1ISEA

Crystal structure of a mutant of ribosome recycling factor from escherichia coli, arg132gly
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
ISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVGRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Ribosome Recycling Factor
publication title Crystal structure of a mutant of ribosome recycling factor from Escherichia coli, Arg132Gly
rcsb
source organism Escherichia coli
total genus 65
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1iseA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1iseA02
3OREA 1GE9A 4OYDB 1B4AA 2ZFZA 2XCQA 4G0VA 1WQGA 3L4KA 2KWAA 1BGWA 4KC6A 5JVOA 1EK8A 1XXAA 3CAGA 5JSBB 4KAWX 1AB4A 3MMLB 4L8IA 3LHPS 1WQHA 1B4BA 2XCOA 3BUEA 1WQFA 2XCRB 3OEPA 1BJTA 4J3NA 2RGRA 3L4JA 4KDDA 4G0UA 3LF9A 4KB2A 1XXBA 1ZVUA 3OPFA 3VA7A 3LPXA 3LAPA 3LAJA 3FHZA 5JSNB 4JLRC 2P5MA 3FOFA 3FOEA 3ERED 4DDQA 3V4GA 1DD5A 1EH1A 1F9NA 5CJ9A 1XXCA 5MLC9 4KB4A 1IS1A 1WIHA 4G0WA 4FM9A 1ISEA 3QX3A 4GFQA 2Y3PA 3NUHA 1Y698 2PHCB
chains in the Genus database with same CATH superfamily
5EGHA 5C9HA 4MEXA 4BLBA 3FKIC 1YX2A 1XZPA 2E2IC 4XLNA 1ZQ1C 2F4QA 3T00A 4PAAA 4OIOA 3M3YK 4YFKA 1WQHA 3GTOA 5C44C 3JSTA 1RRJA 4OIPA 4D3ZA 3M3YC 4BXXK 4X6AC 2GAGC 3IAYA 2Y0SL 3HOYC 3GEEA 3K5MA 1K83K 5M3MK 4BXXC 2PMZL 2GSUA 1F9NA 1VJEA 3PO2K 1K83C 3I4MK 4FXDA 4IP9A 4WJ4A 1SFOA 3AD8C 1IBAA 2XCRB 2ZFZA 2GSNA 3TFJA 2XCQA 4BY1K 3HXAA 1WQGA 4GTEA 5TJ3A 4MQ9A 4C3HC 1TWAA 3MMLB 3S1NK 1WORA 4Y52C 4RMFA 1BJTA 1JQWA 1L0WA 3I4NC 4BBRK 1VRQC 1WOPA 4A3DK 3HOZK 5IYCK 3LAPA 3HKZA 4BKWA 1I3QC 2E2HK 2R4GA 4BBRC 5CJ9A 4A3BK 3A8IA 4KARA 3SZZA 4G7ZA 3K5OA 3PO3C 5C4XK 4A3BC 5C3EK 4GZYA 3DXJA 1SEUA 3HOVC 4Q5VA 4KN7A 5EGEA 3SJRA 1A35A 5IOTA 1TWFK 3L4KA 4NOKA 5C3EC 1XZPB 1R5ZA 3TFHA 5FJ8K 1EFWA 5M5YK 3SZYA 4O26A 4XLPA 3RZOK 4GTDA 3FHZA 4LLGA 1Y1WC 1EH1A 3K7AC 4QJVA 5IORA 1IS1A 2FQOA 1G51A 4Q4ZA 4C45A 4QIWL 5IOSA 3NUHA 3HOWK 3S2HK 1WOOA 2JH3A 3H0GK 2R7ZA 3CAGA 1R9TK 2E2JK 4OINA 3BP8C 4A93K 2E2HA 1TWGK 3ADAC 3S2DK 1R9TC 2NVXC 2E2JC 4OIRA 4J3NA 4AN8A 1TWGC 3S1MC 1USMA 1JVIA 3K5LA 5IOQA 4LR2A 3FOFA 3DU5A 3FOEA 5M3FK 4BBSK 2O5JA 1TWFA 4P5BA 4LK0A 2Y0SA 2JA7C 3GTKK 4C3JK 2Y3PA 2PMZA 1O24A 1IW7A 3GTKC 4JK1A 2KWAA 3CQZK 2WAQL 1EK8A 2B63K 4BY7K 2A69D 2VUMK 4A3JC 2JA8K 4KM8A 4KMHA 3S0XA 3GTMC 5HL8A 3GSIA 3G4AA 2R92C 5JSNB 1V5VA 2P5MA 4KN4A 2JA5C 3H0GA 2V6SA 1XXCA 3GTLC 4QJVB 3FKIK 2E2IK 1RU0A 1O29A 2V6UA 4OYDB 1TWHC 2B9SB 2WB1L 4A3CC 5C44K 3S15C 2A6HD 1VGXA 4P5AA 4X6AK 4G7HA 3HOYK 1MIUA 1HQMA 2A6HA 5TMCA 4YG2A 3GTJC 1DCPA 3OPFA 1O2AA 1R49A 2V6TA 4DDQA 1YNJA 3CQZA 4AYBL 1O26A 2B63A 3K57A 2CW0A 4FM9A 2VUMA 4LJZA 5JFEA 1Y698 2PHCB 2GAHC 4C3HK 1PJ5A 4QIWA 4A3MK 4Y52K 1J6WA 3I4NK 5C4JK 1WQFA 4A3MC 1Y1VC 3H3VL 1SC7A 4EJ3A 3T01A 1I3QK 1KQ4A 3HKZD 3FKIA 2E2IA 5C4JC 5L46A 3LPXA 4JLRC 3WODA 3PO3K 2R93C 5MLC9 1WIHA 2GSOA 1BS2A 3N3YA 4GT9A 1J98A 4OIQA 1UV7A 1IL2A 2YU9C 3HOVK 4GTCA 5M5WK 2NVQC 1WOSA 4QCLA 3S17C 1LPQA 3TFIA 2O5IA 1K83A 4A3LC 3BUEA 2WAQA 3P9AA 5CHPA 1Y1WK 4FGUA 3K5NA 3K59A 3K7AK 1YNND 1I6HK 1DCHA 3LAJA 5FLMC 3ERED 3S16C 1O2FB 1A31A 2PA8L 3V4GA 2BE5A 1O28A 3EQLA 1YNNA 2JA6K 1I6HC 1TGOA 4G0VA 5IP9C 3S1QK 2JA6C 1TWCC 2NVTC 1I3QA 4A3FK 3S1QC 4A3EK 3GTGC 2NVXK 1AB4A 4KMUA 3S1MK 1O27A 2WB1A 4A3FC 3OEPA 4A3EC 4Y7NC 5IYDC 4KDDA 1XXBA 4G0WA 2O5JD 4IP8A 2JA7K 1O25A 2Y0SD 1C0AA 1V9MA 1EQRA 4BLAA 2PMZD 1ISEA 1DCOA 5M5XK 1IW7D 2D6FC 2EBBA 1B4AA 3GTPC 4C3IC 1Y1WA 1BGWA 3WVOA 4A3JK 4KAWX 4M1XA 4FZBA 2W7VA 3GTMK 3Q3QA 2R92K 2JA5K 4G0UA 3LF9A 3VA7A 3IPJA 3GTLK 3AQPA 4F3EA 4A3KC 3GTOC 1R9TA 2NVXA 1I6VA 1ZXOA 1TWHK 1TWGA 3HOUC 4A3CK 3OREA 1GE9A 4GTFA 3S15K 2ZUEA 2A68A 5JVOA 4AHCA 2NVYK 5IYBK 5JSBB 3GEHA 4Q5GA 2JA7A 1HQMD 3GTJK 3S14C 1PJ7A 1F7VA 2NVYC 4O2DA 5IYBC 1TL8A 4KM9A 1SFOC 1J6XA 3GTKA 4WILA 4NOIA 1YNJD 3T02A 4A3GK 2CW0D 4H3TA 4KB4A 3HOXK 4YFNA 4ILDA 4A3GC 1F7UA 2CFAA 3GTMA 4QIWD 1O2BA 3HOXC 2R92A 4YFXA 4KC6A 1K4TA 2JA5A 1HI9A 4L8IA 1Y1VK 3RZDK 3GTLA 1Q8IA 3RZDC 3M4AA 4GTAA 1TWHA 2R93K 4NOLA 3KYLA 2YU9K 1IQ0A 2NVYA 4C2MK 3PO2C 3GTJA 2NVQK 4LMOA 1USOA 3I4MC 1WSVA 4C2MC 1T8IA 3S17K 4A3LK 4BY1C 3G4CA 4G7OA 4GTBA 2WAQD 2XCOA 4Q5SA 3S1NC 2R7ZK 5IP7K 2RGRA 5FLMK 2PPBA 4LQYA 3S16K 1BDFA 2BE5D 2P8TA 3TTGA 5IP7C 2R7ZC 1INNA 4A3DC 3HOZC 5IYCC 3A8JA 2E2HC 5IP9K 1Y1VA 1TWCK 3AD9C 1K4SA 2NVTK 1WCMK 4KMDA 3DU6A 3GTGK 5TMFA 2A6ED 5C4XC 1XZQA 4XSXA 2CFAB 2R93A 1WCMC 2A6EA 1VH2A 1EJ9A 2WB1D 1TWFC 4Y7NK 5IYDK 3BP3A 4NOMA 2YU9A 4GTLA 4C2MA 3L4JA 1RR8C 4PABA 4P9SA 4WJ3M 3GTQK 3RZOC 1SMYD 1DD5A 2ZUFA 4KASA 4KMAA 1SMYA 1I50K 3GTQC 1VLOA 1PJ6A 4AYBD 3GTPK 1IE0A 4C3IK 1YCLA 4KATA 2FQTA 1I50C 4AYBA 1F93A 3HOWC 1ZYRD 1ZBSA 4XCHA 3S2HC 3H0GC 3LHPS 3MAQA 1ZYRA 4ZH4A 3HKZL 4XSZA 3S1RK 3N0CA 4A93C 3GDZA 2JA6A 1JOEA 3S2DC 1TWCA 5CQGA 4D3YA 4KB2A 3H3VD 1J6VA 4LOWA 4A3KK 3S1RC 1WCMA 3GTOK 3GEIA 3GTGA 1NH3A 3AD7C 1WSRA 4MEYA 1I6VD 3HOUK 4AH6A 2RH6A 4LK1A 1XPPA 3QX3A 4BBSC 4GFQA 3AH5A 1A36A 2A68D 4C3JC 3N0BA 4A3IK 3GIRA 1XXAA 3M4OK 3S14K 1XZQB 3CQZC 3AQOA 3GTQA 4A3IC 1SFOK 2B63C 4BY7C 1B4BA 2A69A 3M4OC 2VUMC 2JA8C 1I50A 3K58A 3GTPA 1TWAK 1ZVUA 1EI6A 3A8KA 4FYDA 1X31C 1TWAC 5D4DA 5E68A 2PA8D
chains in the Genus database with same CATH topology
4LMOA 5C9HA 5EGHA 4BLBA 1O24A 4C2MC 1T8IA 1I3QA 2KWAA 2F4QA 1EK8A 1AB4A 2A69D 3G4CA 4GTBA 1WQHA 3GTOA 4KM8A 2XCOA 1O27A 2WB1A 3OEPA 1RRJA 4D3ZA 4KMHA 2RGRA 3S0XA 4LQYA 4KDDA 3IAYA 1XXBA 4G0WA 2O5JD 3G4AA 2BE5D 4IP8A 5JSNB 3K5MA 2P5MA 1O25A 2GSUA 3H0GA 1F9NA 1V9MA 1XXCA 4BLAA 1ISEA 1Y1VA 4FXDA 4IP9A 1K4SA 1SFOA 1IW7D 2XCRB 4KMDA 1O29A 3DU6A 4OYDB 1B4AA 2GSNA 2XCQA 2ZFZA 2A6ED 1WQGA 4GTEA 5TJ3A 1Y1WA 2B9SB 3WVOA 1BGWA 2CFAB 4C3IC 4C3HC 1TWAA 2R93A 3MMLB 4KAWX 4M1XA 1EJ9A 2A6HD 4FZBA 4P5AA 4NOMA 2YU9A 1BJTA 3Q3QA 1MIUA 4GTLA 4C2MA 3L4JA 1RR8C 4G0UA 3LF9A 3OPFA 3VA7A 3HKZA 4BKWA 3LAPA 1O2AA 1R49A 1SMYD 2R4GA 4DDQA 1DD5A 3AQPA 3CQZA 4F3EA 5CJ9A 1O26A 2B63A 4KARA 4KASA 4KMAA 3K57A 4FM9A 1R9TA 2NVXA 3K5OA 2VUMA 5JFEA 1ZXOA 1TWGA 1Y698 2PHCB 3OREA 4KATA 1SEUA 1GE9A 4GTFA 4Q5VA 4AYBA 3L4KA 5EGEA 3SJRA 1A35A 1ZYRD 4QIWA 1ZBSA 5IOTA 4AHCA 4NOKA 5JVOA 1R5ZA 5JSBB 3LHPS 3MAQA 4Q5GA 2JA7A 1HQMD 1WQFA 5IORA 4O26A 3N0CA 1TL8A 1SC7A 4EJ3A 4KM9A 2JA6A 1KQ4A 1TWCA 3FKIA 5CQGA 3GTKA 2E2IA 4D3YA 4KB2A 4GTDA 1WCMA 1YNJD 3LPXA 3FHZA 4JLRC 3GTGA 1NH3A 1EH1A 2CW0D 4H3TA 1I6VD 4KB4A 1IS1A 5MLC9 1WIHA 2GSOA 2RH6A 3N3YA 4GT9A 3QX3A 4GFQA 5IOSA 3AH5A 3NUHA 4ILDA 2CFAA 4GTCA 1A36A 2A68D 3GTMA 1O2BA 3N0BA 4C3JC 2R92A 2JH3A 2R7ZA 4KC6A 1K4TA 2JA5A 4QCLA 1XXAA 3CAGA 4L8IA 1LPQA 2E2HA 3GTLA 3GTQA 3AQOA 1K83A 1B4BA 3BUEA 1Q8IA 2WAQA 3P9AA 5CHPA 4J3NA 4AN8A 1I50A 4FGUA 3M4AA 3K58A 3GTPA 3K5NA 3K59A 4GTAA 1TWHA 3K5LA 5IOQA 1ZVUA 1YNND 4NOLA 4LR2A 3LAJA 3FOFA 3ERED 3DU5A 3KYLA 3FOEA 1A31A 3V4GA 1O28A 1TWFA 4FYDA 4P5BA 2Y0SA 2NVYA 1TGOA 2Y3PA 2PMZA 4G0VA 3GTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ORE A;  1GE9 A;  4OYD B;  1B4A A;  2ZFZ A;  2XCQ A;  4G0V A;  1WQG A;  3L4K A;  2KWA A;  1BGW A;  4KC6 A;  5JVO A;  1EK8 A;  1XXA A;  3CAG A;  5JSB B;  4KAW X;  1AB4 A;  3MML B;  4L8I A;  3LHP S;  1WQH A;  1B4B A;  2XCO A;  3BUE A;  1WQF A;  2XCR B;  3OEP A;  1BJT A;  4J3N A;  2RGR A;  3L4J A;  4KDD A;  4G0U A;  3LF9 A;  4KB2 A;  1XXB A;  1ZVU A;  3OPF A;  3VA7 A;  3LPX A;  3LAP A;  3LAJ A;  3FHZ A;  5JSN B;  4JLR C;  2P5M A;  3FOF A;  3FOE A;  3ERE D;  4DDQ A;  3V4G A;  1DD5 A;  1EH1 A;  1F9N A;  5CJ9 A;  1XXC A;  5MLC 9;  4KB4 A;  1IS1 A;  1WIH A;  4G0W A;  4FM9 A;  1ISE A;  3QX3 A;  4GFQ A;  2Y3P A;  3NUH A;  1Y69 8;  2PHC B; 
#chains in the Genus database with same CATH topology
 5EGH A;  5C9H A;  4MEX A;  4BLB A;  3FKI C;  1YX2 A;  1XZP A;  2E2I C;  4XLN A;  1ZQ1 C;  2F4Q A;  3T00 A;  4PAA A;  4OIO A;  3M3Y K;  4YFK A;  1WQH A;  3GTO A;  5C44 C;  3JST A;  1RRJ A;  4OIP A;  4D3Z A;  3M3Y C;  4BXX K;  4X6A C;  2GAG C;  3IAY A;  2Y0S L;  3HOY C;  3GEE A;  3K5M A;  1K83 K;  5M3M K;  4BXX C;  2PMZ L;  2GSU A;  1F9N A;  1VJE A;  3PO2 K;  1K83 C;  3I4M K;  4FXD A;  4IP9 A;  4WJ4 A;  1SFO A;  3AD8 C;  1IBA A;  2XCR B;  2ZFZ A;  2GSN A;  3TFJ A;  2XCQ A;  4BY1 K;  3HXA A;  1WQG A;  4GTE A;  5TJ3 A;  4MQ9 A;  4C3H C;  1TWA A;  3MML B;  3S1N K;  1WOR A;  4Y52 C;  4RMF A;  1BJT A;  1JQW A;  1L0W A;  3I4N C;  4BBR K;  1VRQ C;  1WOP A;  4A3D K;  3HOZ K;  5IYC K;  3LAP A;  3HKZ A;  4BKW A;  1I3Q C;  2E2H K;  2R4G A;  4BBR C;  5CJ9 A;  4A3B K;  3A8I A;  4KAR A;  3SZZ A;  4G7Z A;  3K5O A;  3PO3 C;  5C4X K;  4A3B C;  5C3E K;  4GZY A;  3DXJ A;  1SEU A;  3HOV C;  4Q5V A;  4KN7 A;  5EGE A;  3SJR A;  1A35 A;  5IOT A;  1TWF K;  3L4K A;  4NOK A;  5C3E C;  1XZP B;  1R5Z A;  3TFH A;  5FJ8 K;  1EFW A;  5M5Y K;  3SZY A;  4O26 A;  4XLP A;  3RZO K;  4GTD A;  3FHZ A;  4LLG A;  1Y1W C;  1EH1 A;  3K7A C;  4QJV A;  5IOR A;  1IS1 A;  2FQO A;  1G51 A;  4Q4Z A;  4C45 A;  4QIW L;  5IOS A;  3NUH A;  3HOW K;  3S2H K;  1WOO A;  2JH3 A;  3H0G K;  2R7Z A;  3CAG A;  1R9T K;  2E2J K;  4OIN A;  3BP8 C;  4A93 K;  2E2H A;  1TWG K;  3ADA C;  3S2D K;  1R9T C;  2NVX C;  2E2J C;  4OIR A;  4J3N A;  4AN8 A;  1TWG C;  3S1M C;  1USM A;  1JVI A;  3K5L A;  5IOQ A;  4LR2 A;  3FOF A;  3DU5 A;  3FOE A;  5M3F K;  4BBS K;  2O5J A;  1TWF A;  4P5B A;  4LK0 A;  2Y0S A;  2JA7 C;  3GTK K;  4C3J K;  2Y3P A;  2PMZ A;  1O24 A;  1IW7 A;  3GTK C;  4JK1 A;  2KWA A;  3CQZ K;  2WAQ L;  1EK8 A;  2B63 K;  4BY7 K;  2A69 D;  2VUM K;  4A3J C;  2JA8 K;  4KM8 A;  4KMH A;  3S0X A;  3GTM C;  5HL8 A;  3GSI A;  3G4A A;  2R92 C;  5JSN B;  1V5V A;  2P5M A;  4KN4 A;  2JA5 C;  3H0G A;  2V6S A;  1XXC A;  3GTL C;  4QJV B;  3FKI K;  2E2I K;  1RU0 A;  1O29 A;  2V6U A;  4OYD B;  1TWH C;  2B9S B;  2WB1 L;  4A3C C;  5C44 K;  3S15 C;  2A6H D;  1VGX A;  4P5A A;  4X6A K;  4G7H A;  3HOY K;  1MIU A;  1HQM A;  2A6H A;  5TMC A;  4YG2 A;  3GTJ C;  1DCP A;  3OPF A;  1O2A A;  1R49 A;  2V6T A;  4DDQ A;  1YNJ A;  3CQZ A;  4AYB L;  1O26 A;  2B63 A;  3K57 A;  2CW0 A;  4FM9 A;  2VUM A;  4LJZ A;  5JFE A;  1Y69 8;  2PHC B;  2GAH C;  4C3H K;  1PJ5 A;  4QIW A;  4A3M K;  4Y52 K;  1J6W A;  3I4N K;  5C4J K;  1WQF A;  4A3M C;  1Y1V C;  3H3V L;  1SC7 A;  4EJ3 A;  3T01 A;  1I3Q K;  1KQ4 A;  3HKZ D;  3FKI A;  2E2I A;  5C4J C;  5L46 A;  3LPX A;  4JLR C;  3WOD A;  3PO3 K;  2R93 C;  5MLC 9;  1WIH A;  2GSO A;  1BS2 A;  3N3Y A;  4GT9 A;  1J98 A;  4OIQ A;  1UV7 A;  1IL2 A;  2YU9 C;  3HOV K;  4GTC A;  5M5W K;  2NVQ C;  1WOS A;  4QCL A;  3S17 C;  1LPQ A;  3TFI A;  2O5I A;  1K83 A;  4A3L C;  3BUE A;  2WAQ A;  3P9A A;  5CHP A;  1Y1W K;  4FGU A;  3K5N A;  3K59 A;  3K7A K;  1YNN D;  1I6H K;  1DCH A;  3LAJ A;  5FLM C;  3ERE D;  3S16 C;  1O2F B;  1A31 A;  2PA8 L;  3V4G A;  2BE5 A;  1O28 A;  3EQL A;  1YNN A;  2JA6 K;  1I6H C;  1TGO A;  4G0V A;  5IP9 C;  3S1Q K;  2JA6 C;  1TWC C;  2NVT C;  1I3Q A;  4A3F K;  3S1Q C;  4A3E K;  3GTG C;  2NVX K;  1AB4 A;  4KMU A;  3S1M K;  1O27 A;  2WB1 A;  4A3F C;  3OEP A;  4A3E C;  4Y7N C;  5IYD C;  4KDD A;  1XXB A;  4G0W A;  2O5J D;  4IP8 A;  2JA7 K;  1O25 A;  2Y0S D;  1C0A A;  1V9M A;  1EQR A;  4BLA A;  2PMZ D;  1ISE A;  1DCO A;  5M5X K;  1IW7 D;  2D6F C;  2EBB A;  1B4A A;  3GTP C;  4C3I C;  1Y1W A;  1BGW A;  3WVO A;  4A3J K;  4KAW X;  4M1X A;  4FZB A;  2W7V A;  3GTM K;  3Q3Q A;  2R92 K;  2JA5 K;  4G0U A;  3LF9 A;  3VA7 A;  3IPJ A;  3GTL K;  3AQP A;  4F3E A;  4A3K C;  3GTO C;  1R9T A;  2NVX A;  1I6V A;  1ZXO A;  1TWH K;  1TWG A;  3HOU C;  4A3C K;  3ORE A;  1GE9 A;  4GTF A;  3S15 K;  2ZUE A;  2A68 A;  5JVO A;  4AHC A;  2NVY K;  5IYB K;  5JSB B;  3GEH A;  4Q5G A;  2JA7 A;  1HQM D;  3GTJ K;  3S14 C;  1PJ7 A;  1F7V A;  2NVY C;  4O2D A;  5IYB C;  1TL8 A;  4KM9 A;  1SFO C;  1J6X A;  3GTK A;  4WIL A;  4NOI A;  1YNJ D;  3T02 A;  4A3G K;  2CW0 D;  4H3T A;  4KB4 A;  3HOX K;  4YFN A;  4ILD A;  4A3G C;  1F7U A;  2CFA A;  3GTM A;  4QIW D;  1O2B A;  3HOX C;  2R92 A;  4YFX A;  4KC6 A;  1K4T A;  2JA5 A;  1HI9 A;  4L8I A;  1Y1V K;  3RZD K;  3GTL A;  1Q8I A;  3RZD C;  3M4A A;  4GTA A;  1TWH A;  2R93 K;  4NOL A;  3KYL A;  2YU9 K;  1IQ0 A;  2NVY A;  4C2M K;  3PO2 C;  3GTJ A;  2NVQ K;  4LMO A;  1USO A;  3I4M C;  1WSV A;  4C2M C;  1T8I A;  3S17 K;  4A3L K;  4BY1 C;  3G4C A;  4G7O A;  4GTB A;  2WAQ D;  2XCO A;  4Q5S A;  3S1N C;  2R7Z K;  5IP7 K;  2RGR A;  5FLM K;  2PPB A;  4LQY A;  3S16 K;  1BDF A;  2BE5 D;  2P8T A;  3TTG A;  5IP7 C;  2R7Z C;  1INN A;  4A3D C;  3HOZ C;  5IYC C;  3A8J A;  2E2H C;  5IP9 K;  1Y1V A;  1TWC K;  3AD9 C;  1K4S A;  2NVT K;  1WCM K;  4KMD A;  3DU6 A;  3GTG K;  5TMF A;  2A6E D;  5C4X C;  1XZQ A;  4XSX A;  2CFA B;  2R93 A;  1WCM C;  2A6E A;  1VH2 A;  1EJ9 A;  2WB1 D;  1TWF C;  4Y7N K;  5IYD K;  3BP3 A;  4NOM A;  2YU9 A;  4GTL A;  4C2M A;  3L4J A;  1RR8 C;  4PAB A;  4P9S A;  4WJ3 M;  3GTQ K;  3RZO C;  1SMY D;  1DD5 A;  2ZUF A;  4KAS A;  4KMA A;  1SMY A;  1I50 K;  3GTQ C;  1VLO A;  1PJ6 A;  4AYB D;  3GTP K;  1IE0 A;  4C3I K;  1YCL A;  4KAT A;  2FQT A;  1I50 C;  4AYB A;  1F93 A;  3HOW C;  1ZYR D;  1ZBS A;  4XCH A;  3S2H C;  3H0G C;  3LHP S;  3MAQ A;  1ZYR A;  4ZH4 A;  3HKZ L;  4XSZ A;  3S1R K;  3N0C A;  4A93 C;  3GDZ A;  2JA6 A;  1JOE A;  3S2D C;  1TWC A;  5CQG A;  4D3Y A;  4KB2 A;  3H3V D;  1J6V A;  4LOW A;  4A3K K;  3S1R C;  1WCM A;  3GTO K;  3GEI A;  3GTG A;  1NH3 A;  3AD7 C;  1WSR A;  4MEY A;  1I6V D;  3HOU K;  4AH6 A;  2RH6 A;  4LK1 A;  1XPP A;  3QX3 A;  4BBS C;  4GFQ A;  3AH5 A;  1A36 A;  2A68 D;  4C3J C;  3N0B A;  4A3I K;  3GIR A;  1XXA A;  3M4O K;  3S14 K;  1XZQ B;  3CQZ C;  3AQO A;  3GTQ A;  4A3I C;  1SFO K;  2B63 C;  4BY7 C;  1B4B A;  2A69 A;  3M4O C;  2VUM C;  2JA8 C;  1I50 A;  3K58 A;  3GTP A;  1TWA K;  1ZVU A;  1EI6 A;  3A8K A;  4FYD A;  1X31 C;  1TWA C;  5D4D A;  5E68 A;  2PA8 D; 
#chains in the Genus database with same CATH homology
 4LMO A;  5C9H A;  5EGH A;  4BLB A;  1O24 A;  4C2M C;  1T8I A;  1I3Q A;  2KWA A;  2F4Q A;  1EK8 A;  1AB4 A;  2A69 D;  3G4C A;  4GTB A;  1WQH A;  3GTO A;  4KM8 A;  2XCO A;  1O27 A;  2WB1 A;  3OEP A;  1RRJ A;  4D3Z A;  4KMH A;  2RGR A;  3S0X A;  4LQY A;  4KDD A;  3IAY A;  1XXB A;  4G0W A;  2O5J D;  3G4A A;  2BE5 D;  4IP8 A;  5JSN B;  3K5M A;  2P5M A;  1O25 A;  2GSU A;  3H0G A;  1F9N A;  1V9M A;  1XXC A;  4BLA A;  1ISE A;  1Y1V A;  4FXD A;  4IP9 A;  1K4S A;  1SFO A;  1IW7 D;  2XCR B;  4KMD A;  1O29 A;  3DU6 A;  4OYD B;  1B4A A;  2GSN A;  2XCQ A;  2ZFZ A;  2A6E D;  1WQG A;  4GTE A;  5TJ3 A;  1Y1W A;  2B9S B;  3WVO A;  1BGW A;  2CFA B;  4C3I C;  4C3H C;  1TWA A;  2R93 A;  3MML B;  4KAW X;  4M1X A;  1EJ9 A;  2A6H D;  4FZB A;  4P5A A;  4NOM A;  2YU9 A;  1BJT A;  3Q3Q A;  1MIU A;  4GTL A;  4C2M A;  3L4J A;  1RR8 C;  4G0U A;  3LF9 A;  3OPF A;  3VA7 A;  3HKZ A;  4BKW A;  3LAP A;  1O2A A;  1R49 A;  1SMY D;  2R4G A;  4DDQ A;  1DD5 A;  3AQP A;  3CQZ A;  4F3E A;  5CJ9 A;  1O26 A;  2B63 A;  4KAR A;  4KAS A;  4KMA A;  3K57 A;  4FM9 A;  1R9T A;  2NVX A;  3K5O A;  2VUM A;  5JFE A;  1ZXO A;  1TWG A;  1Y69 8;  2PHC B;  3ORE A;  4KAT A;  1SEU A;  1GE9 A;  4GTF A;  4Q5V A;  4AYB A;  3L4K A;  5EGE A;  3SJR A;  1A35 A;  1ZYR D;  4QIW A;  1ZBS A;  5IOT A;  4AHC A;  4NOK A;  5JVO A;  1R5Z A;  5JSB B;  3LHP S;  3MAQ A;  4Q5G A;  2JA7 A;  1HQM D;  1WQF A;  5IOR A;  4O26 A;  3N0C A;  1TL8 A;  1SC7 A;  4EJ3 A;  4KM9 A;  2JA6 A;  1KQ4 A;  1TWC A;  3FKI A;  5CQG A;  3GTK A;  2E2I A;  4D3Y A;  4KB2 A;  4GTD A;  1WCM A;  1YNJ D;  3LPX A;  3FHZ A;  4JLR C;  3GTG A;  1NH3 A;  1EH1 A;  2CW0 D;  4H3T A;  1I6V D;  4KB4 A;  1IS1 A;  5MLC 9;  1WIH A;  2GSO A;  2RH6 A;  3N3Y A;  4GT9 A;  3QX3 A;  4GFQ A;  5IOS A;  3AH5 A;  3NUH A;  4ILD A;  2CFA A;  4GTC A;  1A36 A;  2A68 D;  3GTM A;  1O2B A;  3N0B A;  4C3J C;  2R92 A;  2JH3 A;  2R7Z A;  4KC6 A;  1K4T A;  2JA5 A;  4QCL A;  1XXA A;  3CAG A;  4L8I A;  1LPQ A;  2E2H A;  3GTL A;  3GTQ A;  3AQO A;  1K83 A;  1B4B A;  3BUE A;  1Q8I A;  2WAQ A;  3P9A A;  5CHP A;  4J3N A;  4AN8 A;  1I50 A;  4FGU A;  3M4A A;  3K58 A;  3GTP A;  3K5N A;  3K59 A;  4GTA A;  1TWH A;  3K5L A;  5IOQ A;  1ZVU A;  1YNN D;  4NOL A;  4LR2 A;  3LAJ A;  3FOF A;  3ERE D;  3DU5 A;  3KYL A;  3FOE A;  1A31 A;  3V4G A;  1O28 A;  1TWF A;  4FYD A;  4P5B A;  2Y0S A;  2NVY A;  1TGO A;  2Y3P A;  2PMZ A;  4G0V A;  3GTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...