1ISEA

Crystal structure of a mutant of ribosome recycling factor from escherichia coli, arg132gly
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
ISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVGRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome Recycling Factor
publication title Crystal structure of a mutant of ribosome recycling factor from Escherichia coli, Arg132Gly
rcsb
source organism Escherichia coli
molecule tags Translation
total genus 65
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1iseA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1iseA02
3LF9A 5JSBB 1BJTA 3NUHA 4L8IA 1EH1A 5MLC9 4G0WA 3LHPS 4KAWX 3OPFA 3CAGA 3OREA 1WIHA 3FHZA 3L4KA 1Y698 2XCQA 3FOEA 4G0VA 4J3NA 1XXAA 3LAJA 5JVOA 5CJ9A 1B4AA 1F9NA 4DDQA 2ZFZA 4FM9A 1EK8A 1BGWA 1WQHA 1XXBA 2Y3PA 4KB2A 3FOFA 3OEPA 1WQGA 2XCOA 4KDDA 1GE9A 2XCRB 3ERED 3LPXA 4KB4A 1WQFA 4GFQA 1B4BA 4KC6A 1XXCA 3BUEA 1AB4A 3VA7A 4G0UA 3MMLB 1ISEA 2RGRA 4OYDB 2PHCB 3L4JA 5JSNB 1ZVUA 2P5MA 4JLRC 1IS1A 3LAPA 3V4GA 2KWAA 3QX3A 1DD5A
chains in the Genus database with same CATH superfamily
3LF9A 4WILA 3S1NC 4BY1C 3S1NK 1K83A 4BY1K 1Q8IA 4A3LC 4GTDA 3FOEA 1NH3A 1TWCC 5IYDK 1TWCK 5JVOA 4DDQA 4FYDA 1BGWA 4WJ4A 3HOXC 1VGXA 4KB2A 4IP8A 1J98A 3HOXK 2JA6C 2CFAB 2JA6K 2D6FC 3A8JA 1RRJA 4D3ZA 3DU6A 1WQFA 4BBSC 3T02A 4BBSK 1YNJD 1XXCA 4OIQA 4XSZA 1VRQC 2EBBA 2WB1D 1O25A 3HOWK 3HOWC 3GEIA 4A3CC 4A3CK 4GTFA 4A3KC 4A3KK 3H3VL 1EH1A 4O26A 1HQMA 4ILDA 4KM9A 2B63A 3PO2C 4BBRC 2XCQA 4PABA 4BBRK 3PO2K 4AYBL 1ZXOA 2ZFZA 4PAAA 2A6HD 1TWCA 1R9TC 2B9SB 1R9TK 1MIUA 1WQGA 3IPJA 4O2DA 3LPXA 4KMHA 1KQ4A 2JA6A 4GFQA 1B4BA 2A68D 1I3QC 1I3QK 4KM8A 5CHPA 4KMAA 1IE0A 1ZQ1C 5FLMC 3L4JA 5FLMK 1DCOA 3GTOC 1ZBSA 5IORA 3GTOK 3MAQA 2JH3A 2P5MA 1IW7D 3WODA 1TGOA 4G0WA 3AQPA 4LOWA 4A93C 4A93K 5M5YK 1Y698 3HOUC 3HOUK 3GTKC 2GSNA 3AD9C 1DCHA 3N0BA 1WQHA 1TWGC 2O5JA 3OEPA 4NOMA 1SFOC 1SFOK 1GE9A 4FXDA 1O27A 1R9TA 3A8IA 5TJ3A 3MMLB 4KN4A 1O26A 2FQTA 4ZH4A 5IP7C 4BKWA 5IP7K 4RMFA 3S0XA 1IS1A 1I3QA 2BE5A 2NVTC 3GTOA 1J6VA 2NVTK 5C4XC 3GTGC 3OPFA 5C4XK 3GTGK 3SZYA 5EGEA 2E2JC 4A3DC 2E2JK 3AD7C 1HQMD 1R49A 4P5AA 4NOLA 4Y52C 4BLBA 4Y52K 2R92C 2R92K 3GTKA 3TFIA 3SZZA 3GTLC 3GTLK 1TWGA 4YFXA 2NVYC 3FKIC 2NVYK 3FKIK 2JA7C 2JA7K 3GTQA 3BUEA 2NVXC 4XSXA 2NVXK 1SFOA 4P9SA 3N3YA 3TTGA 1A35A 2B63K 2JA8C 2JA8K 4AN8A 4KASA 4C3JC 4C3JK 2R7ZC 2R7ZK 1WIHA 5M5WK 2RH6A 2ZUFA 4AYBA 3GTGA 1TWAC 4MQ9A 1TWAK 4LK1A 5C4JC 5C4JK 1PJ5A 1F7UA 2V6TA 2XCOA 2R92A 2WAQL 2PA8D 3GTLA 2O5JD 3AQOA 1WCMA 1L0WA 3FKIA 1O2AA 2JA7A 4Q5SA 3HKZL 2NVXA 1O24A 4QJVB 4XLPA 1JQWA 5JSBB 2V6UA 3NUHA 1Y1VC 1Y1VK 3BP3A 1TWFA 2CW0A 3T01A 5M5XK 2BE5D 1IL2A 5IYDC 1XPPA 4AHCA 4QIWL 1EK8A 2R7ZA 2CFAA 4Q4ZA 2Y0SL 3GTMC 3GTMK 4GZYA 1TWAA 3K58A 3HOVC 1VJEA 3HOVK 4OYDB 1RR8C 4JLRC 5IP9C 5IP9K 2FQOA 4P5BA 4KAWX 3HOZC 3HOZK 5TMCA 1V5VA 3H3VD 4D3YA 1Y1VA 5M3FK 1WSRA 1IBAA 5IOQA 1SEUA 4IP9A 1WORA 4AYBD 3RZOC 3GTMA 3RZOK 1AB4A 1PJ7A 1J6WA 3RZDC 3RZDK 1XZPA 1EJ9A 1UV7A 4QCLA 2GSUA 1PJ6A 3G4AA 3Q3QA 3K5LA 2F4QA 2CW0D 3SJRA 1BS2A 3IAYA 1F7VA 2PMZL 3BP8C 2WAQA 5IYCC 5IYCK 5EGHA 1BDFA 5M3MK 2YU9C 3HKZA 4LMOA 2YU9K 1Y1WC 3CQZC 1Y1WK 3CQZK 4BY7K 3TFJA 5JFEA 4GTLA 3H0GK 4A3GK 1TL8A 5CJ9A 4FM9A 3K57A 4QIWA 1O29A 3GEEA 1SC7A 2Y0SA 3ERED 3M3YC 3M3YK 5L46A 4A3MC 4A3MK 4KN7A 3S2HC 3T00A 3S2HK 4NOKA 1VH2A 1O28A 4GT9A 1G51A 4EJ3A 3JSTA 1BJTA 5HL8A 4F3EA 4A3EC 2YU9A 4A3EK 4H3TA 1Y1WA 3K5MA 3CQZA 1A31A 3S1MC 3S1MK 3DU5A 1ZYRA 4GTEA 2Y3PA 2R4GA 3S2DC 4KDDA 3S2DK 4LR2A 5IOSA 4C3HC 4OIRA 4KC6A 4C3HK 2E2IC 1SMYA 2E2IK 2VUMC 2VUMK 1XZQA 2NVYA 3GEHA 2WAQD 2ZUEA 2A69A 1VLOA 3K5OA 4GTBA 3K5NA 4L8IA 3HKZD 1INNA 5CQGA 4YFKA 3WVOA 4JK1A 4LK0A 3S15C 3S15K 4A3BC 4A3BK 3K7AC 1F93A 3K7AK 1O2FB 1I6VA 2XCRB 1R5ZA 4QIWD 1WOSA 4KB4A 1I6HC 1I6HK 2A6EA 3ADAC 3HOYC 1A36A 2PMZA 2GSOA 4G0UA 1O2BA 3HOYK 3S14K 3S14C 2Y0SD 1C0AA 2PHCB 4XCHA 4G7HA 1K4TA 2NVQC 4OINA 2NVQK 4YFNA 2E2IA 2VUMA 4OIPA 3QX3A 5FJ8K 2O5IA 4A3LK 4MEXA 5D4DA 4FGUA 3N0CA 1WOOA 1USOA 3GTPC 3GTPK 3M4OC 3M4OK 3AD8C 1TWHC 5TMFA 3FOFA 1TWHK 4A3JK 4A3JC 3K59A 3S16K 3S16C 2WB1L 1ZYRD 5C44C 4X6AC 5C44K 4X6AK 1ISEA 3HXAA 4KMDA 3LAPA 2R93C 1I50C 3V4GA 2R93K 1I50K 2KWAA 1SMYD 4C2MK 4C2MC 4MEYA 1EQRA 1EFWA 2A69D 3LHPS 1YNNA 2E2HC 2E2HK 3L4KA 1YX2A 4LQYA 3AH5A 1B4AA 3GSIA 5IYBK 5IYBC 3GIRA 1XXBA 1T8IA 3GTPA 1TWHA 3VA7A 4Q5GA 1I6VD 4GTCA 1ZVUA 2A6ED 2PMZD 1XZPB 3GTJC 3GTJK 4BY7C 4KARA 2R93A 1I50A 2PPBA 3CAGA 4C2MA 3OREA 3FHZA 3GTKK 3H0GC 5C3EC 1XXAA 3LAJA 5C3EK 4A3GC 2E2HA 1TWGK 3GTQC 3GTQK 3PO3C 3PO3K 4G7ZA 3A8KA 2JA5C 1USMA 3GTJA 1WOPA 2JA5K 4KATA 3S1QC 1LPQA 2GAGC 1WSVA 4G0VA 3S1QK 4LLGA 4J3NA 4A3DK 4BLAA 4C45A 1YNND 1HI9A 3H0GA 3GDZA 3KYLA 1WCMC 1WCMK 1YNJA 4GTAA 3M4AA 4A3FK 4A3FC 2W7VA 1X31C 1JVIA 4LJZA 2WB1A 1JOEA 3TFHA 3P9AA 2P8TA 4OIOA 2V6SA 4NOIA 4C3IC 2RGRA 4C3IK 4WJ3M 5JSNB 4AH6A 1TWFC 1YCLA 1TWFK 4QJVA 5IOTA 1K83C 1K83K 4Y7NC 4Y7NK 3S17C 3S17K 1DCPA 3G4CA 5MLC9 4G7OA 3S1RC 2A6HA 3S1RK 4FZBA 4YG2A 1J6XA 1F9NA 2JA5A 5C9HA 3I4NC 2PA8L 1K4SA 3I4NK 1EI6A 2A68A 2GAHC 3I4MC 4Q5VA 3I4MK 4BXXC 4M1XA 4BXXK 3DXJA 1V9MA 4A3IC 4A3IK 1IQ0A 1IW7A 3EQLA 4XLNA 1RU0A 1XZQB 5E68A 4KMUA 2B63C 1DD5A
chains in the Genus database with same CATH topology
3LF9A 4AN8A 4KASA 4C3JC 2A69D 3LHPS 1Q8IA 1K83A 4GTDA 1WIHA 4GTLA 5JFEA 3FOEA 4KM9A 4LQYA 1NH3A 3L4KA 1TL8A 2RH6A 3AH5A 1B4AA 5CJ9A 4DDQA 5JVOA 4AYBA 4FYDA 3K57A 4QIWA 3GTGA 1BGWA 4FM9A 1O29A 1XXBA 1T8IA 4KB2A 4IP8A 2CFAB 2XCOA 1SC7A 2Y0SA 4D3ZA 1RRJA 3GTPA 3ERED 3DU6A 2R92A 1WQFA 1TWHA 1YNJD 3GTLA 2O5JD 1XXCA 1WCMA 4Q5GA 3AQOA 3VA7A 1I6VD 4GTCA 3FKIA 1O2AA 2JA7A 1O25A 1ZVUA 4NOKA 2A6ED 2NVXA 1O24A 4GTFA 1O28A 4GT9A 4EJ3A 5JSBB 1BJTA 3NUHA 1EH1A 4F3EA 1TWFA 2YU9A 4H3TA 4O26A 2R93A 4ILDA 1I50A 4KARA 3CAGA 4C2MA 3K5MA 1Y1WA 3CQZA 2BE5D 1A31A 2B63A 2XCQA 3OREA 3FHZA 1XXAA 3LAJA 4AHCA 3DU5A 1ZXOA 2ZFZA 1EK8A 2R7ZA 2E2HA 2CFAA 4GTEA 2A6HD 2Y3PA 1TWCA 2R4GA 2B9SB 1MIUA 1WQGA 4KDDA 1TWAA 3K58A 4LR2A 3LPXA 4KMHA 1KQ4A 5IOSA 2JA6A 4GFQA 1B4BA 4KC6A 4C3HC 2A68D 4KM8A 5CHPA 4KMAA 4OYDB 3L4JA 1ZBSA 5IORA 2NVYA 3MAQA 1RR8C 2JH3A 4JLRC 2P5MA 1IW7D 3K5OA 4GTBA 1TGOA 3K5NA 4L8IA 3V4GA 4P5BA 4G0WA 3AQPA 4KAWX 3GTJA 4KATA 1Y698 1LPQA 4G0VA 4J3NA 5CQGA 1Y1VA 4D3YA 2GSNA 4BLAA 3N0BA 1WQHA 1YNND 3WVOA 5IOQA 3H0GA 3KYLA 3OEPA 4NOMA 3M4AA 1SEUA 4IP9A 4GTAA 2XCRB 1GE9A 1R5ZA 2WB1A 4FXDA 4KB4A 1O27A 3P9AA 1R9TA 5TJ3A 1A36A 2PMZA 3GTMA 1AB4A 1O2BA 2GSOA 2KWAA 3MMLB 4G0UA 4C3IC 1O26A 2RGRA 2PHCB 5JSNB 4BKWA 1K4TA 3S0XA 1IS1A 1I3QA 1EJ9A 2E2IA 5IOTA 2VUMA 3QX3A 3GTOA 4QCLA 2GSUA 5MLC9 3G4CA 3OPFA 4FZBA 5EGEA 3G4AA 4C2MC 3Q3QA 3K5LA 2F4QA 4FGUA 3N0CA 1F9NA 1HQMD 1R49A 4P5AA 2CW0D 2JA5A 3SJRA 5C9HA 4NOLA 4BLBA 1K4SA 3IAYA 3GTKA 3FOFA 3K59A 4Q5VA 4M1XA 1ZYRD 1TWGA 1V9MA 2WAQA 3GTQA 3BUEA 1SFOA 1ISEA 5EGHA 3N3YA 3HKZA 4KMDA 4LMOA 3LAPA 1A35A 1SMYD 1DD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LF9 A;  5JSB B;  1BJT A;  3NUH A;  4L8I A;  1EH1 A;  5MLC 9;  4G0W A;  3LHP S;  4KAW X;  3OPF A;  3CAG A;  3ORE A;  1WIH A;  3FHZ A;  3L4K A;  1Y69 8;  2XCQ A;  3FOE A;  4G0V A;  4J3N A;  1XXA A;  3LAJ A;  5JVO A;  5CJ9 A;  1B4A A;  1F9N A;  4DDQ A;  2ZFZ A;  4FM9 A;  1EK8 A;  1BGW A;  1WQH A;  1XXB A;  2Y3P A;  4KB2 A;  3FOF A;  3OEP A;  1WQG A;  2XCO A;  4KDD A;  1GE9 A;  2XCR B;  3ERE D;  3LPX A;  4KB4 A;  1WQF A;  4GFQ A;  1B4B A;  4KC6 A;  1XXC A;  3BUE A;  1AB4 A;  3VA7 A;  4G0U A;  3MML B;  1ISE A;  2RGR A;  4OYD B;  2PHC B;  3L4J A;  5JSN B;  1ZVU A;  2P5M A;  4JLR C;  1IS1 A;  3LAP A;  3V4G A;  2KWA A;  3QX3 A;  1DD5 A; 
#chains in the Genus database with same CATH topology
 3LF9 A;  4WIL A;  3S1N C;  4BY1 C;  3S1N K;  1K83 A;  4BY1 K;  1Q8I A;  4A3L C;  4GTD A;  3FOE A;  1NH3 A;  1TWC C;  5IYD K;  1TWC K;  5JVO A;  4DDQ A;  4FYD A;  1BGW A;  4WJ4 A;  3HOX C;  1VGX A;  4KB2 A;  4IP8 A;  1J98 A;  3HOX K;  2JA6 C;  2CFA B;  2JA6 K;  2D6F C;  3A8J A;  1RRJ A;  4D3Z A;  3DU6 A;  1WQF A;  4BBS C;  3T02 A;  4BBS K;  1YNJ D;  1XXC A;  4OIQ A;  4XSZ A;  1VRQ C;  2EBB A;  2WB1 D;  1O25 A;  3HOW K;  3HOW C;  3GEI A;  4A3C C;  4A3C K;  4GTF A;  4A3K C;  4A3K K;  3H3V L;  1EH1 A;  4O26 A;  1HQM A;  4ILD A;  4KM9 A;  2B63 A;  3PO2 C;  4BBR C;  2XCQ A;  4PAB A;  4BBR K;  3PO2 K;  4AYB L;  1ZXO A;  2ZFZ A;  4PAA A;  2A6H D;  1TWC A;  1R9T C;  2B9S B;  1R9T K;  1MIU A;  1WQG A;  3IPJ A;  4O2D A;  3LPX A;  4KMH A;  1KQ4 A;  2JA6 A;  4GFQ A;  1B4B A;  2A68 D;  1I3Q C;  1I3Q K;  4KM8 A;  5CHP A;  4KMA A;  1IE0 A;  1ZQ1 C;  5FLM C;  3L4J A;  5FLM K;  1DCO A;  3GTO C;  1ZBS A;  5IOR A;  3GTO K;  3MAQ A;  2JH3 A;  2P5M A;  1IW7 D;  3WOD A;  1TGO A;  4G0W A;  3AQP A;  4LOW A;  4A93 C;  4A93 K;  5M5Y K;  1Y69 8;  3HOU C;  3HOU K;  3GTK C;  2GSN A;  3AD9 C;  1DCH A;  3N0B A;  1WQH A;  1TWG C;  2O5J A;  3OEP A;  4NOM A;  1SFO C;  1SFO K;  1GE9 A;  4FXD A;  1O27 A;  1R9T A;  3A8I A;  5TJ3 A;  3MML B;  4KN4 A;  1O26 A;  2FQT A;  4ZH4 A;  5IP7 C;  4BKW A;  5IP7 K;  4RMF A;  3S0X A;  1IS1 A;  1I3Q A;  2BE5 A;  2NVT C;  3GTO A;  1J6V A;  2NVT K;  5C4X C;  3GTG C;  3OPF A;  5C4X K;  3GTG K;  3SZY A;  5EGE A;  2E2J C;  4A3D C;  2E2J K;  3AD7 C;  1HQM D;  1R49 A;  4P5A A;  4NOL A;  4Y52 C;  4BLB A;  4Y52 K;  2R92 C;  2R92 K;  3GTK A;  3TFI A;  3SZZ A;  3GTL C;  3GTL K;  1TWG A;  4YFX A;  2NVY C;  3FKI C;  2NVY K;  3FKI K;  2JA7 C;  2JA7 K;  3GTQ A;  3BUE A;  2NVX C;  4XSX A;  2NVX K;  1SFO A;  4P9S A;  3N3Y A;  3TTG A;  1A35 A;  2B63 K;  2JA8 C;  2JA8 K;  4AN8 A;  4KAS A;  4C3J C;  4C3J K;  2R7Z C;  2R7Z K;  1WIH A;  5M5W K;  2RH6 A;  2ZUF A;  4AYB A;  3GTG A;  1TWA C;  4MQ9 A;  1TWA K;  4LK1 A;  5C4J C;  5C4J K;  1PJ5 A;  1F7U A;  2V6T A;  2XCO A;  2R92 A;  2WAQ L;  2PA8 D;  3GTL A;  2O5J D;  3AQO A;  1WCM A;  1L0W A;  3FKI A;  1O2A A;  2JA7 A;  4Q5S A;  3HKZ L;  2NVX A;  1O24 A;  4QJV B;  4XLP A;  1JQW A;  5JSB B;  2V6U A;  3NUH A;  1Y1V C;  1Y1V K;  3BP3 A;  1TWF A;  2CW0 A;  3T01 A;  5M5X K;  2BE5 D;  1IL2 A;  5IYD C;  1XPP A;  4AHC A;  4QIW L;  1EK8 A;  2R7Z A;  2CFA A;  4Q4Z A;  2Y0S L;  3GTM C;  3GTM K;  4GZY A;  1TWA A;  3K58 A;  3HOV C;  1VJE A;  3HOV K;  4OYD B;  1RR8 C;  4JLR C;  5IP9 C;  5IP9 K;  2FQO A;  4P5B A;  4KAW X;  3HOZ C;  3HOZ K;  5TMC A;  1V5V A;  3H3V D;  4D3Y A;  1Y1V A;  5M3F K;  1WSR A;  1IBA A;  5IOQ A;  1SEU A;  4IP9 A;  1WOR A;  4AYB D;  3RZO C;  3GTM A;  3RZO K;  1AB4 A;  1PJ7 A;  1J6W A;  3RZD C;  3RZD K;  1XZP A;  1EJ9 A;  1UV7 A;  4QCL A;  2GSU A;  1PJ6 A;  3G4A A;  3Q3Q A;  3K5L A;  2F4Q A;  2CW0 D;  3SJR A;  1BS2 A;  3IAY A;  1F7V A;  2PMZ L;  3BP8 C;  2WAQ A;  5IYC C;  5IYC K;  5EGH A;  1BDF A;  5M3M K;  2YU9 C;  3HKZ A;  4LMO A;  2YU9 K;  1Y1W C;  3CQZ C;  1Y1W K;  3CQZ K;  4BY7 K;  3TFJ A;  5JFE A;  4GTL A;  3H0G K;  4A3G K;  1TL8 A;  5CJ9 A;  4FM9 A;  3K57 A;  4QIW A;  1O29 A;  3GEE A;  1SC7 A;  2Y0S A;  3ERE D;  3M3Y C;  3M3Y K;  5L46 A;  4A3M C;  4A3M K;  4KN7 A;  3S2H C;  3T00 A;  3S2H K;  4NOK A;  1VH2 A;  1O28 A;  4GT9 A;  1G51 A;  4EJ3 A;  3JST A;  1BJT A;  5HL8 A;  4F3E A;  4A3E C;  2YU9 A;  4A3E K;  4H3T A;  1Y1W A;  3K5M A;  3CQZ A;  1A31 A;  3S1M C;  3S1M K;  3DU5 A;  1ZYR A;  4GTE A;  2Y3P A;  2R4G A;  3S2D C;  4KDD A;  3S2D K;  4LR2 A;  5IOS A;  4C3H C;  4OIR A;  4KC6 A;  4C3H K;  2E2I C;  1SMY A;  2E2I K;  2VUM C;  2VUM K;  1XZQ A;  2NVY A;  3GEH A;  2WAQ D;  2ZUE A;  2A69 A;  1VLO A;  3K5O A;  4GTB A;  3K5N A;  4L8I A;  3HKZ D;  1INN A;  5CQG A;  4YFK A;  3WVO A;  4JK1 A;  4LK0 A;  3S15 C;  3S15 K;  4A3B C;  4A3B K;  3K7A C;  1F93 A;  3K7A K;  1O2F B;  1I6V A;  2XCR B;  1R5Z A;  4QIW D;  1WOS A;  4KB4 A;  1I6H C;  1I6H K;  2A6E A;  3ADA C;  3HOY C;  1A36 A;  2PMZ A;  2GSO A;  4G0U A;  1O2B A;  3HOY K;  3S14 K;  3S14 C;  2Y0S D;  1C0A A;  2PHC B;  4XCH A;  4G7H A;  1K4T A;  2NVQ C;  4OIN A;  2NVQ K;  4YFN A;  2E2I A;  2VUM A;  4OIP A;  3QX3 A;  5FJ8 K;  2O5I A;  4A3L K;  4MEX A;  5D4D A;  4FGU A;  3N0C A;  1WOO A;  1USO A;  3GTP C;  3GTP K;  3M4O C;  3M4O K;  3AD8 C;  1TWH C;  5TMF A;  3FOF A;  1TWH K;  4A3J K;  4A3J C;  3K59 A;  3S16 K;  3S16 C;  2WB1 L;  1ZYR D;  5C44 C;  4X6A C;  5C44 K;  4X6A K;  1ISE A;  3HXA A;  4KMD A;  3LAP A;  2R93 C;  1I50 C;  3V4G A;  2R93 K;  1I50 K;  2KWA A;  1SMY D;  4C2M K;  4C2M C;  4MEY A;  1EQR A;  1EFW A;  2A69 D;  3LHP S;  1YNN A;  2E2H C;  2E2H K;  3L4K A;  1YX2 A;  4LQY A;  3AH5 A;  1B4A A;  3GSI A;  5IYB K;  5IYB C;  3GIR A;  1XXB A;  1T8I A;  3GTP A;  1TWH A;  3VA7 A;  4Q5G A;  1I6V D;  4GTC A;  1ZVU A;  2A6E D;  2PMZ D;  1XZP B;  3GTJ C;  3GTJ K;  4BY7 C;  4KAR A;  2R93 A;  1I50 A;  2PPB A;  3CAG A;  4C2M A;  3ORE A;  3FHZ A;  3GTK K;  3H0G C;  5C3E C;  1XXA A;  3LAJ A;  5C3E K;  4A3G C;  2E2H A;  1TWG K;  3GTQ C;  3GTQ K;  3PO3 C;  3PO3 K;  4G7Z A;  3A8K A;  2JA5 C;  1USM A;  3GTJ A;  1WOP A;  2JA5 K;  4KAT A;  3S1Q C;  1LPQ A;  2GAG C;  1WSV A;  4G0V A;  3S1Q K;  4LLG A;  4J3N A;  4A3D K;  4BLA A;  4C45 A;  1YNN D;  1HI9 A;  3H0G A;  3GDZ A;  3KYL A;  1WCM C;  1WCM K;  1YNJ A;  4GTA A;  3M4A A;  4A3F K;  4A3F C;  2W7V A;  1X31 C;  1JVI A;  4LJZ A;  2WB1 A;  1JOE A;  3TFH A;  3P9A A;  2P8T A;  4OIO A;  2V6S A;  4NOI A;  4C3I C;  2RGR A;  4C3I K;  4WJ3 M;  5JSN B;  4AH6 A;  1TWF C;  1YCL A;  1TWF K;  4QJV A;  5IOT A;  1K83 C;  1K83 K;  4Y7N C;  4Y7N K;  3S17 C;  3S17 K;  1DCP A;  3G4C A;  5MLC 9;  4G7O A;  3S1R C;  2A6H A;  3S1R K;  4FZB A;  4YG2 A;  1J6X A;  1F9N A;  2JA5 A;  5C9H A;  3I4N C;  2PA8 L;  1K4S A;  3I4N K;  1EI6 A;  2A68 A;  2GAH C;  3I4M C;  4Q5V A;  3I4M K;  4BXX C;  4M1X A;  4BXX K;  3DXJ A;  1V9M A;  4A3I C;  4A3I K;  1IQ0 A;  1IW7 A;  3EQL A;  4XLN A;  1RU0 A;  1XZQ B;  5E68 A;  4KMU A;  2B63 C;  1DD5 A; 
#chains in the Genus database with same CATH homology
 3LF9 A;  4AN8 A;  4KAS A;  4C3J C;  2A69 D;  3LHP S;  1Q8I A;  1K83 A;  4GTD A;  1WIH A;  4GTL A;  5JFE A;  3FOE A;  4KM9 A;  4LQY A;  1NH3 A;  3L4K A;  1TL8 A;  2RH6 A;  3AH5 A;  1B4A A;  5CJ9 A;  4DDQ A;  5JVO A;  4AYB A;  4FYD A;  3K57 A;  4QIW A;  3GTG A;  1BGW A;  4FM9 A;  1O29 A;  1XXB A;  1T8I A;  4KB2 A;  4IP8 A;  2CFA B;  2XCO A;  1SC7 A;  2Y0S A;  4D3Z A;  1RRJ A;  3GTP A;  3ERE D;  3DU6 A;  2R92 A;  1WQF A;  1TWH A;  1YNJ D;  3GTL A;  2O5J D;  1XXC A;  1WCM A;  4Q5G A;  3AQO A;  3VA7 A;  1I6V D;  4GTC A;  3FKI A;  1O2A A;  2JA7 A;  1O25 A;  1ZVU A;  4NOK A;  2A6E D;  2NVX A;  1O24 A;  4GTF A;  1O28 A;  4GT9 A;  4EJ3 A;  5JSB B;  1BJT A;  3NUH A;  1EH1 A;  4F3E A;  1TWF A;  2YU9 A;  4H3T A;  4O26 A;  2R93 A;  4ILD A;  1I50 A;  4KAR A;  3CAG A;  4C2M A;  3K5M A;  1Y1W A;  3CQZ A;  2BE5 D;  1A31 A;  2B63 A;  2XCQ A;  3ORE A;  3FHZ A;  1XXA A;  3LAJ A;  4AHC A;  3DU5 A;  1ZXO A;  2ZFZ A;  1EK8 A;  2R7Z A;  2E2H A;  2CFA A;  4GTE A;  2A6H D;  2Y3P A;  1TWC A;  2R4G A;  2B9S B;  1MIU A;  1WQG A;  4KDD A;  1TWA A;  3K58 A;  4LR2 A;  3LPX A;  4KMH A;  1KQ4 A;  5IOS A;  2JA6 A;  4GFQ A;  1B4B A;  4KC6 A;  4C3H C;  2A68 D;  4KM8 A;  5CHP A;  4KMA A;  4OYD B;  3L4J A;  1ZBS A;  5IOR A;  2NVY A;  3MAQ A;  1RR8 C;  2JH3 A;  4JLR C;  2P5M A;  1IW7 D;  3K5O A;  4GTB A;  1TGO A;  3K5N A;  4L8I A;  3V4G A;  4P5B A;  4G0W A;  3AQP A;  4KAW X;  3GTJ A;  4KAT A;  1Y69 8;  1LPQ A;  4G0V A;  4J3N A;  5CQG A;  1Y1V A;  4D3Y A;  2GSN A;  4BLA A;  3N0B A;  1WQH A;  1YNN D;  3WVO A;  5IOQ A;  3H0G A;  3KYL A;  3OEP A;  4NOM A;  3M4A A;  1SEU A;  4IP9 A;  4GTA A;  2XCR B;  1GE9 A;  1R5Z A;  2WB1 A;  4FXD A;  4KB4 A;  1O27 A;  3P9A A;  1R9T A;  5TJ3 A;  1A36 A;  2PMZ A;  3GTM A;  1AB4 A;  1O2B A;  2GSO A;  2KWA A;  3MML B;  4G0U A;  4C3I C;  1O26 A;  2RGR A;  2PHC B;  5JSN B;  4BKW A;  1K4T A;  3S0X A;  1IS1 A;  1I3Q A;  1EJ9 A;  2E2I A;  5IOT A;  2VUM A;  3QX3 A;  3GTO A;  4QCL A;  2GSU A;  5MLC 9;  3G4C A;  3OPF A;  4FZB A;  5EGE A;  3G4A A;  4C2M C;  3Q3Q A;  3K5L A;  2F4Q A;  4FGU A;  3N0C A;  1F9N A;  1HQM D;  1R49 A;  4P5A A;  2CW0 D;  2JA5 A;  3SJR A;  5C9H A;  4NOL A;  4BLB A;  1K4S A;  3IAY A;  3GTK A;  3FOF A;  3K59 A;  4Q5V A;  4M1X A;  1ZYR D;  1TWG A;  1V9M A;  2WAQ A;  3GTQ A;  3BUE A;  1SFO A;  1ISE A;  5EGH A;  3N3Y A;  3HKZ A;  4KMD A;  4LMO A;  3LAP A;  1A35 A;  1SMY D;  1DD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...