26 A;  4A3K K;  2WAQ A;  2NVX C;  1I50 K;  1WOS A;  4GTB A;  4C2M K;  2NVT C;  1RR8 C;  4GTD A;  1TL8 A;  4GTA A;  5D4D A;  3HOU K;  1K4S A;  3L4K A;  3GTG A;  1EJ9 A;  4BLB A;  1SFO K;  1Y1V K;  5CJ9 A;  2VUM C;  5C9H A;  1TWG A;  2FQO A;  4A3F K;  2PHC B;  3GTM A;  1VLO A;  3LHP S;  1WSR A;  2PMZ A;  1IS1 A;  1ZVU A;  4A3B K;  4WIL A;  3GTQ K;  4IP8 A;  4XCH A;  1KQ4 A;  2EBB A;  2XCQ A;  3GDZ A;  4Y52 C;  4C3I K;  2CFA A;  2GAG C;  4AYB A;  4Q5S A;  2W7V A;  4AHC A;  4A3I K;  1TWH A;  4X6A C;  1TWA A;  4GTC A;  4FZB A;  4AN8 A;  1RU0 A;  2F4Q A;  5JFE A;  1XZP B;  3AQO A;  1G51 A;  3HOW K;  3BUE A;  4G0V A;  3HOY K;  4KAR A;  4KN7 A;  4XLP A;  5C4J K;  3HOZ C;  4QIW L;  5TJ3 A;  3EQL A;  2PA8 L;  4A3J C;  3S1M C;  3K5N A;  4YG2 A;  2NVY K;  4A3C K;  1O25 A;  5EGE A;  3HKZ A;  5L46 A;  2JH3 A;  3DU5 A;  3PO2 C;  1O27 A;  1R9T K;  2E2J C;  4FM9 A;  4KMD A;  3S17 K;  3K7A K;  5IOQ A;  2FQT A;  2JA7 K;  1I50 A;  4C2M A;  4G7H A;  1K83 C;  1V5V A;  1LPQ A;  4KB4 A;  2JA5 K;  3K5M A;  2A69 D;  4KC6 A;  4XSZ A;  5E68 A;  3GTM K;  4NOM A;  4A3K C;  3GEI A;  1SFO A;  4C2M C;  3K57 A;  5CHP A;  1XXC A;  3HOU C;  3S14 C;  4BBR K;  3GTP K;  1DCO A;  2A6H D;  5IYB K;  3S2D C;  5IOS A;  3H3V D;  1JOE A;  3GTK K;  4KN4 A;  1I6V A;  1Y1W K;  1SFO C;  2KWA A;  1Y1V C;  4WJ4 A;  3LAP A;  1HI9 A;  5IYD K;  3GTQ A;  4BBS C;  4A3F C;  1TWA K;  3HXA A;  1SEU A;  4J3N A;  1V9M A;  2GSN A;  3GEE A;  1IQ0 A;  2Y0S D;  2O5J D;  2R7Z A;  4KB2 A;  3M4O K;  4OIO A;  2B63 K;  4LR2 A;  1IL2 A;  4A3B C;  4Y7N K;  2CFA B;  3GTQ C;  2Y0S A;  1WCM A;  4BY7 K;  1F7U A;  4A3M K;  4FYD A;  2R93 K;  5EGH A;  1USO A;  3G4A A;  1X31 C;  4YFK A;  4M1X A;  5IYC K;  1J98 A;  4O2D A;  1VH2 A;  3IPJ A;  2D6F C;  3SZY A;  3S1N K;  2GSU A;  2WB1 A;  2NVY A;  3IAY A;  4YFN A;  4C3J K;  3HOW C;  3K5L A;  3S2H K;  3TFH A;  5C4J C;  1TWC A;  1EH1 A;  4A3D K;  1JVI A;  2O5I A;  3BP3 A;  1R9T A;  3AD9 C;  1O29 A;  5IOR A;  2RGR A;  3ERE D;  5IOT A;  1WQF A;  4LJZ A;  3L4J A;  2NVY C;  2JA7 A;  5M3M K;  1J6V A;  5MLC 9;  2JA5 A;  5IP9 K;  3N3Y A;  3S15 C;  3S1R C;  3RZO K;  1R9T C;  1IBA A;  4KMH A;  3K7A C;  3FOF A;  3HOV C;  3GTG C;  2B9S B;  1WOP A;  1WOO A;  4C3H K;  3QX3 A;  3S1Q K;  2JA5 C;  3DU6 A;  2JA6 A;  1TWG C;  3GTM C;  3GTP A;  2JA8 K;  2E2H A;  4JK1 A;  1UV7 A;  4QIW D;  1BGW A;  3T02 A;  3GTK A;  2R7Z K;  1Y1W A;  2PA8 D;  4A3L C;  2XCO A;  3GEH A;  3T00 A;  1I6H K;  4LK1 A;  3K58 A;  4QIW A;  1WCM K;  1R49 A;  3A8K A;  2GAH C;  3H0G A;  4G7Z A;  1XPP A;  3GTP C;  2B63 A;  5IYB C;  5M3F K;  3GTK C;  5IP7 K;  4G0W A;  4A3G K;  3GIR A;  5IYD C;  1TWH C;  3CQZ K;  1TWA C;  3PO3 K;  5M5W K;  2A68 D;  1SMY D;  5C44 K;  1AB4 A;  4NOL A;  2PMZ L;  2R93 A;  3V4G A;  4G0U A;  3LAJ A;  5CQG A;  3A8I A;  3M4O C;  4P5A A;  5C3E K;  1TGO A;  1SC7 A;  3S16 C;  3GTJ K;  1BS2 A;  2A68 A; 
#chains in the Genus database with same CATH homology
 2R4G A;  3K5O A;  4KM8 A;  4EJ3 A;  5CHP A;  1XXC A;  4Q5G A;  4LMO A;  4KAW X;  1WQH A;  4KDD A;  3S0X A;  4QCL A;  2A6H D;  2BE5 D;  5IOS A;  1R5Z A;  4D3Y A;  3AH5 A;  3G4C A;  3LF9 A;  1O28 A;  2KWA A;  4KM9 A;  3LAP A;  3GTQ A;  4ILD A;  4GFQ A;  1TWF A;  3WVO A;  1O24 A;  1SEU A;  4J3N A;  1V9M A;  1O26 A;  5JVO A;  2GSN A;  3AQP A;  4JLR C;  1Y69 8;  2O5J D;  2R7Z A;  4KB2 A;  2WAQ A;  3Q3Q A;  1IW7 D;  4GTB A;  4LR2 A;  1RR8 C;  1B4A A;  4C3J C;  2CFA B;  4GTD A;  1TL8 A;  2Y0S A;  1WCM A;  4GTA A;  4KAS A;  1I3Q A;  1K4S A;  3L4K A;  3GTG A;  1EJ9 A;  4FYD A;  4BLA A;  5EGH A;  1F9N A;  3G4A A;  4BLB A;  1ZBS A;  4M1X A;  5CJ9 A;  5C9H A;  1TWG A;  2PHC B;  4GTE A;  3GTM A;  3LHP S;  1YNJ D;  3FKI A;  3MAQ A;  2PMZ A;  4GT9 A;  1T8I A;  2GSU A;  1IS1 A;  2WB1 A;  4Q5V A;  2NVY A;  1ZVU A;  3IAY A;  3P9A A;  1K4T A;  3K5L A;  3VA7 A;  2XCR B;  4IP8 A;  2CW0 D;  1KQ4 A;  1TWC A;  1EH1 A;  2XCQ A;  4BKW A;  2P5M A;  2CFA A;  4AYB A;  1BJT A;  1R9T A;  1A35 A;  1O29 A;  5IOR A;  2RGR A;  3ERE D;  1K83 A;  5JSB B;  4AHC A;  5IOT A;  3K59 A;  4KMA A;  1WQF A;  1TWH A;  3SJR A;  3GTO A;  1A31 A;  4C3I C;  3FHZ A;  1TWA A;  1ZYR D;  4GTC A;  2JA7 A;  4FZB A;  5MLC 9;  2YU9 A;  4DDQ A;  2JA5 A;  4AN8 A;  3N3Y A;  4LQY A;  1RRJ A;  3CQZ A;  2F4Q A;  4GTL A;  5JFE A;  4NOK A;  4KMH A;  3GTL A;  4OYD B;  3AQO A;  5JSN B;  2Y3P A;  3BUE A;  3FOF A;  4KAR A;  2B9S B;  4G0V A;  4H3T A;  3ORE A;  5TJ3 A;  3GTJ A;  3QX3 A;  2E2I A;  3DU6 A;  3KYL A;  1A36 A;  4IP9 A;  2JA6 A;  1WIH A;  2R92 A;  3M4A A;  3MML B;  1O2B A;  1Y1V A;  3NUH A;  3K5N A;  3OEP A;  4C3H C;  3GTP A;  2E2H A;  4FXD A;  1I6V D;  1BGW A;  3GTK A;  1O25 A;  1MIU A;  5EGE A;  1Y1W A;  3HKZ A;  4L8I A;  1Q8I A;  1ZXO A;  3DU5 A;  1YNN D;  2JH3 A;  4GTF A;  4D3Z A;  4F3E A;  2NVX A;  2XCO A;  2GSO A;  1O27 A;  3L4J A;  1DD5 A;  3K58 A;  4QIW A;  4O26 A;  4KMD A;  4FM9 A;  1R49 A;  1B4B A;  3H0G A;  5IOQ A;  2B63 A;  1I50 A;  4C2M A;  4FGU A;  3N0B A;  1XXA A;  1LPQ A;  4KB4 A;  4G0W A;  3LPX A;  1GE9 A;  1NH3 A;  2A6E D;  3K5M A;  2A69 D;  4KC6 A;  1WQG A;  1XXB A;  3N0C A;  1O2A A;  2A68 D;  3OPF A;  1SMY D;  2VUM A;  1AB4 A;  4P5B A;  3FOE A;  2RH6 A;  4NOL A;  1HQM D;  2R93 A;  3V4G A;  4NOM A;  3CAG A;  4G0U A;  2ZFZ A;  3LAJ A;  1ISE A;  5CQG A;  1SFO A;  4P5A A;  4KAT A;  1TGO A;  1SC7 A;  1EK8 A;  4C2M C;  3K57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...