1WQFA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structural studies of Mycobacterium tuberculosis RRF and a comparative study of RRFs of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome recycling factor
total genus 62
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqfA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqfA02
4OYDB 3V4GA 1WQFA 4KC6A 4G0VA 1BGWA 1WQGA 1B4BA 4J3NA 5JSNB 3CAGA 1F9NA 4KB2A 1ISEA 1DD5A 2KWAA 1IS1A 1WIHA 3OEPA 1WQHA 3L4KA 4JLRC 2XCQA 2ZFZA 4G0UA 4KDDA 3L4JA 3LPXA 1EK8A 1XXAA 3FOFA 4GFQA 1ZVUA 1EH1A 1XXCA 1AB4A 5CJ9A 3FOEA 3BUEA 3LAPA 4G0WA 3LF9A 2Y3PA 3MMLB 4DDQA 4FM9A 5JSBB 2XCRB 4L8IA 2PHCB 1BJTA 1GE9A 3QX3A 5MLC9 1B4AA 4KAWX 5JVOA 4KB4A 3FHZA 3OREA 3VA7A 3NUHA 3ERED 3OPFA 2P5MA 2XCOA 1XXBA 3LAJA 3LHPS 1Y698 2RGRA
chains in the Genus database with same CATH superfamily
2WB1L 4LR2A 2R92A 4A3BC 1Y1VK 3FKIK 5IOQA 1MIUA 4D3YA 1YNJA 3T00A 4C3HC 5L46A 4XLNA 2EBBA 4GTAA 1O2AA 3L4JA 3HOUC 1L0WA 2CW0A 1R9TC 3EQLA 4AYBL 2A69D 5CJ9A 5M3FK 1USOA 2JA7K 4G0WA 3I4MC 5M3MK 1Y1WA 1GE9A 3N0CA 4QJVA 4KAWX 4C3JC 1TWHA 3RZOK 1YNJD 4NOKA 5IP9C 4A3MC 4F3EA 3K58A 1Y698 1F7VA 1JVIA 3PO3K 2NVTK 5C3EK 4G0VA 4C2MC 3CAGA 4A3LK 4A93C 3I4MK 3S15K 4G0UA 1XXAA 2JH3A 4O2DA 4KMDA 3FKIC 1O26A 3GEEA 4H3TA 4BKWA 2VUMA 4Y52C 4GT9A 3GTMK 1TWCK 3S1RK 3M4AA 4XSZA 3HOVK 2R7ZA 5C4JC 3GTMC 3S1QK 4KASA 4EJ3A 4OIOA 2Y0SA 3DU6A 2VUMC 1I6VA 3TFHA 5EGEA 2KWAA 3OEPA 1WIHA 3S1NK 2A69A 1VJEA 1YX2A 4A3EK 4BY7K 3WVOA 3S15C 3S1NC 1TWCA 3GTMA 1XPPA 4A93K 5IOSA 4A3LC 2WAQD 1HI9A 4L8IA 2NVTC 2NVQK 3PO3C 3HKZA 1PJ7A 2YU9K 3S1QC 3FHZA 1RR8C 1K4SA 3HOYC 1SFOK 3IPJA 3S1RC 2RGRA 3SJRA 1WOOA 2FQTA 1J98A 4GTFA 2NVXK 4M1XA 1I3QC 3HOWC 2JA7C 4OIPA 1VLOA 4JLRC 3HKZD 1V9MA 2A68A 1DCOA 4XSXA 4NOIA 4A3JC 3JSTA 4C3HK 4LK1A 1Y1VC 4Q5VA 5TMFA 1WCMK 2GAGC 3MMLB 4C2MK 1I50A 3GTQK 2GSOA 2JA7A 5CQGA 3GTGK 4BLAA 3CQZK 1A36A 1YNND 3SZYA 1R9TA 4P9SA 1Y1VA 2WAQL 3N3YA 1LPQA 5FJ8K 1Y1WC 1DCHA 1BS2A 3HOZC 3HXAA 3GTJC 1IL2A 5M5WK 1F7UA 1TWHC 2NVXA 4LK0A 3M4OC 3S2DK 1ZVUA 2R4GA 2PA8D 1R5ZA 2PA8L 3BUEA 1V5VA 2JA5C 3GTLK 2GSNA 3H3VL 4G7OA 3S2HC 1BJTA 4FGUA 3S0XA 2PMZD 5JFEA 5TMCA 1KQ4A 4MEYA 3AD8C 4Y7NC 4A3CK 3VA7A 2XCOA 1TWGA 4Q4ZA 4KARA 3FKIA 1O28A 4RMFA 2V6TA 2WAQA 4J3NA 3WODA 4WILA 3GTOA 2E2JC 4AN8A 2D6FC 2JA6A 1K83K 1VRQC 4AH6A 5IORA 3K5MA 1TWGC 2R7ZC 1ZYRA 4QIWA 4GTDA 1I6HK 3FOEA 5C44K 3AD9C 3GTPA 2F4QA 4A3EC 1IBAA 2PMZL 4KMAA 1TWFK 3OREA 2CW0D 2A6HD 2PPBA 2JA6C 4LQYA 1PJ6A 2P8TA 2A6HA 5C4XK 3GTPC 1UV7A 4FZBA 1TL8A 1IS1A 4IP8A 5TJ3A 3GTQA 1VGXA 4IP9A 3GDZA 1I50K 1WCMA 1AB4A 3LAPA 3LF9A 4BXXK 1TWHK 2PHCB 4BLBA 1XZQB 3K7AC 2O5IA 3H0GA 3GTQC 5C3EC 4KN7A 2P5MA 1SMYA 1ZXOA 4A3GC 3LHPS 1C0AA 1NH3A 4A3JK 3CQZC 1I50C 4C3JK 1WSVA 4MQ9A 1ISEA 4P5AA 3H0GC 1YNNA 5IP7K 2NVYK 1IW7A 2O5JD 1J6WA 3GIRA 1RU0A 1TGOA 3K5NA 4LOWA 4A3DK 3N0BA 3TTGA 4AHCA 1G51A 3S14K 2Y3PA 3G4CA 3CQZA 5M5YK 2E2IK 4BBSC 3KYLA 4BBRK 3GTJA 4KB4A 4A3IK 4NOMA 3OPFA 2NVXC 5D4DA 1XZQA 4A3KC 4KM9A 3LAJA 2JA5A 4MEXA 1F93A 3V4GA 2GAHC 2R7ZK 3HOYK 4X6AC 3A8IA 2NVQC 2ZFZA 5M5XK 4LJZA 1USMA 2V6UA 2V6SA 3PO2K 4ILDA 2E2IA 4X6AK 4DDQA 1INNA 4WJ4A 5EGHA 4KM8A 3GTOC 3AQOA 4LLGA 4A3KK 2JA8C 4OIQA 4KN4A 5FLMC 2B63K 2ZUFA 3S2HK 3M3YK 1XXBA 4BBRC 5JSBB 5HL8A 4PABA 3GTKC 3M4OK 3S14C 2WB1A 1TWAK 1WQHA 1JOEA 4Y52K 2XCQA 1Q8IA 4AYBA 1PJ5A 1Y1WK 1K4TA 3HKZL 4Q5SA 5IP9K 1O29A 4D3ZA 4QCLA 3GEHA 3K5LA 2E2HC 3K59A 3NUHA 3ERED 4OIRA 4OINA 3DXJA 1WCMC 2NVYA 1I6VD 4BBSK 1A35A 4QJVB 1R9TK 3RZOC 3AH5A 1BGWA 1WQGA 1B4BA 4YFXA 2R93K 3L4KA 2Y0SD 1X31C 1JQWA 4GTBA 1EFWA 4A3BK 4KDDA 1I3QK 3HOWK 1EK8A 5IOTA 3FOFA 4GFQA 3TFJA 2A6ED 2NVYC 5IP7C 1TWAC 3H0GK 3HOXK 1YCLA 1ZQ1C 3QX3A 4YG2A 4ZH4A 5IYCC 4GTLA 1SC7A 4C45A 3DU5A 3GTOK 1ZBSA 1TWAA 4A3FK 4XCHA 3K57A 5IYDK 1DCPA 3ADAC 3TFIA 1O27A 3PO2C 1ZYRD 1TWGK 2Y0SL 2R92K 3GEIA 1TWFA 2BE5A 2W7VA 1O2BA 3HOVC 1BDFA 3AQPA 3GTPK 3MAQA 1O2FB 5IYBC 4A3CC 1K83A 2JA6K 2JA8K 1T8IA 2E2IC 3T01A 4BY1C 3K5OA 1F9NA 4KB2A 4YFKA 4A3DC 3S2DC 1I6HC 1RRJA 4C3IC 3GSIA 3S16K 1R49A 1IE0A 5E68A 3GTGA 1XZPB 4FM9A 2PMZA 3GTKA 2XCRB 4A3MK 4FYDA 1B4AA 3GTLA 5JVOA 2O5JA 2CFAB 4G7HA 1J6XA 4NOLA 3S1MC 4A3FC 3GTGC 2ZUEA 1WOSA 4JK1A 3K7AK 4A3IC 4GTEA 4KC6A 2A6EA 3RZDK 5IYCK 3HOUK 1EQRA 5JSNB 1SFOA 2JA5K 3GTLC 1HQMA 2R93A 4GTCA 2E2HA 3HOXC 3A8KA 3RZDC 3H3VD 4XLPA 2BE5D 3GTJK 1A31A 3S1MK 3I4NC 1SEUA 3SZZA 5C4XC 4C2MA 5MLC9 4KMHA 1SFOC 2R93C 4A3GK 2FQOA 3T02A 3BP3A 1WQFA 4YFNA 1WORA 1XZPA 1WSRA 1O24A 2E2HK 4GZYA 4G7ZA 4C3IK 2GSUA 4BXXC 1EI6A 3G4AA 1EJ9A 4QIWL 4BY7C 1WOPA 4O26A 3LPXA 3BP8C 4BY1K 4KMUA 3IAYA 1XXCA 2E2JK 4Q5GA 2RH6A 2YU9A 2VUMK 3Q3QA 2WB1D 2B63A 5IYBK 3S16C 5C9HA 3S17K 5C4JK 4KATA 3S17C 3AD7C 3GTKK 1VH2A 1TWFC 1TWCC 2YU9C 4OYDB 3M3YC 1O25A 1SMYD 4WJ3M 5FLMK 2B63C 3A8JA 1IQ0A 1DD5A 4FXDA 5C44C 3P9AA 4QIWD 2CFAA 1HQMD 2B9SB 5IYDC 1K83C 1EH1A 3HOZK 4AYBD 2A68D 5CHPA 1J6VA 2R92C 1I3QA 4P5BA 4LMOA 4PAAA 3I4NK 1IW7D 4Y7NK
chains in the Genus database with same CATH topology
2JA5A 3N3YA 4LR2A 1LPQA 3V4GA 3K5OA 2R92A 1F9NA 4KB2A 5IOQA 1MIUA 4D3YA 4C3HC 1RRJA 2ZFZA 1O2AA 4GTAA 4C3IC 3L4JA 1R49A 2NVXA 3GTGA 1ZVUA 2R4GA 1R5ZA 2A69D 5CJ9A 4ILDA 2E2IA 3BUEA 3LAJA 4G0WA 4DDQA 2GSNA 4FM9A 2PMZA 3GTKA 2XCRB 5EGHA 1Y1WA 1GE9A 4FGUA 1BJTA 3N0CA 4KM8A 4FYDA 1B4AA 3GTLA 4KAWX 3AQOA 5JFEA 5JVOA 1KQ4A 3S0XA 2CFAB 4C3JC 3VA7A 1TWHA 1YNJD 4NOKA 4NOLA 1TWGA 2XCOA 1XXBA 4F3EA 5JSBB 4KARA 3K58A 1Y698 3FKIA 4GTEA 4KC6A 1O28A 4G0VA 2WAQA 2WB1A 4J3NA 5JSNB 3CAGA 4C2MC 3GTOA 1SFOA 4AN8A 1WQHA 2R93A 4GTCA 2E2HA 1Q8IA 2JA6A 4AYBA 2XCQA 5IORA 4G0UA 1XXAA 3K5MA 2JH3A 2BE5D 4QIWA 4GTDA 1K4TA 4KMDA 3FOEA 1A31A 2F4QA 3GTPA 1O26A 4H3TA 4BKWA 1SEUA 2VUMA 4D3ZA 1O29A 4C2MA 5MLC9 4GT9A 4QCLA 4KMHA 3K5LA 4KMAA 3M4AA 3OREA 2CW0D 2A6HD 3K59A 3NUHA 3ERED 4LQYA 2R7ZA 2NVYA 4KASA 1I6VD 4EJ3A 1WQFA 1A35A 4FZBA 3AH5A 1BGWA 2Y0SA 1WQGA 3DU6A 1B4BA 1O24A 1TL8A 2GSUA 5EGEA 2KWAA 1IS1A 4IP8A 1WIHA 1EJ9A 3G4AA 3OEPA 5TJ3A 4GTBA 3L4KA 4O26A 4KDDA 3GTQA 3LPXA 4IP9A 1EK8A 5IOTA 3FOFA 4GFQA 3WVOA 1WCMA 3IAYA 2A6ED 1TWCA 4Q5GA 3GTMA 1AB4A 1XXCA 2YU9A 2RH6A 5IOSA 3LAPA 3LF9A 3Q3QA 2B63A 4L8IA 2PHCB 5C9HA 4BLBA 3QX3A 3HKZA 3H0GA 3FHZA 4KATA 1RR8C 1K4SA 4GTLA 1SC7A 2P5MA 1ZXOA 3DU5A 3LHPS 1ZBSA 1TWAA 2RGRA 3SJRA 4OYDB 3K57A 1SMYD 1NH3A 1O25A 4GTFA 4M1XA 1ISEA 1DD5A 1O27A 4FXDA 4P5AA 3P9AA 1ZYRD 4JLRC 1V9MA 2O5JD 2CFAA 1HQMD 1TGOA 2B9SB 3K5NA 1EH1A 1TWFA 4Q5VA 3N0BA 2A68D 4AHCA 2Y3PA 3G4CA 3MMLB 5CHPA 3CQZA 1I50A 1O2BA 1I3QA 2GSOA 3KYLA 2JA7A 5CQGA 3AQPA 4P5BA 4LMOA 3GTJA 4KB4A 3MAQA 4BLAA 4NOMA 3OPFA 1A36A 1YNND 1R9TA 1K83A 4KM9A 1IW7D 1Y1VA 1T8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYD B;  3V4G A;  1WQF A;  4KC6 A;  4G0V A;  1BGW A;  1WQG A;  1B4B A;  4J3N A;  5JSN B;  3CAG A;  1F9N A;  4KB2 A;  1ISE A;  1DD5 A;  2KWA A;  1IS1 A;  1WIH A;  3OEP A;  1WQH A;  3L4K A;  4JLR C;  2XCQ A;  2ZFZ A;  4G0U A;  4KDD A;  3L4J A;  3LPX A;  1EK8 A;  1XXA A;  3FOF A;  4GFQ A;  1ZVU A;  1EH1 A;  1XXC A;  1AB4 A;  5CJ9 A;  3FOE A;  3BUE A;  3LAP A;  4G0W A;  3LF9 A;  2Y3P A;  3MML B;  4DDQ A;  4FM9 A;  5JSB B;  2XCR B;  4L8I A;  2PHC B;  1BJT A;  1GE9 A;  3QX3 A;  5MLC 9;  1B4A A;  4KAW X;  5JVO A;  4KB4 A;  3FHZ A;  3ORE A;  3VA7 A;  3NUH A;  3ERE D;  3OPF A;  2P5M A;  2XCO A;  1XXB A;  3LAJ A;  3LHP S;  1Y69 8;  2RGR A; 
#chains in the Genus database with same CATH topology
 2WB1 L;  4LR2 A;  2R92 A;  4A3B C;  1Y1V K;  3FKI K;  5IOQ A;  1MIU A;  4D3Y A;  1YNJ A;  3T00 A;  4C3H C;  5L46 A;  4XLN A;  2EBB A;  4GTA A;  1O2A A;  3L4J A;  3HOU C;  1L0W A;  2CW0 A;  1R9T C;  3EQL A;  4AYB L;  2A69 D;  5CJ9 A;  5M3F K;  1USO A;  2JA7 K;  4G0W A;  3I4M C;  5M3M K;  1Y1W A;  1GE9 A;  3N0C A;  4QJV A;  4KAW X;  4C3J C;  1TWH A;  3RZO K;  1YNJ D;  4NOK A;  5IP9 C;  4A3M C;  4F3E A;  3K58 A;  1Y69 8;  1F7V A;  1JVI A;  3PO3 K;  2NVT K;  5C3E K;  4G0V A;  4C2M C;  3CAG A;  4A3L K;  4A93 C;  3I4M K;  3S15 K;  4G0U A;  1XXA A;  2JH3 A;  4O2D A;  4KMD A;  3FKI C;  1O26 A;  3GEE A;  4H3T A;  4BKW A;  2VUM A;  4Y52 C;  4GT9 A;  3GTM K;  1TWC K;  3S1R K;  3M4A A;  4XSZ A;  3HOV K;  2R7Z A;  5C4J C;  3GTM C;  3S1Q K;  4KAS A;  4EJ3 A;  4OIO A;  2Y0S A;  3DU6 A;  2VUM C;  1I6V A;  3TFH A;  5EGE A;  2KWA A;  3OEP A;  1WIH A;  3S1N K;  2A69 A;  1VJE A;  1YX2 A;  4A3E K;  4BY7 K;  3WVO A;  3S15 C;  3S1N C;  1TWC A;  3GTM A;  1XPP A;  4A93 K;  5IOS A;  4A3L C;  2WAQ D;  1HI9 A;  4L8I A;  2NVT C;  2NVQ K;  3PO3 C;  3HKZ A;  1PJ7 A;  2YU9 K;  3S1Q C;  3FHZ A;  1RR8 C;  1K4S A;  3HOY C;  1SFO K;  3IPJ A;  3S1R C;  2RGR A;  3SJR A;  1WOO A;  2FQT A;  1J98 A;  4GTF A;  2NVX K;  4M1X A;  1I3Q C;  3HOW C;  2JA7 C;  4OIP A;  1VLO A;  4JLR C;  3HKZ D;  1V9M A;  2A68 A;  1DCO A;  4XSX A;  4NOI A;  4A3J C;  3JST A;  4C3H K;  4LK1 A;  1Y1V C;  4Q5V A;  5TMF A;  1WCM K;  2GAG C;  3MML B;  4C2M K;  1I50 A;  3GTQ K;  2GSO A;  2JA7 A;  5CQG A;  3GTG K;  4BLA A;  3CQZ K;  1A36 A;  1YNN D;  3SZY A;  1R9T A;  4P9S A;  1Y1V A;  2WAQ L;  3N3Y A;  1LPQ A;  5FJ8 K;  1Y1W C;  1DCH A;  1BS2 A;  3HOZ C;  3HXA A;  3GTJ C;  1IL2 A;  5M5W K;  1F7U A;  1TWH C;  2NVX A;  4LK0 A;  3M4O C;  3S2D K;  1ZVU A;  2R4G A;  2PA8 D;  1R5Z A;  2PA8 L;  3BUE A;  1V5V A;  2JA5 C;  3GTL K;  2GSN A;  3H3V L;  4G7O A;  3S2H C;  1BJT A;  4FGU A;  3S0X A;  2PMZ D;  5JFE A;  5TMC A;  1KQ4 A;  4MEY A;  3AD8 C;  4Y7N C;  4A3C K;  3VA7 A;  2XCO A;  1TWG A;  4Q4Z A;  4KAR A;  3FKI A;  1O28 A;  4RMF A;  2V6T A;  2WAQ A;  4J3N A;  3WOD A;  4WIL A;  3GTO A;  2E2J C;  4AN8 A;  2D6F C;  2JA6 A;  1K83 K;  1VRQ C;  4AH6 A;  5IOR A;  3K5M A;  1TWG C;  2R7Z C;  1ZYR A;  4QIW A;  4GTD A;  1I6H K;  3FOE A;  5C44 K;  3AD9 C;  3GTP A;  2F4Q A;  4A3E C;  1IBA A;  2PMZ L;  4KMA A;  1TWF K;  3ORE A;  2CW0 D;  2A6H D;  2PPB A;  2JA6 C;  4LQY A;  1PJ6 A;  2P8T A;  2A6H A;  5C4X K;  3GTP C;  1UV7 A;  4FZB A;  1TL8 A;  1IS1 A;  4IP8 A;  5TJ3 A;  3GTQ A;  1VGX A;  4IP9 A;  3GDZ A;  1I50 K;  1WCM A;  1AB4 A;  3LAP A;  3LF9 A;  4BXX K;  1TWH K;  2PHC B;  4BLB A;  1XZQ B;  3K7A C;  2O5I A;  3H0G A;  3GTQ C;  5C3E C;  4KN7 A;  2P5M A;  1SMY A;  1ZXO A;  4A3G C;  3LHP S;  1C0A A;  1NH3 A;  4A3J K;  3CQZ C;  1I50 C;  4C3J K;  1WSV A;  4MQ9 A;  1ISE A;  4P5A A;  3H0G C;  1YNN A;  5IP7 K;  2NVY K;  1IW7 A;  2O5J D;  1J6W A;  3GIR A;  1RU0 A;  1TGO A;  3K5N A;  4LOW A;  4A3D K;  3N0B A;  3TTG A;  4AHC A;  1G51 A;  3S14 K;  2Y3P A;  3G4C A;  3CQZ A;  5M5Y K;  2E2I K;  4BBS C;  3KYL A;  4BBR K;  3GTJ A;  4KB4 A;  4A3I K;  4NOM A;  3OPF A;  2NVX C;  5D4D A;  1XZQ A;  4A3K C;  4KM9 A;  3LAJ A;  2JA5 A;  4MEX A;  1F93 A;  3V4G A;  2GAH C;  2R7Z K;  3HOY K;  4X6A C;  3A8I A;  2NVQ C;  2ZFZ A;  5M5X K;  4LJZ A;  1USM A;  2V6U A;  2V6S A;  3PO2 K;  4ILD A;  2E2I A;  4X6A K;  4DDQ A;  1INN A;  4WJ4 A;  5EGH A;  4KM8 A;  3GTO C;  3AQO A;  4LLG A;  4A3K K;  2JA8 C;  4OIQ A;  4KN4 A;  5FLM C;  2B63 K;  2ZUF A;  3S2H K;  3M3Y K;  1XXB A;  4BBR C;  5JSB B;  5HL8 A;  4PAB A;  3GTK C;  3M4O K;  3S14 C;  2WB1 A;  1TWA K;  1WQH A;  1JOE A;  4Y52 K;  2XCQ A;  1Q8I A;  4AYB A;  1PJ5 A;  1Y1W K;  1K4T A;  3HKZ L;  4Q5S A;  5IP9 K;  1O29 A;  4D3Z A;  4QCL A;  3GEH A;  3K5L A;  2E2H C;  3K59 A;  3NUH A;  3ERE D;  4OIR A;  4OIN A;  3DXJ A;  1WCM C;  2NVY A;  1I6V D;  4BBS K;  1A35 A;  4QJV B;  1R9T K;  3RZO C;  3AH5 A;  1BGW A;  1WQG A;  1B4B A;  4YFX A;  2R93 K;  3L4K A;  2Y0S D;  1X31 C;  1JQW A;  4GTB A;  1EFW A;  4A3B K;  4KDD A;  1I3Q K;  3HOW K;  1EK8 A;  5IOT A;  3FOF A;  4GFQ A;  3TFJ A;  2A6E D;  2NVY C;  5IP7 C;  1TWA C;  3H0G K;  3HOX K;  1YCL A;  1ZQ1 C;  3QX3 A;  4YG2 A;  4ZH4 A;  5IYC C;  4GTL A;  1SC7 A;  4C45 A;  3DU5 A;  3GTO K;  1ZBS A;  1TWA A;  4A3F K;  4XCH A;  3K57 A;  5IYD K;  1DCP A;  3ADA C;  3TFI A;  1O27 A;  3PO2 C;  1ZYR D;  1TWG K;  2Y0S L;  2R92 K;  3GEI A;  1TWF A;  2BE5 A;  2W7V A;  1O2B A;  3HOV C;  1BDF A;  3AQP A;  3GTP K;  3MAQ A;  1O2F B;  5IYB C;  4A3C C;  1K83 A;  2JA6 K;  2JA8 K;  1T8I A;  2E2I C;  3T01 A;  4BY1 C;  3K5O A;  1F9N A;  4KB2 A;  4YFK A;  4A3D C;  3S2D C;  1I6H C;  1RRJ A;  4C3I C;  3GSI A;  3S16 K;  1R49 A;  1IE0 A;  5E68 A;  3GTG A;  1XZP B;  4FM9 A;  2PMZ A;  3GTK A;  2XCR B;  4A3M K;  4FYD A;  1B4A A;  3GTL A;  5JVO A;  2O5J A;  2CFA B;  4G7H A;  1J6X A;  4NOL A;  3S1M C;  4A3F C;  3GTG C;  2ZUE A;  1WOS A;  4JK1 A;  3K7A K;  4A3I C;  4GTE A;  4KC6 A;  2A6E A;  3RZD K;  5IYC K;  3HOU K;  1EQR A;  5JSN B;  1SFO A;  2JA5 K;  3GTL C;  1HQM A;  2R93 A;  4GTC A;  2E2H A;  3HOX C;  3A8K A;  3RZD C;  3H3V D;  4XLP A;  2BE5 D;  3GTJ K;  1A31 A;  3S1M K;  3I4N C;  1SEU A;  3SZZ A;  5C4X C;  4C2M A;  5MLC 9;  4KMH A;  1SFO C;  2R93 C;  4A3G K;  2FQO A;  3T02 A;  3BP3 A;  1WQF A;  4YFN A;  1WOR A;  1XZP A;  1WSR A;  1O24 A;  2E2H K;  4GZY A;  4G7Z A;  4C3I K;  2GSU A;  4BXX C;  1EI6 A;  3G4A A;  1EJ9 A;  4QIW L;  4BY7 C;  1WOP A;  4O26 A;  3LPX A;  3BP8 C;  4BY1 K;  4KMU A;  3IAY A;  1XXC A;  2E2J K;  4Q5G A;  2RH6 A;  2YU9 A;  2VUM K;  3Q3Q A;  2WB1 D;  2B63 A;  5IYB K;  3S16 C;  5C9H A;  3S17 K;  5C4J K;  4KAT A;  3S17 C;  3AD7 C;  3GTK K;  1VH2 A;  1TWF C;  1TWC C;  2YU9 C;  4OYD B;  3M3Y C;  1O25 A;  1SMY D;  4WJ3 M;  5FLM K;  2B63 C;  3A8J A;  1IQ0 A;  1DD5 A;  4FXD A;  5C44 C;  3P9A A;  4QIW D;  2CFA A;  1HQM D;  2B9S B;  5IYD C;  1K83 C;  1EH1 A;  3HOZ K;  4AYB D;  2A68 D;  5CHP A;  1J6V A;  2R92 C;  1I3Q A;  4P5B A;  4LMO A;  4PAA A;  3I4N K;  1IW7 D;  4Y7N K; 
#chains in the Genus database with same CATH homology
 2JA5 A;  3N3Y A;  4LR2 A;  1LPQ A;  3V4G A;  3K5O A;  2R92 A;  1F9N A;  4KB2 A;  5IOQ A;  1MIU A;  4D3Y A;  4C3H C;  1RRJ A;  2ZFZ A;  1O2A A;  4GTA A;  4C3I C;  3L4J A;  1R49 A;  2NVX A;  3GTG A;  1ZVU A;  2R4G A;  1R5Z A;  2A69 D;  5CJ9 A;  4ILD A;  2E2I A;  3BUE A;  3LAJ A;  4G0W A;  4DDQ A;  2GSN A;  4FM9 A;  2PMZ A;  3GTK A;  2XCR B;  5EGH A;  1Y1W A;  1GE9 A;  4FGU A;  1BJT A;  3N0C A;  4KM8 A;  4FYD A;  1B4A A;  3GTL A;  4KAW X;  3AQO A;  5JFE A;  5JVO A;  1KQ4 A;  3S0X A;  2CFA B;  4C3J C;  3VA7 A;  1TWH A;  1YNJ D;  4NOK A;  4NOL A;  1TWG A;  2XCO A;  1XXB A;  4F3E A;  5JSB B;  4KAR A;  3K58 A;  1Y69 8;  3FKI A;  4GTE A;  4KC6 A;  1O28 A;  4G0V A;  2WAQ A;  2WB1 A;  4J3N A;  5JSN B;  3CAG A;  4C2M C;  3GTO A;  1SFO A;  4AN8 A;  1WQH A;  2R93 A;  4GTC A;  2E2H A;  1Q8I A;  2JA6 A;  4AYB A;  2XCQ A;  5IOR A;  4G0U A;  1XXA A;  3K5M A;  2JH3 A;  2BE5 D;  4QIW A;  4GTD A;  1K4T A;  4KMD A;  3FOE A;  1A31 A;  2F4Q A;  3GTP A;  1O26 A;  4H3T A;  4BKW A;  1SEU A;  2VUM A;  4D3Z A;  1O29 A;  4C2M A;  5MLC 9;  4GT9 A;  4QCL A;  4KMH A;  3K5L A;  4KMA A;  3M4A A;  3ORE A;  2CW0 D;  2A6H D;  3K59 A;  3NUH A;  3ERE D;  4LQY A;  2R7Z A;  2NVY A;  4KAS A;  1I6V D;  4EJ3 A;  1WQF A;  1A35 A;  4FZB A;  3AH5 A;  1BGW A;  2Y0S A;  1WQG A;  3DU6 A;  1B4B A;  1O24 A;  1TL8 A;  2GSU A;  5EGE A;  2KWA A;  1IS1 A;  4IP8 A;  1WIH A;  1EJ9 A;  3G4A A;  3OEP A;  5TJ3 A;  4GTB A;  3L4K A;  4O26 A;  4KDD A;  3GTQ A;  3LPX A;  4IP9 A;  1EK8 A;  5IOT A;  3FOF A;  4GFQ A;  3WVO A;  1WCM A;  3IAY A;  2A6E D;  1TWC A;  4Q5G A;  3GTM A;  1AB4 A;  1XXC A;  2YU9 A;  2RH6 A;  5IOS A;  3LAP A;  3LF9 A;  3Q3Q A;  2B63 A;  4L8I A;  2PHC B;  5C9H A;  4BLB A;  3QX3 A;  3HKZ A;  3H0G A;  3FHZ A;  4KAT A;  1RR8 C;  1K4S A;  4GTL A;  1SC7 A;  2P5M A;  1ZXO A;  3DU5 A;  3LHP S;  1ZBS A;  1TWA A;  2RGR A;  3SJR A;  4OYD B;  3K57 A;  1SMY D;  1NH3 A;  1O25 A;  4GTF A;  4M1X A;  1ISE A;  1DD5 A;  1O27 A;  4FXD A;  4P5A A;  3P9A A;  1ZYR D;  4JLR C;  1V9M A;  2O5J D;  2CFA A;  1HQM D;  1TGO A;  2B9S B;  3K5N A;  1EH1 A;  1TWF A;  4Q5V A;  3N0B A;  2A68 D;  4AHC A;  2Y3P A;  3G4C A;  3MML B;  5CHP A;  3CQZ A;  1I50 A;  1O2B A;  1I3Q A;  2GSO A;  3KYL A;  2JA7 A;  5CQG A;  3AQP A;  4P5B A;  4LMO A;  3GTJ A;  4KB4 A;  3MAQ A;  4BLA A;  4NOM A;  3OPF A;  1A36 A;  1YNN D;  1R9T A;  1K83 A;  4KM9 A;  1IW7 D;  1Y1V A;  1T8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...