1ISEA

Crystal structure of a mutant of ribosome recycling factor from escherichia coli, arg132gly
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
ISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVGRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a mutant of ribosome recycling factor from Escherichia coli, Arg132Gly
rcsb
source organism Escherichia coli
molecule tags Translation
molecule keywords Ribosome Recycling Factor
total genus 65
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1iseA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1iseA02
2XCOA 1B4AA 3LPXA 3BUEA 2P5MA 4KB2A 4J3NA 3OREA 3LF9A 4DDQA 4KAWX 5JVOA 4OYDB 2XCQA 1BGWA 3V4GA 4L8IA 3LAJA 4G0UA 1DD5A 1AB4A 2PHCB 3OEPA 3MMLB 1ZVUA 1WIHA 2ZFZA 1B4BA 1BJTA 2XCRB 1WQFA 3L4JA 3QX3A 1XXAA 4GFQA 1XXCA 4FM9A 2Y3PA 3VA7A 3CAGA 3LAPA 3NUHA 2RGRA 2KWAA 3FOEA 1IS1A 1WQGA 1XXBA 3OPFA 1EK8A 4KDDA 1F9NA 4G0WA 3FOFA 1ISEA 3LHPS 5CJ9A 5JSBB 4G0VA 3ERED 4JLRC 3FHZA 4KC6A 1EH1A 1WQHA 5JSNB 1Y698 1GE9A 4KB4A 5MLC9 3L4KA
chains in the Genus database with same CATH superfamily
3S2DC 3LPXA 1XZQB 2E2HK 1YNNA 3BP8C 2XCQA 3S14K 4L8IA 4G0UA 2R7ZK 4A3MK 2JA7C 3RZOC 5CHPA 4D3YA 4Y52K 3PO2K 3A8KA 4Y7NK 3A8JA 3PO3C 3TFIA 1WCMC 1WQGA 1VLOA 4BBRC 3G4CA 4X6AC 4Y52C 2A6HA 2BE5A 4F3EA 1V5VA 2O5IA 3L4KA 1I3QC 2XCOA 4A3CK 5M5XK 2NVYK 2NVXC 3FKIC 2JA5C 4GT9A 1BS2A 4XCHA 1T8IA 4NOIA 4GZYA 2JA8C 1YCLA 3N0CA 4AH6A 4C2MK 3I4MK 4JK1A 5IYCK 1XZPA 4P9SA 4FZBA 2KWAA 4KATA 3S1MK 3H0GK 2ZUFA 5CQGA 1SMYA 3LHPS 4OIRA 3M4OC 3WVOA 1ZYRA 2GAHC 3N3YA 2R92C 3M3YK 1Y1VA 5MLC9 2PA8L 1TWGK 4A3DK 4WJ3M 3S2HC 1Y1WK 4BKWA 3CQZK 2E2IK 3GTMK 2A69D 4OIOA 2YU9K 3CQZC 2E2IC 3GTMC 4XLNA 3S17K 3OEPA 5FLMK 2NVYA 4OIPA 1ZVUA 3S1MC 1KQ4A 1I50C 2GSOA 4BXXK 3TTGA 1TWFK 1SC7A 2VUMC 3K59A 4A3MC 2JA7K 4GTCA 2A69A 4G0VA 4C2MC 4G7HA 1SEUA 2CFAB 1WQHA 2WB1L 2Y0SL 1GE9A 3TFHA 1TWCA 3HOXC 1B4AA 2R93C 1HI9A 1PJ5A 3M4AA 5JFEA 3GTQK 3K5OA 4C3IK 1DD5A 1TGOA 2VUMA 1EJ9A 2PMZD 4KMUA 3CQZA 3GTMA 2E2IA 4KMDA 1WQFA 2NVTK 1F7VA 4O26A 2PMZL 4D3ZA 1WSRA 2RGRA 3GTGC 3SZZA 5IORA 1F9NA 3GTPA 2JA6K 3S15K 2R92A 4M1XA 3FHZA 1TWFA 4BY1K 3GTOC 3H3VD 4A3GC 2P5MA 1O2BA 4KB2A 4A3LK 1I6VD 1K4SA 1HQMA 1DCPA 4A3FK 1K83K 1TWCK 4GTEA 2WAQD 1IE0A 4GTBA 3S2DK 3GEEA 4KASA 1I50A 3K7AC 3L4JA 1C0AA 1TWHA 4A3KK 3I4MC 4BY7K 3OPFA 3DU5A 3I4NC 1EQRA 3BP3A 5JSBB 2YU9A 4BBSC 1USOA 3WODA 4KAWX 4A3LC 1BGWA 3GTKA 4MQ9A 4GTDA 5IP9K 3IPJA 4BBRK 2PMZA 5C3EC 1K83A 1JVIA 4GFQA 3EQLA 2V6TA 2B63A 4FYDA 3FOEA 1ZQ1C 1EI6A 1Y698 2WAQA 4KARA 3T01A 3GTQA 4A3EK 3HOYC 3AQOA 3HOYK 3GTGA 5IP7K 1O24A 4AYBA 3HKZD 2B63C 2RH6A 4GTLA 5M5WK 1VRQC 2EBBA 1R9TK 1EFWA 1TWFC 2ZFZA 2XCRB 2WAQL 1USMA 3QX3A 1XXCA 4YFXA 4AHCA 4BXXC 1O27A 5D4DA 4C3JK 3HXAA 4C2MA 4Y7NC 1EK8A 4KDDA 3SJRA 1TWCC 2YU9C 4Q5VA 1VH2A 3AD7C 1SFOA 1LPQA 5FLMC 3AD8C 4KM9A 3TFJA 3AH5A 1TWGC 4A3DC 1HQMD 3HOZK 4GTFA 3LF9A 1ZYRD 1Y1WC 3HOVC 4MEXA 1AB4A 4LR2A 3H0GC 3HOXK 4G7OA 3GTGK 1WIHA 4MEYA 1B4BA 4ILDA 3HOUC 4KN4A 1O25A 4QIWL 2FQTA 3H3VL 5E68A 3GDZA 1VGXA 1R9TC 5JSNB 4IP8A 3FKIK 2JA5K 1Q8IA 1PJ7A 3GTJK 3S1NC 2W7VA 1F93A 2V6UA 3OREA 2CFAA 2GAGC 3SZYA 5JVOA 3A8IA 4A3GK 1J6XA 4ZH4A 4PAAA 4PABA 3LAJA 1IL2A 2PHCB 4WILA 5EGEA 1DCOA 4Q4ZA 1BJTA 1A36A 3T00A 3H0GA 3S15C 1I6VA 2Y3PA 2NVQC 4YFKA 2ZUEA 2NVTC 1R49A 1DCHA 1YNND 4KMHA 2B9SB 1TWGA 5FJ8K 4AN8A 1WSVA 5IP9C 1Y1WA 3GTLA 1EH1A 4KMAA 2JA8K 3HKZA 4AYBD 1ZBSA 4XSXA 1IW7D 1RRJA 2JA6A 3GTPK 5EGHA 4Q5SA 2R92K 4QJVA 3GTJA 3S1RK 4A3CC 1I3QK 4A3JC 2WB1A 2Y0SA 4IP9A 3Q3QA 5C9HA 2JA7A 1L0WA 3LAPA 5C4JK 4P5BA 4A93K 5C4XC 4RMFA 1I50K 4A3BK 1RR8C 1INNA 3S16C 4G0WA 1A35A 4FGUA 2P8TA 4JLRC 1VJEA 3ERED 1PJ6A 3PO2C 3S17C 4KB4A 3S2HK 4J3NA 4DDQA 1O29A 1F7UA 3K57A 2JA6C 1XZQA 4KN7A 4C3JC 1WCMA 4LJZA 4A3BC 3G4AA 1XXAA 3GTKK 4BY7C 1O2FB 3K5MA 1O2AA 4QJVB 3GSIA 2PA8D 3RZOK 3DXJA 4O2DA 5IYCC 4LOWA 3K5LA 5IP7C 2B63K 2O5JA 1K83C 4QIWD 1SFOC 2R93K 4EJ3A 1ZXOA 4QIWA 4LK0A 4QCLA 2FQOA 1Y1VK 4C3HC 5L46A 4A3IK 1TWHK 2GSNA 3AD9C 3GIRA 1J6VA 2WB1D 2Y0SD 5IOQA 1UV7A 2CW0A 2JH3A 1R9TA 5C3EK 1WCMK 5M3MK 1J6WA 2BE5D 3N0BA 2A6HD 2GSUA 3HOVK 1NH3A 2R7ZC 2V6SA 1TWAA 1O28A 1IW7A 5IYDC 3GTQC 4XLPA 1X31C 2R4GA 1I3QA 4BBSK 4H3TA 2PPBA 1SFOK 3V4GA 3DU6A 1YNJD 2E2HC 1JOEA 3GTJC 2R93A 3ADAC 3S16K 3S1NK 1YNJA 1XZPB 4GTAA 5IOTA 5M3FK 2VUMK 5C4XK 4A93C 3VA7A 1WOSA 3HOWK 3NUHA 3HOUK 1IS1A 3GTLC 2A6ED 3GTKC 3K7AK 1R5ZA 1J98A 5HL8A 5TMFA 5M5YK 5IYBC 4FXDA 1V9MA 3MAQA 3FOFA 4BLBA 1SMYD 2F4QA 2CW0D 4A3FC 5IYDK 2NVXK 3GTPC 4A3EC 3GTOA 4OYDB 1WOOA 4BY1C 4LMOA 3IAYA 4LLGA 3HOZC 4BLAA 3M3YC 4X6AK 4OIQA 3P9AA 2A68A 3T02A 3MMLB 2E2JC 3JSTA 1G51A 1IBAA 4LK1A 5TJ3A 1I6HK 1WORA 4Q5GA 2NVQK 3PO3K 5C44C 1TWAC 5C4JC 2D6FC 1XXBA 4C45A 1XPPA 1Y1VC 4C3HK 5CJ9A 4AYBL 4OINA 3S1RC 4C3IC 3K5NA 2NVYC 1WOPA 1JQWA 4WJ4A 3S1QK 3GTOK 4XSZA 1TL8A 4P5AA 4A3KC 3HKZL 4FM9A 4G7ZA 3FKIA 2JA5A 1TWAK 1MIUA 5C44K 3AQPA 2E2HA 2E2JK 1ISEA 3RZDC 4YFNA 1I6HC 4NOLA 2R7ZA 3S0XA 2A68D 3BUEA 4A3IC 1IQ0A 3S14C 5TMCA 1O26A 1YX2A 4KM8A 4NOKA 2O5JD 3RZDK 3M4OK 1K4TA 4NOMA 5IYBK 1A31A 3HOWC 3GEHA 3CAGA 3I4NK 3K58A 4A3JK 3GTLK 2A6EA 1BDFA 1TWHC 3S1QC 2NVXA 5IOSA 3KYLA 4YG2A 4LQYA 4KC6A 3GEIA 1RU0A
chains in the Genus database with same CATH topology
3LPXA 2P5MA 1O2BA 4KB2A 2R4GA 3OREA 1I3QA 2CFAA 1I6VD 5JVOA 1K4SA 4H3TA 2XCQA 3V4GA 3DU6A 4L8IA 4GTEA 1YNJD 3LAJA 4G0UA 2PHCB 4GTBA 5EGEA 2R93A 5CHPA 4D3YA 4KASA 1I50A 4GTAA 1BJTA 1A36A 5IOTA 3H0GA 3L4JA 2Y3PA 3VA7A 1TWHA 3NUHA 1IS1A 1WQGA 1R49A 1YNND 2A6ED 2B9SB 3OPFA 4KMHA 1TWGA 3DU5A 3G4CA 1R5ZA 4AN8A 1Y1WA 5JSBB 3GTLA 4F3EA 1EH1A 1V9MA 2YU9A 4FXDA 4KMAA 3MAQA 3FOFA 4BLBA 1SMYD 2XCOA 3HKZA 2F4QA 2CW0D 1ZBSA 1IW7D 1RRJA 2JA6A 5EGHA 4KAWX 3GTOA 4OYDB 4LMOA 1BGWA 4GT9A 3IAYA 1T8IA 3GTJA 3GTKA 4GTDA 4BLAA 3P9AA 3MMLB 3N0CA 2PMZA 5TJ3A 2WB1A 2Y0SA 1K83A 3L4KA 4IP9A 4GFQA 3Q3QA 5C9HA 4Q5GA 2JA7A 3LAPA 4FZBA 4P5BA 2B63A 2KWAA 4FYDA 3FOEA 1XXBA 4KATA 1RR8C 5CQGA 4G0WA 1A35A 4FGUA 3LHPS 5CJ9A 3ERED 4JLRC 3WVOA 2WAQA 1Y698 3N3YA 3GTQA 4KARA 4KB4A 1Y1VA 5MLC9 4C3IC 4J3NA 4DDQA 3AQOA 3K5NA 1O29A 4BKWA 3GTGA 2A69D 1O24A 4AYBA 2RH6A 4GTLA 3OEPA 3K57A 2NVYA 1ZVUA 4C3JC 1WCMA 2ZFZA 1TL8A 4P5AA 2XCRB 3G4AA 1KQ4A 3QX3A 1XXAA 1XXCA 4FM9A 2GSOA 3K5MA 1O2AA 4AHCA 1O27A 3FKIA 2JA5A 1MIUA 1SC7A 4C2MA 3AQPA 1EK8A 3K59A 4KDDA 2E2HA 3SJRA 3K5LA 4GTCA 1ISEA 4G0VA 4Q5VA 4C2MC 1SFOA 1SEUA 1LPQA 4NOLA 1WQHA 2CFAB 1GE9A 4KM9A 1TWCA 2R7ZA 3S0XA 3AH5A 1B4AA 2A68D 3BUEA 1HQMD 4GTFA 3LF9A 1ZYRD 4EJ3A 1ZXOA 4QIWA 3M4AA 1O26A 5JFEA 4QCLA 3K5OA 4KM8A 4C3HC 4NOKA 1DD5A 1TGOA 2VUMA 1AB4A 4LR2A 2O5JD 1EJ9A 1K4TA 2GSNA 3CQZA 3GTMA 4NOMA 2E2IA 1WIHA 4KMDA 1B4BA 1WQFA 4ILDA 1A31A 4O26A 3CAGA 5IOQA 3K58A 4D3ZA 1R9TA 2JH3A 1O28A 1O25A 2RGRA 2BE5D 3N0BA 5IORA 2A6HD 1F9NA 3GTPA 2NVXA 3KYLA 5IOSA 2GSUA 2R92A 4M1XA 4LQYA 1NH3A 3FHZA 1TWFA 4IP8A 1TWAA 4KC6A 5JSNB 1Q8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XCO A;  1B4A A;  3LPX A;  3BUE A;  2P5M A;  4KB2 A;  4J3N A;  3ORE A;  3LF9 A;  4DDQ A;  4KAW X;  5JVO A;  4OYD B;  2XCQ A;  1BGW A;  3V4G A;  4L8I A;  3LAJ A;  4G0U A;  1DD5 A;  1AB4 A;  2PHC B;  3OEP A;  3MML B;  1ZVU A;  1WIH A;  2ZFZ A;  1B4B A;  1BJT A;  2XCR B;  1WQF A;  3L4J A;  3QX3 A;  1XXA A;  4GFQ A;  1XXC A;  4FM9 A;  2Y3P A;  3VA7 A;  3CAG A;  3LAP A;  3NUH A;  2RGR A;  2KWA A;  3FOE A;  1IS1 A;  1WQG A;  1XXB A;  3OPF A;  1EK8 A;  4KDD A;  1F9N A;  4G0W A;  3FOF A;  1ISE A;  3LHP S;  5CJ9 A;  5JSB B;  4G0V A;  3ERE D;  4JLR C;  3FHZ A;  4KC6 A;  1EH1 A;  1WQH A;  5JSN B;  1Y69 8;  1GE9 A;  4KB4 A;  5MLC 9;  3L4K A; 
#chains in the Genus database with same CATH topology
 3S2D C;  3LPX A;  1XZQ B;  2E2H K;  1YNN A;  3BP8 C;  2XCQ A;  3S14 K;  4L8I A;  4G0U A;  2R7Z K;  4A3M K;  2JA7 C;  3RZO C;  5CHP A;  4D3Y A;  4Y52 K;  3PO2 K;  3A8K A;  4Y7N K;  3A8J A;  3PO3 C;  3TFI A;  1WCM C;  1WQG A;  1VLO A;  4BBR C;  3G4C A;  4X6A C;  4Y52 C;  2A6H A;  2BE5 A;  4F3E A;  1V5V A;  2O5I A;  3L4K A;  1I3Q C;  2XCO A;  4A3C K;  5M5X K;  2NVY K;  2NVX C;  3FKI C;  2JA5 C;  4GT9 A;  1BS2 A;  4XCH A;  1T8I A;  4NOI A;  4GZY A;  2JA8 C;  1YCL A;  3N0C A;  4AH6 A;  4C2M K;  3I4M K;  4JK1 A;  5IYC K;  1XZP A;  4P9S A;  4FZB A;  2KWA A;  4KAT A;  3S1M K;  3H0G K;  2ZUF A;  5CQG A;  1SMY A;  3LHP S;  4OIR A;  3M4O C;  3WVO A;  1ZYR A;  2GAH C;  3N3Y A;  2R92 C;  3M3Y K;  1Y1V A;  5MLC 9;  2PA8 L;  1TWG K;  4A3D K;  4WJ3 M;  3S2H C;  1Y1W K;  4BKW A;  3CQZ K;  2E2I K;  3GTM K;  2A69 D;  4OIO A;  2YU9 K;  3CQZ C;  2E2I C;  3GTM C;  4XLN A;  3S17 K;  3OEP A;  5FLM K;  2NVY A;  4OIP A;  1ZVU A;  3S1M C;  1KQ4 A;  1I50 C;  2GSO A;  4BXX K;  3TTG A;  1TWF K;  1SC7 A;  2VUM C;  3K59 A;  4A3M C;  2JA7 K;  4GTC A;  2A69 A;  4G0V A;  4C2M C;  4G7H A;  1SEU A;  2CFA B;  1WQH A;  2WB1 L;  2Y0S L;  1GE9 A;  3TFH A;  1TWC A;  3HOX C;  1B4A A;  2R93 C;  1HI9 A;  1PJ5 A;  3M4A A;  5JFE A;  3GTQ K;  3K5O A;  4C3I K;  1DD5 A;  1TGO A;  2VUM A;  1EJ9 A;  2PMZ D;  4KMU A;  3CQZ A;  3GTM A;  2E2I A;  4KMD A;  1WQF A;  2NVT K;  1F7V A;  4O26 A;  2PMZ L;  4D3Z A;  1WSR A;  2RGR A;  3GTG C;  3SZZ A;  5IOR A;  1F9N A;  3GTP A;  2JA6 K;  3S15 K;  2R92 A;  4M1X A;  3FHZ A;  1TWF A;  4BY1 K;  3GTO C;  3H3V D;  4A3G C;  2P5M A;  1O2B A;  4KB2 A;  4A3L K;  1I6V D;  1K4S A;  1HQM A;  1DCP A;  4A3F K;  1K83 K;  1TWC K;  4GTE A;  2WAQ D;  1IE0 A;  4GTB A;  3S2D K;  3GEE A;  4KAS A;  1I50 A;  3K7A C;  3L4J A;  1C0A A;  1TWH A;  4A3K K;  3I4M C;  4BY7 K;  3OPF A;  3DU5 A;  3I4N C;  1EQR A;  3BP3 A;  5JSB B;  2YU9 A;  4BBS C;  1USO A;  3WOD A;  4KAW X;  4A3L C;  1BGW A;  3GTK A;  4MQ9 A;  4GTD A;  5IP9 K;  3IPJ A;  4BBR K;  2PMZ A;  5C3E C;  1K83 A;  1JVI A;  4GFQ A;  3EQL A;  2V6T A;  2B63 A;  4FYD A;  3FOE A;  1ZQ1 C;  1EI6 A;  1Y69 8;  2WAQ A;  4KAR A;  3T01 A;  3GTQ A;  4A3E K;  3HOY C;  3AQO A;  3HOY K;  3GTG A;  5IP7 K;  1O24 A;  4AYB A;  3HKZ D;  2B63 C;  2RH6 A;  4GTL A;  5M5W K;  1VRQ C;  2EBB A;  1R9T K;  1EFW A;  1TWF C;  2ZFZ A;  2XCR B;  2WAQ L;  1USM A;  3QX3 A;  1XXC A;  4YFX A;  4AHC A;  4BXX C;  1O27 A;  5D4D A;  4C3J K;  3HXA A;  4C2M A;  4Y7N C;  1EK8 A;  4KDD A;  3SJR A;  1TWC C;  2YU9 C;  4Q5V A;  1VH2 A;  3AD7 C;  1SFO A;  1LPQ A;  5FLM C;  3AD8 C;  4KM9 A;  3TFJ A;  3AH5 A;  1TWG C;  4A3D C;  1HQM D;  3HOZ K;  4GTF A;  3LF9 A;  1ZYR D;  1Y1W C;  3HOV C;  4MEX A;  1AB4 A;  4LR2 A;  3H0G C;  3HOX K;  4G7O A;  3GTG K;  1WIH A;  4MEY A;  1B4B A;  4ILD A;  3HOU C;  4KN4 A;  1O25 A;  4QIW L;  2FQT A;  3H3V L;  5E68 A;  3GDZ A;  1VGX A;  1R9T C;  5JSN B;  4IP8 A;  3FKI K;  2JA5 K;  1Q8I A;  1PJ7 A;  3GTJ K;  3S1N C;  2W7V A;  1F93 A;  2V6U A;  3ORE A;  2CFA A;  2GAG C;  3SZY A;  5JVO A;  3A8I A;  4A3G K;  1J6X A;  4ZH4 A;  4PAA A;  4PAB A;  3LAJ A;  1IL2 A;  2PHC B;  4WIL A;  5EGE A;  1DCO A;  4Q4Z A;  1BJT A;  1A36 A;  3T00 A;  3H0G A;  3S15 C;  1I6V A;  2Y3P A;  2NVQ C;  4YFK A;  2ZUE A;  2NVT C;  1R49 A;  1DCH A;  1YNN D;  4KMH A;  2B9S B;  1TWG A;  5FJ8 K;  4AN8 A;  1WSV A;  5IP9 C;  1Y1W A;  3GTL A;  1EH1 A;  4KMA A;  2JA8 K;  3HKZ A;  4AYB D;  1ZBS A;  4XSX A;  1IW7 D;  1RRJ A;  2JA6 A;  3GTP K;  5EGH A;  4Q5S A;  2R92 K;  4QJV A;  3GTJ A;  3S1R K;  4A3C C;  1I3Q K;  4A3J C;  2WB1 A;  2Y0S A;  4IP9 A;  3Q3Q A;  5C9H A;  2JA7 A;  1L0W A;  3LAP A;  5C4J K;  4P5B A;  4A93 K;  5C4X C;  4RMF A;  1I50 K;  4A3B K;  1RR8 C;  1INN A;  3S16 C;  4G0W A;  1A35 A;  4FGU A;  2P8T A;  4JLR C;  1VJE A;  3ERE D;  1PJ6 A;  3PO2 C;  3S17 C;  4KB4 A;  3S2H K;  4J3N A;  4DDQ A;  1O29 A;  1F7U A;  3K57 A;  2JA6 C;  1XZQ A;  4KN7 A;  4C3J C;  1WCM A;  4LJZ A;  4A3B C;  3G4A A;  1XXA A;  3GTK K;  4BY7 C;  1O2F B;  3K5M A;  1O2A A;  4QJV B;  3GSI A;  2PA8 D;  3RZO K;  3DXJ A;  4O2D A;  5IYC C;  4LOW A;  3K5L A;  5IP7 C;  2B63 K;  2O5J A;  1K83 C;  4QIW D;  1SFO C;  2R93 K;  4EJ3 A;  1ZXO A;  4QIW A;  4LK0 A;  4QCL A;  2FQO A;  1Y1V K;  4C3H C;  5L46 A;  4A3I K;  1TWH K;  2GSN A;  3AD9 C;  3GIR A;  1J6V A;  2WB1 D;  2Y0S D;  5IOQ A;  1UV7 A;  2CW0 A;  2JH3 A;  1R9T A;  5C3E K;  1WCM K;  5M3M K;  1J6W A;  2BE5 D;  3N0B A;  2A6H D;  2GSU A;  3HOV K;  1NH3 A;  2R7Z C;  2V6S A;  1TWA A;  1O28 A;  1IW7 A;  5IYD C;  3GTQ C;  4XLP A;  1X31 C;  2R4G A;  1I3Q A;  4BBS K;  4H3T A;  2PPB A;  1SFO K;  3V4G A;  3DU6 A;  1YNJ D;  2E2H C;  1JOE A;  3GTJ C;  2R93 A;  3ADA C;  3S16 K;  3S1N K;  1YNJ A;  1XZP B;  4GTA A;  5IOT A;  5M3F K;  2VUM K;  5C4X K;  4A93 C;  3VA7 A;  1WOS A;  3HOW K;  3NUH A;  3HOU K;  1IS1 A;  3GTL C;  2A6E D;  3GTK C;  3K7A K;  1R5Z A;  1J98 A;  5HL8 A;  5TMF A;  5M5Y K;  5IYB C;  4FXD A;  1V9M A;  3MAQ A;  3FOF A;  4BLB A;  1SMY D;  2F4Q A;  2CW0 D;  4A3F C;  5IYD K;  2NVX K;  3GTP C;  4A3E C;  3GTO A;  4OYD B;  1WOO A;  4BY1 C;  4LMO A;  3IAY A;  4LLG A;  3HOZ C;  4BLA A;  3M3Y C;  4X6A K;  4OIQ A;  3P9A A;  2A68 A;  3T02 A;  3MML B;  2E2J C;  3JST A;  1G51 A;  1IBA A;  4LK1 A;  5TJ3 A;  1I6H K;  1WOR A;  4Q5G A;  2NVQ K;  3PO3 K;  5C44 C;  1TWA C;  5C4J C;  2D6F C;  1XXB A;  4C45 A;  1XPP A;  1Y1V C;  4C3H K;  5CJ9 A;  4AYB L;  4OIN A;  3S1R C;  4C3I C;  3K5N A;  2NVY C;  1WOP A;  1JQW A;  4WJ4 A;  3S1Q K;  3GTO K;  4XSZ A;  1TL8 A;  4P5A A;  4A3K C;  3HKZ L;  4FM9 A;  4G7Z A;  3FKI A;  2JA5 A;  1TWA K;  1MIU A;  5C44 K;  3AQP A;  2E2H A;  2E2J K;  1ISE A;  3RZD C;  4YFN A;  1I6H C;  4NOL A;  2R7Z A;  3S0X A;  2A68 D;  3BUE A;  4A3I C;  1IQ0 A;  3S14 C;  5TMC A;  1O26 A;  1YX2 A;  4KM8 A;  4NOK A;  2O5J D;  3RZD K;  3M4O K;  1K4T A;  4NOM A;  5IYB K;  1A31 A;  3HOW C;  3GEH A;  3CAG A;  3I4N K;  3K58 A;  4A3J K;  3GTL K;  2A6E A;  1BDF A;  1TWH C;  3S1Q C;  2NVX A;  5IOS A;  3KYL A;  4YG2 A;  4LQY A;  4KC6 A;  3GEI A;  1RU0 A; 
#chains in the Genus database with same CATH homology
 3LPX A;  2P5M A;  1O2B A;  4KB2 A;  2R4G A;  3ORE A;  1I3Q A;  2CFA A;  1I6V D;  5JVO A;  1K4S A;  4H3T A;  2XCQ A;  3V4G A;  3DU6 A;  4L8I A;  4GTE A;  1YNJ D;  3LAJ A;  4G0U A;  2PHC B;  4GTB A;  5EGE A;  2R93 A;  5CHP A;  4D3Y A;  4KAS A;  1I50 A;  4GTA A;  1BJT A;  1A36 A;  5IOT A;  3H0G A;  3L4J A;  2Y3P A;  3VA7 A;  1TWH A;  3NUH A;  1IS1 A;  1WQG A;  1R49 A;  1YNN D;  2A6E D;  2B9S B;  3OPF A;  4KMH A;  1TWG A;  3DU5 A;  3G4C A;  1R5Z A;  4AN8 A;  1Y1W A;  5JSB B;  3GTL A;  4F3E A;  1EH1 A;  1V9M A;  2YU9 A;  4FXD A;  4KMA A;  3MAQ A;  3FOF A;  4BLB A;  1SMY D;  2XCO A;  3HKZ A;  2F4Q A;  2CW0 D;  1ZBS A;  1IW7 D;  1RRJ A;  2JA6 A;  5EGH A;  4KAW X;  3GTO A;  4OYD B;  4LMO A;  1BGW A;  4GT9 A;  3IAY A;  1T8I A;  3GTJ A;  3GTK A;  4GTD A;  4BLA A;  3P9A A;  3MML B;  3N0C A;  2PMZ A;  5TJ3 A;  2WB1 A;  2Y0S A;  1K83 A;  3L4K A;  4IP9 A;  4GFQ A;  3Q3Q A;  5C9H A;  4Q5G A;  2JA7 A;  3LAP A;  4FZB A;  4P5B A;  2B63 A;  2KWA A;  4FYD A;  3FOE A;  1XXB A;  4KAT A;  1RR8 C;  5CQG A;  4G0W A;  1A35 A;  4FGU A;  3LHP S;  5CJ9 A;  3ERE D;  4JLR C;  3WVO A;  2WAQ A;  1Y69 8;  3N3Y A;  3GTQ A;  4KAR A;  4KB4 A;  1Y1V A;  5MLC 9;  4C3I C;  4J3N A;  4DDQ A;  3AQO A;  3K5N A;  1O29 A;  4BKW A;  3GTG A;  2A69 D;  1O24 A;  4AYB A;  2RH6 A;  4GTL A;  3OEP A;  3K57 A;  2NVY A;  1ZVU A;  4C3J C;  1WCM A;  2ZFZ A;  1TL8 A;  4P5A A;  2XCR B;  3G4A A;  1KQ4 A;  3QX3 A;  1XXA A;  1XXC A;  4FM9 A;  2GSO A;  3K5M A;  1O2A A;  4AHC A;  1O27 A;  3FKI A;  2JA5 A;  1MIU A;  1SC7 A;  4C2M A;  3AQP A;  1EK8 A;  3K59 A;  4KDD A;  2E2H A;  3SJR A;  3K5L A;  4GTC A;  1ISE A;  4G0V A;  4Q5V A;  4C2M C;  1SFO A;  1SEU A;  1LPQ A;  4NOL A;  1WQH A;  2CFA B;  1GE9 A;  4KM9 A;  1TWC A;  2R7Z A;  3S0X A;  3AH5 A;  1B4A A;  2A68 D;  3BUE A;  1HQM D;  4GTF A;  3LF9 A;  1ZYR D;  4EJ3 A;  1ZXO A;  4QIW A;  3M4A A;  1O26 A;  5JFE A;  4QCL A;  3K5O A;  4KM8 A;  4C3H C;  4NOK A;  1DD5 A;  1TGO A;  2VUM A;  1AB4 A;  4LR2 A;  2O5J D;  1EJ9 A;  1K4T A;  2GSN A;  3CQZ A;  3GTM A;  4NOM A;  2E2I A;  1WIH A;  4KMD A;  1B4B A;  1WQF A;  4ILD A;  1A31 A;  4O26 A;  3CAG A;  5IOQ A;  3K58 A;  4D3Z A;  1R9T A;  2JH3 A;  1O28 A;  1O25 A;  2RGR A;  2BE5 D;  3N0B A;  5IOR A;  2A6H D;  1F9N A;  3GTP A;  2NVX A;  3KYL A;  5IOS A;  2GSU A;  2R92 A;  4M1X A;  4LQY A;  1NH3 A;  3FHZ A;  1TWF A;  4IP8 A;  1TWA A;  4KC6 A;  5JSN B;  1Q8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...