1ISEA

Crystal structure of a mutant of ribosome recycling factor from escherichia coli, arg132gly
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
ISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVGRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome Recycling Factor
publication title Crystal structure of a mutant of ribosome recycling factor from Escherichia coli, Arg132Gly
rcsb
source organism Escherichia coli
molecule tags Translation
total genus 65
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1iseA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1iseA02
1IS1A 3FOFA 4FM9A 4J3NA 3FHZA 4G0UA 4KC6A 4OYDB 5JSNB 5MLC9 3LPXA 3NUHA 1Y698 5JVOA 4G0VA 3LF9A 3OPFA 3CAGA 1EK8A 1BGWA 1ZVUA 3VA7A 5CJ9A 4KB2A 4L8IA 4DDQA 1B4BA 1BJTA 4KB4A 3LHPS 1XXAA 4G0WA 3OEPA 3FOEA 3L4JA 2RGRA 1WQHA 1ISEA 1WIHA 3BUEA 2XCQA 2PHCB 2XCRB 4JLRC 3QX3A 1EH1A 4KAWX 1XXBA 1XXCA 1DD5A 2ZFZA 2XCOA 3MMLB 2KWAA 3V4GA 1B4AA 3OREA 3ERED 2Y3PA 4GFQA 2P5MA 3LAPA 1AB4A 4KDDA 5JSBB 3L4KA 1WQGA 1F9NA 1GE9A 3LAJA 1WQFA
chains in the Genus database with same CATH superfamily
1I3QK 2WAQA 1DCOA 1JQWA 3DU6A 4F3EA 4IP9A 2JA5K 3GTMK 3S1RC 1TWGA 1TWHC 3CQZA 1BJTA 2JH3A 5M5YK 4ILDA 1K83A 4FGUA 3TTGA 1XXBA 1J6XA 5IP7C 2PMZA 1YX2A 1F7VA 2JA6A 3GTOC 4A3JC 3SJRA 1IQ0A 3HOYK 4KDDA 1YNJA 1HQMD 1GE9A 3H0GK 4Q5SA 3AH5A 1ZBSA 1R5ZA 1PJ7A 1I3QA 2R92C 1T8IA 3DXJA 2JA7K 3S14C 3VA7A 1C0AA 4BY7C 3I4NK 3H3VL 5IOTA 3KYLA 3GTMA 3M4AA 1WIHA 5C4JK 4Y7NC 2B63C 4QIWL 3GEIA 3GIRA 3GTLK 2YU9A 2V6SA 5JSBB 2JA8C 4C2MK 1VJEA 1MIUA 3FHZA 5IYDC 2Y0SD 4OYDB 2E2JC 1F7UA 4NOMA 2CFAA 1R9TA 2ZUFA 1Y1VK 4KATA 4GT9A 3Q3QA 2R7ZC 3S1QK 4GTBA 1WSRA 2R4GA 2CW0D 3HKZD 4C45A 4IP8A 1V9MA 1TGOA 1WCMC 2FQOA 2CFAB 2ZFZA 1WORA 4FYDA 4P9SA 3AD9C 3GTJK 4X6AK 2E2IA 4C3HC 1TWFC 3GTPC 4LMOA 3N3YA 3S16K 1SC7A 4Y52K 1IE0A 1SFOC 4XLPA 1I6HC 4OIOA 5FLMK 1O28A 2EBBA 4A3MC 3S2HC 3K5OA 5IOQA 4A3BC 2V6TA 5M5WK 4H3TA 2NVXK 4C3IK 1Y1WA 1EI6A 3T01A 1TWGC 3AD8C 3CQZC 4BXXC 1UV7A 4KMAA 4A3GC 1WOPA 2VUMA 3BP8C 2PHCB 1K83C 1J6WA 3FKIA 1XPPA 3S1MK 4A3CC 1TWCA 4AHCA 1KQ4A 2JA6C 3PO2K 3HOZC 4D3YA 3M3YC 4A3KK 4GTAA 1I50A 5CJ9A 3S2DC 4A3EK 1BDFA 3M4OK 1SEUA 3MAQA 3I4MC 3S17K 4BBSC 4YFXA 1TL8A 4GTEA 5JFEA 4KAWX 4A93K 3GTQA 1TWAK 1USMA 1PJ6A 5EGEA 2R93K 2NVYK 2A6ED 3GTKK 4AYBL 2A68D 3L4KA 1WQGA 5IOSA 4G0UA 4KM9A 4RMFA 5IYCK 3AQPA 5C4XK 3OPFA 4KM8A 2WB1L 2YU9C 2A6HD 3S15C 5IP9K 5C3EC 5D4DA 3HOVK 1EJ9A 4WJ4A 4GTFA 1JVIA 1R9TC 2E2HK 1O26A 3SZZA 3WVOA 2KWAA 5C44C 3RZDK 2NVQC 2A69D 3K7AK 1Q8IA 2W7VA 4C3JK 3HOWK 4BLBA 4A3DK 4J3NA 1VLOA 1X31C 1VRQC 1Y698 4QCLA 5JVOA 4P5AA 5IYBK 2D6FC 3T00A 4M1XA 4A3FK 1A31A 4BY1K 1HI9A 4QIWA 4PABA 4LK0A 2WAQL 2JA5A 2E2IC 4Q5VA 3BUEA 2XCRB 2XCQA 3S1RK 4BBRC 1O2AA 1R49A 1TWHK 3K59A 2PA8D 3RZOC 4KMHA 2GAGC 2RH6A 3HOXC 1O27A 3LAJA 4LJZA 4FM9A 5IP7K 4KC6A 5MLC9 2PMZL 2ZUEA 3GTOK 4A3JK 3H0GA 2A6EA 4KMDA 4AYBD 1Y1WC 2A68A 3N0CA 1EK8A 1BGWA 3AD7C 1ZVUA 4LLGA 1USOA 3PO3C 2VUMC 1O25A 2JA7A 4KB4A 2R92K 3FKIC 4KN4A 3FOEA 2NVTC 3S14K 3TFHA 1TWCC 2A6HA 4BY7K 4MEYA 1I50C 2FQTA 5FJ8K 4P5BA 1A35A 2GSOA 4GFQA 4LR2A 3GTGC 4Y7NK 2B63K 3IAYA 3GTLA 1WSVA 1VGXA 3GTQC 1IW7A 3NUHA 4C2MA 1I6VD 1PJ5A 2A69A 3GSIA 1EFWA 2JA8K 3S1NC 4KN7A 4L8IA 4NOLA 1ZQ1C 5IYDK 1DCHA 2E2JK 1Y1VA 5C9HA 4Q4ZA 3OEPA 3S0XA 5E68A 1VH2A 2R7ZK 4NOIA 3WODA 3H3VD 3V4GA 4A3LC 3LAPA 2GAHC 4OINA 4NOKA 3TFJA 1WCMK 4QIWD 1RRJA 1XZPA 4XCHA 1INNA 3GTJA 3LF9A 3CAGA 3EQLA 4KB2A 4YFKA 3G4CA 5HL8A 4C3HK 1TWFK 3GTPK 4AYBA 4FZBA 3HOUC 4A3IC 1XZPB 5CQGA 4EJ3A 1O2FB 1I3QC 1SFOK 4BKWA 2XCOA 1I6HK 1B4AA 4KARA 4A3MK 3ADAC 2NVXA 5M3MK 3S2HK 4AN8A 2BE5D 4O2DA 2JA5C 4A3BK 3GTMC 3FOFA 5JSNB 1TWGK 1A36A 3CQZK 4BXXK 4A3GK 1J6VA 4KMUA 1K83K 5TMCA 1I6VA 4MQ9A 4AH6A 4A3CK 3HOYC 3A8IA 3SZYA 1WQHA 5M5XK 1TWFA 2JA6K 3HOZK 3P9AA 1RR8C 3M3YK 3H0GC 1EH1A 1K4SA 3IPJA 4QJVA 3S2DK 2Y0SL 3ERED 3GDZA 3I4MK 3HOUK 1IW7D 4BBSK 2JA7C 1TWAA 3A8KA 1WOSA 3I4NC 2R93A 4PAAA 2NVYA 5EGHA 4OIQA 3GTKA 4WILA 3LPXA 1O2BA 1EQRA 4QJVB 4JK1A 5C4JC 1K4TA 4GTCA 4MEXA 3HKZL 1YNND 4GTLA 2O5JD 3GTLC 1J98A 1XZQA 4C2MC 2YU9K 1XXCA 5TMFA 3S15K 5C3EK 3GEEA 3K58A 5IORA 2E2HA 1Y1VC 4WJ3M 1R9TK 3S1QC 1XZQB 4FXDA 1DCPA 4YG2A 5C44K 1NH3A 1YCLA 2NVQK 2BE5A 5CHPA 1JOEA 1V5VA 2V6UA 4DDQA 4OIRA 4OIPA 1F93A 1ISEA 2WB1D 4XLNA 3GTJC 4X6AC 1DD5A 3MMLB 1SMYA 4LOWA 2E2IK 1ZYRD 1TWHA 1AB4A 5M3FK 3S16C 4BBRK 1WQFA 1IS1A 4Y52C 3RZOK 1L0WA 5FLMC 3N0BA 3HOXK 4G0VA 1O24A 2GSNA 2NVXC 4C3IC 3GTOA 3GEHA 3K57A 4G7OA 1Y1WK 3K5NA 4G0WA 3L4JA 2RGRA 3QX3A 4JLRC 1YNNA 3JSTA 3PO3K 3BP3A 2VUMK 2R92A 2WAQD 2O5JA 3G4AA 3S1MC 3K5LA 3FKIK 2F4QA 2NVTK 1WOOA 3PO2C 1TWCK 2P8TA 4A3KC 4A3EC 3M4OC 4O26A 1I50K 1G51A 1LPQA 1HQMA 3S17C 2B9SB 4YFNA 2B63A 4GZYA 1ZXOA 5TJ3A 3GTGK 4A93C 4BLAA 1TWAC 1B4BA 4KASA 3K5MA 3A8JA 3GTQK 2PMZD 2R93C 2NVYC 3GTKC 4Q5GA 3S1NK 2PPBA 1YNJD 4G7HA 3OREA 5IYCC 2GSUA 2P5MA 5C4XC 2R7ZA 3T02A 2WB1A 1O29A 1BS2A 5IP9C 3HXAA 4GTDA 4A3LK 1ZYRA 1IL2A 4LK1A 4LQYA 3HOVC 1WCMA 2Y0SA 2PA8L 2E2HC 3DU5A 2O5IA 3LHPS 3GTGA 3RZDC 1XXAA 1SMYD 4D3ZA 1RU0A 3K7AC 4XSZA 4XSXA 3TFIA 4C3JC 1IBAA 3GTPA 5L46A 3HOWC 4A3DC 2CW0A 2Y3PA 5IYBC 3HKZA 3AQOA 4A3FC 1SFOA 4ZH4A 4A3IK 1F9NA 4BY1C 4G7ZA
chains in the Genus database with same CATH topology
2WAQA 3IAYA 3GTLA 3FKIA 4FXDA 3NUHA 3DU6A 4C2MA 1NH3A 1I6VD 1TWCA 4AHCA 1KQ4A 5CHPA 4F3EA 4IP9A 4D3YA 4GTAA 1I50A 1TWGA 4L8IA 3CQZA 5CJ9A 4DDQA 1BJTA 4NOLA 2JH3A 1SEUA 3MAQA 1Y1VA 5C9HA 3OEPA 4ILDA 3S0XA 1ISEA 1TL8A 4FGUA 1K83A 4GTEA 5JFEA 4KAWX 3GTQA 1XXBA 1DD5A 3V4GA 3MMLB 2PMZA 2JA6A 5EGEA 3SJRA 3LAPA 2A6ED 1ZYRD 1TWHA 1AB4A 4KDDA 2A68D 1HQMD 4NOKA 1WQGA 3L4KA 1GE9A 5IOSA 1WQFA 1IS1A 3AH5A 1ZBSA 1R5ZA 1RRJA 4KM9A 4G0UA 3N0BA 3AQPA 1I3QA 4G0VA 1T8IA 3GTJA 3LF9A 3OPFA 3CAGA 4KM8A 1O24A 2GSNA 3VA7A 4KB2A 2A6HD 4C3IC 3GTOA 3K57A 3G4CA 5IOTA 3KYLA 3GTMA 4AYBA 3M4AA 3K5NA 4G0WA 3L4JA 2RGRA 3QX3A 4FZBA 1WIHA 1EJ9A 4JLRC 5CQGA 4EJ3A 4GTFA 1O26A 2R92A 4BKWA 3WVOA 2XCOA 2KWAA 1B4AA 3G4AA 4KARA 3K5LA 2NVXA 2F4QA 4AN8A 2BE5D 2YU9A 5JSBB 2A69D 1Q8IA 1MIUA 4BLBA 3FOFA 4J3NA 3FHZA 4O26A 4OYDB 5JSNB 1Y698 1A36A 4QCLA 1LPQA 4P5AA 5JVOA 4NOMA 2CFAA 1R9TA 2B9SB 4KATA 1A31A 2B63A 4M1XA 1ZXOA 4QIWA 4GT9A 5TJ3A 4BLAA 3Q3QA 1B4BA 4KASA 3K5MA 4GTBA 2JA5A 4Q5VA 2R4GA 1WQHA 2CW0D 1TWFA 4Q5GA 2XCQA 3P9AA 1YNJD 1RR8C 3BUEA 1EH1A 2XCRB 4IP8A 1V9MA 1TGOA 1K4SA 1R49A 1O2AA 3K59A 2CFAB 2ZFZA 4KMHA 4FYDA 3OREA 2GSUA 2RH6A 3ERED 1IW7D 2P5MA 1TWAA 1O27A 2R7ZA 2WB1A 1O29A 3LAJA 4FM9A 2R93A 2E2IA 2NVYA 4KC6A 5MLC9 3GTKA 5EGHA 4C3HC 3LPXA 4LMOA 4GTDA 1O2BA 3H0GA 4KMDA 4LQYA 1WCMA 3N0CA 3N3YA 1EK8A 1SC7A 1K4TA 1BGWA 1ZVUA 4GTCA 2Y0SA 1YNND 4GTLA 3DU5A 1O25A 2JA7A 4KB4A 2O5JD 3LHPS 3GTGA 1O28A 1XXAA 3FOEA 1SMYD 4D3ZA 3K5OA 4C2MC 5IOQA 4C3JC 4H3TA 3GTPA 1XXCA 1Y1WA 4P5BA 3K58A 1A35A 2GSOA 2Y3PA 4GFQA 4KMAA 3HKZA 4LR2A 5IORA 3AQOA 2E2HA 1SFOA 2VUMA 1F9NA 2PHCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IS1 A;  3FOF A;  4FM9 A;  4J3N A;  3FHZ A;  4G0U A;  4KC6 A;  4OYD B;  5JSN B;  5MLC 9;  3LPX A;  3NUH A;  1Y69 8;  5JVO A;  4G0V A;  3LF9 A;  3OPF A;  3CAG A;  1EK8 A;  1BGW A;  1ZVU A;  3VA7 A;  5CJ9 A;  4KB2 A;  4L8I A;  4DDQ A;  1B4B A;  1BJT A;  4KB4 A;  3LHP S;  1XXA A;  4G0W A;  3OEP A;  3FOE A;  3L4J A;  2RGR A;  1WQH A;  1ISE A;  1WIH A;  3BUE A;  2XCQ A;  2PHC B;  2XCR B;  4JLR C;  3QX3 A;  1EH1 A;  4KAW X;  1XXB A;  1XXC A;  1DD5 A;  2ZFZ A;  2XCO A;  3MML B;  2KWA A;  3V4G A;  1B4A A;  3ORE A;  3ERE D;  2Y3P A;  4GFQ A;  2P5M A;  3LAP A;  1AB4 A;  4KDD A;  5JSB B;  3L4K A;  1WQG A;  1F9N A;  1GE9 A;  3LAJ A;  1WQF A; 
#chains in the Genus database with same CATH topology
 1I3Q K;  2WAQ A;  1DCO A;  1JQW A;  3DU6 A;  4F3E A;  4IP9 A;  2JA5 K;  3GTM K;  3S1R C;  1TWG A;  1TWH C;  3CQZ A;  1BJT A;  2JH3 A;  5M5Y K;  4ILD A;  1K83 A;  4FGU A;  3TTG A;  1XXB A;  1J6X A;  5IP7 C;  2PMZ A;  1YX2 A;  1F7V A;  2JA6 A;  3GTO C;  4A3J C;  3SJR A;  1IQ0 A;  3HOY K;  4KDD A;  1YNJ A;  1HQM D;  1GE9 A;  3H0G K;  4Q5S A;  3AH5 A;  1ZBS A;  1R5Z A;  1PJ7 A;  1I3Q A;  2R92 C;  1T8I A;  3DXJ A;  2JA7 K;  3S14 C;  3VA7 A;  1C0A A;  4BY7 C;  3I4N K;  3H3V L;  5IOT A;  3KYL A;  3GTM A;  3M4A A;  1WIH A;  5C4J K;  4Y7N C;  2B63 C;  4QIW L;  3GEI A;  3GIR A;  3GTL K;  2YU9 A;  2V6S A;  5JSB B;  2JA8 C;  4C2M K;  1VJE A;  1MIU A;  3FHZ A;  5IYD C;  2Y0S D;  4OYD B;  2E2J C;  1F7U A;  4NOM A;  2CFA A;  1R9T A;  2ZUF A;  1Y1V K;  4KAT A;  4GT9 A;  3Q3Q A;  2R7Z C;  3S1Q K;  4GTB A;  1WSR A;  2R4G A;  2CW0 D;  3HKZ D;  4C45 A;  4IP8 A;  1V9M A;  1TGO A;  1WCM C;  2FQO A;  2CFA B;  2ZFZ A;  1WOR A;  4FYD A;  4P9S A;  3AD9 C;  3GTJ K;  4X6A K;  2E2I A;  4C3H C;  1TWF C;  3GTP C;  4LMO A;  3N3Y A;  3S16 K;  1SC7 A;  4Y52 K;  1IE0 A;  1SFO C;  4XLP A;  1I6H C;  4OIO A;  5FLM K;  1O28 A;  2EBB A;  4A3M C;  3S2H C;  3K5O A;  5IOQ A;  4A3B C;  2V6T A;  5M5W K;  4H3T A;  2NVX K;  4C3I K;  1Y1W A;  1EI6 A;  3T01 A;  1TWG C;  3AD8 C;  3CQZ C;  4BXX C;  1UV7 A;  4KMA A;  4A3G C;  1WOP A;  2VUM A;  3BP8 C;  2PHC B;  1K83 C;  1J6W A;  3FKI A;  1XPP A;  3S1M K;  4A3C C;  1TWC A;  4AHC A;  1KQ4 A;  2JA6 C;  3PO2 K;  3HOZ C;  4D3Y A;  3M3Y C;  4A3K K;  4GTA A;  1I50 A;  5CJ9 A;  3S2D C;  4A3E K;  1BDF A;  3M4O K;  1SEU A;  3MAQ A;  3I4M C;  3S17 K;  4BBS C;  4YFX A;  1TL8 A;  4GTE A;  5JFE A;  4KAW X;  4A93 K;  3GTQ A;  1TWA K;  1USM A;  1PJ6 A;  5EGE A;  2R93 K;  2NVY K;  2A6E D;  3GTK K;  4AYB L;  2A68 D;  3L4K A;  1WQG A;  5IOS A;  4G0U A;  4KM9 A;  4RMF A;  5IYC K;  3AQP A;  5C4X K;  3OPF A;  4KM8 A;  2WB1 L;  2YU9 C;  2A6H D;  3S15 C;  5IP9 K;  5C3E C;  5D4D A;  3HOV K;  1EJ9 A;  4WJ4 A;  4GTF A;  1JVI A;  1R9T C;  2E2H K;  1O26 A;  3SZZ A;  3WVO A;  2KWA A;  5C44 C;  3RZD K;  2NVQ C;  2A69 D;  3K7A K;  1Q8I A;  2W7V A;  4C3J K;  3HOW K;  4BLB A;  4A3D K;  4J3N A;  1VLO A;  1X31 C;  1VRQ C;  1Y69 8;  4QCL A;  5JVO A;  4P5A A;  5IYB K;  2D6F C;  3T00 A;  4M1X A;  4A3F K;  1A31 A;  4BY1 K;  1HI9 A;  4QIW A;  4PAB A;  4LK0 A;  2WAQ L;  2JA5 A;  2E2I C;  4Q5V A;  3BUE A;  2XCR B;  2XCQ A;  3S1R K;  4BBR C;  1O2A A;  1R49 A;  1TWH K;  3K59 A;  2PA8 D;  3RZO C;  4KMH A;  2GAG C;  2RH6 A;  3HOX C;  1O27 A;  3LAJ A;  4LJZ A;  4FM9 A;  5IP7 K;  4KC6 A;  5MLC 9;  2PMZ L;  2ZUE A;  3GTO K;  4A3J K;  3H0G A;  2A6E A;  4KMD A;  4AYB D;  1Y1W C;  2A68 A;  3N0C A;  1EK8 A;  1BGW A;  3AD7 C;  1ZVU A;  4LLG A;  1USO A;  3PO3 C;  2VUM C;  1O25 A;  2JA7 A;  4KB4 A;  2R92 K;  3FKI C;  4KN4 A;  3FOE A;  2NVT C;  3S14 K;  3TFH A;  1TWC C;  2A6H A;  4BY7 K;  4MEY A;  1I50 C;  2FQT A;  5FJ8 K;  4P5B A;  1A35 A;  2GSO A;  4GFQ A;  4LR2 A;  3GTG C;  4Y7N K;  2B63 K;  3IAY A;  3GTL A;  1WSV A;  1VGX A;  3GTQ C;  1IW7 A;  3NUH A;  4C2M A;  1I6V D;  1PJ5 A;  2A69 A;  3GSI A;  1EFW A;  2JA8 K;  3S1N C;  4KN7 A;  4L8I A;  4NOL A;  1ZQ1 C;  5IYD K;  1DCH A;  2E2J K;  1Y1V A;  5C9H A;  4Q4Z A;  3OEP A;  3S0X A;  5E68 A;  1VH2 A;  2R7Z K;  4NOI A;  3WOD A;  3H3V D;  3V4G A;  4A3L C;  3LAP A;  2GAH C;  4OIN A;  4NOK A;  3TFJ A;  1WCM K;  4QIW D;  1RRJ A;  1XZP A;  4XCH A;  1INN A;  3GTJ A;  3LF9 A;  3CAG A;  3EQL A;  4KB2 A;  4YFK A;  3G4C A;  5HL8 A;  4C3H K;  1TWF K;  3GTP K;  4AYB A;  4FZB A;  3HOU C;  4A3I C;  1XZP B;  5CQG A;  4EJ3 A;  1O2F B;  1I3Q C;  1SFO K;  4BKW A;  2XCO A;  1I6H K;  1B4A A;  4KAR A;  4A3M K;  3ADA C;  2NVX A;  5M3M K;  3S2H K;  4AN8 A;  2BE5 D;  4O2D A;  2JA5 C;  4A3B K;  3GTM C;  3FOF A;  5JSN B;  1TWG K;  1A36 A;  3CQZ K;  4BXX K;  4A3G K;  1J6V A;  4KMU A;  1K83 K;  5TMC A;  1I6V A;  4MQ9 A;  4AH6 A;  4A3C K;  3HOY C;  3A8I A;  3SZY A;  1WQH A;  5M5X K;  1TWF A;  2JA6 K;  3HOZ K;  3P9A A;  1RR8 C;  3M3Y K;  3H0G C;  1EH1 A;  1K4S A;  3IPJ A;  4QJV A;  3S2D K;  2Y0S L;  3ERE D;  3GDZ A;  3I4M K;  3HOU K;  1IW7 D;  4BBS K;  2JA7 C;  1TWA A;  3A8K A;  1WOS A;  3I4N C;  2R93 A;  4PAA A;  2NVY A;  5EGH A;  4OIQ A;  3GTK A;  4WIL A;  3LPX A;  1O2B A;  1EQR A;  4QJV B;  4JK1 A;  5C4J C;  1K4T A;  4GTC A;  4MEX A;  3HKZ L;  1YNN D;  4GTL A;  2O5J D;  3GTL C;  1J98 A;  1XZQ A;  4C2M C;  2YU9 K;  1XXC A;  5TMF A;  3S15 K;  5C3E K;  3GEE A;  3K58 A;  5IOR A;  2E2H A;  1Y1V C;  4WJ3 M;  1R9T K;  3S1Q C;  1XZQ B;  4FXD A;  1DCP A;  4YG2 A;  5C44 K;  1NH3 A;  1YCL A;  2NVQ K;  2BE5 A;  5CHP A;  1JOE A;  1V5V A;  2V6U A;  4DDQ A;  4OIR A;  4OIP A;  1F93 A;  1ISE A;  2WB1 D;  4XLN A;  3GTJ C;  4X6A C;  1DD5 A;  3MML B;  1SMY A;  4LOW A;  2E2I K;  1ZYR D;  1TWH A;  1AB4 A;  5M3F K;  3S16 C;  4BBR K;  1WQF A;  1IS1 A;  4Y52 C;  3RZO K;  1L0W A;  5FLM C;  3N0B A;  3HOX K;  4G0V A;  1O24 A;  2GSN A;  2NVX C;  4C3I C;  3GTO A;  3GEH A;  3K57 A;  4G7O A;  1Y1W K;  3K5N A;  4G0W A;  3L4J A;  2RGR A;  3QX3 A;  4JLR C;  1YNN A;  3JST A;  3PO3 K;  3BP3 A;  2VUM K;  2R92 A;  2WAQ D;  2O5J A;  3G4A A;  3S1M C;  3K5L A;  3FKI K;  2F4Q A;  2NVT K;  1WOO A;  3PO2 C;  1TWC K;  2P8T A;  4A3K C;  4A3E C;  3M4O C;  4O26 A;  1I50 K;  1G51 A;  1LPQ A;  1HQM A;  3S17 C;  2B9S B;  4YFN A;  2B63 A;  4GZY A;  1ZXO A;  5TJ3 A;  3GTG K;  4A93 C;  4BLA A;  1TWA C;  1B4B A;  4KAS A;  3K5M A;  3A8J A;  3GTQ K;  2PMZ D;  2R93 C;  2NVY C;  3GTK C;  4Q5G A;  3S1N K;  2PPB A;  1YNJ D;  4G7H A;  3ORE A;  5IYC C;  2GSU A;  2P5M A;  5C4X C;  2R7Z A;  3T02 A;  2WB1 A;  1O29 A;  1BS2 A;  5IP9 C;  3HXA A;  4GTD A;  4A3L K;  1ZYR A;  1IL2 A;  4LK1 A;  4LQY A;  3HOV C;  1WCM A;  2Y0S A;  2PA8 L;  2E2H C;  3DU5 A;  2O5I A;  3LHP S;  3GTG A;  3RZD C;  1XXA A;  1SMY D;  4D3Z A;  1RU0 A;  3K7A C;  4XSZ A;  4XSX A;  3TFI A;  4C3J C;  1IBA A;  3GTP A;  5L46 A;  3HOW C;  4A3D C;  2CW0 A;  2Y3P A;  5IYB C;  3HKZ A;  3AQO A;  4A3F C;  1SFO A;  4ZH4 A;  4A3I K;  1F9N A;  4BY1 C;  4G7Z A; 
#chains in the Genus database with same CATH homology
 2WAQ A;  3IAY A;  3GTL A;  3FKI A;  4FXD A;  3NUH A;  3DU6 A;  4C2M A;  1NH3 A;  1I6V D;  1TWC A;  4AHC A;  1KQ4 A;  5CHP A;  4F3E A;  4IP9 A;  4D3Y A;  4GTA A;  1I50 A;  1TWG A;  4L8I A;  3CQZ A;  5CJ9 A;  4DDQ A;  1BJT A;  4NOL A;  2JH3 A;  1SEU A;  3MAQ A;  1Y1V A;  5C9H A;  3OEP A;  4ILD A;  3S0X A;  1ISE A;  1TL8 A;  4FGU A;  1K83 A;  4GTE A;  5JFE A;  4KAW X;  3GTQ A;  1XXB A;  1DD5 A;  3V4G A;  3MML B;  2PMZ A;  2JA6 A;  5EGE A;  3SJR A;  3LAP A;  2A6E D;  1ZYR D;  1TWH A;  1AB4 A;  4KDD A;  2A68 D;  1HQM D;  4NOK A;  1WQG A;  3L4K A;  1GE9 A;  5IOS A;  1WQF A;  1IS1 A;  3AH5 A;  1ZBS A;  1R5Z A;  1RRJ A;  4KM9 A;  4G0U A;  3N0B A;  3AQP A;  1I3Q A;  4G0V A;  1T8I A;  3GTJ A;  3LF9 A;  3OPF A;  3CAG A;  4KM8 A;  1O24 A;  2GSN A;  3VA7 A;  4KB2 A;  2A6H D;  4C3I C;  3GTO A;  3K57 A;  3G4C A;  5IOT A;  3KYL A;  3GTM A;  4AYB A;  3M4A A;  3K5N A;  4G0W A;  3L4J A;  2RGR A;  3QX3 A;  4FZB A;  1WIH A;  1EJ9 A;  4JLR C;  5CQG A;  4EJ3 A;  4GTF A;  1O26 A;  2R92 A;  4BKW A;  3WVO A;  2XCO A;  2KWA A;  1B4A A;  3G4A A;  4KAR A;  3K5L A;  2NVX A;  2F4Q A;  4AN8 A;  2BE5 D;  2YU9 A;  5JSB B;  2A69 D;  1Q8I A;  1MIU A;  4BLB A;  3FOF A;  4J3N A;  3FHZ A;  4O26 A;  4OYD B;  5JSN B;  1Y69 8;  1A36 A;  4QCL A;  1LPQ A;  4P5A A;  5JVO A;  4NOM A;  2CFA A;  1R9T A;  2B9S B;  4KAT A;  1A31 A;  2B63 A;  4M1X A;  1ZXO A;  4QIW A;  4GT9 A;  5TJ3 A;  4BLA A;  3Q3Q A;  1B4B A;  4KAS A;  3K5M A;  4GTB A;  2JA5 A;  4Q5V A;  2R4G A;  1WQH A;  2CW0 D;  1TWF A;  4Q5G A;  2XCQ A;  3P9A A;  1YNJ D;  1RR8 C;  3BUE A;  1EH1 A;  2XCR B;  4IP8 A;  1V9M A;  1TGO A;  1K4S A;  1R49 A;  1O2A A;  3K59 A;  2CFA B;  2ZFZ A;  4KMH A;  4FYD A;  3ORE A;  2GSU A;  2RH6 A;  3ERE D;  1IW7 D;  2P5M A;  1TWA A;  1O27 A;  2R7Z A;  2WB1 A;  1O29 A;  3LAJ A;  4FM9 A;  2R93 A;  2E2I A;  2NVY A;  4KC6 A;  5MLC 9;  3GTK A;  5EGH A;  4C3H C;  3LPX A;  4LMO A;  4GTD A;  1O2B A;  3H0G A;  4KMD A;  4LQY A;  1WCM A;  3N0C A;  3N3Y A;  1EK8 A;  1SC7 A;  1K4T A;  1BGW A;  1ZVU A;  4GTC A;  2Y0S A;  1YNN D;  4GTL A;  3DU5 A;  1O25 A;  2JA7 A;  4KB4 A;  2O5J D;  3LHP S;  3GTG A;  1O28 A;  1XXA A;  3FOE A;  1SMY D;  4D3Z A;  3K5O A;  4C2M C;  5IOQ A;  4C3J C;  4H3T A;  3GTP A;  1XXC A;  1Y1W A;  4P5B A;  3K58 A;  1A35 A;  2GSO A;  2Y3P A;  4GFQ A;  4KMA A;  3HKZ A;  4LR2 A;  5IOR A;  3AQO A;  2E2H A;  1SFO A;  2VUM A;  1F9N A;  2PHC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...