1WQFA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structural studies of Mycobacterium tuberculosis RRF and a comparative study of RRFs of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome recycling factor
total genus 62
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqfA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqfA02
1BGWA 4KB2A 2Y3PA 2P5MA 3BUEA 3VA7A 3L4KA 3CAGA 4FM9A 1DD5A 4KAWX 3L4JA 1ISEA 3LAPA 1WQHA 4L8IA 1WQGA 1BJTA 4KC6A 1XXCA 1ZVUA 2RGRA 3LPXA 3NUHA 4G0WA 3ERED 1IS1A 4DDQA 3OREA 4OYDB 2XCQA 3FOEA 3LF9A 2XCRB 3V4GA 3FOFA 4KDDA 1XXAA 3LHPS 5MLC9 1AB4A 3OPFA 1F9NA 1Y698 4J3NA 5CJ9A 3LAJA 3FHZA 1B4AA 1XXBA 5JSNB 5JVOA 5JSBB 3QX3A 1WIHA 1GE9A 1EH1A 4G0VA 1WQFA 4JLRC 2ZFZA 3OEPA 1B4BA 3MMLB 1EK8A 2XCOA 2PHCB 4KB4A 4G0UA 4GFQA 2KWAA
chains in the Genus database with same CATH superfamily
2WAQL 2R93K 4A3LC 1EQRA 3TTGA 3S14C 1WQHA 3K58A 4L8IA 3DXJA 3M4OC 3HOWK 1TWGA 4Q5GA 4BBSC 4BY7K 2NVYC 4A3BC 4C2MC 3HOVK 5C4XK 2JA6C 2FQTA 5IOSA 4XLNA 1DCPA 4WJ3M 3FKIA 5JSBB 4KMAA 2JA5C 1B4BA 1VGXA 4X6AK 3GTLA 3K59A 3S1QK 4GFQA 3H3VL 1TWAC 1DD5A 1WSVA 4OIOA 1O24A 5C44K 1MIUA 3DU6A 3K5LA 1SEUA 3A8JA 4KATA 4LJZA 4AN8A 5E68A 4KASA 2GSOA 4XLPA 5IP9C 2O5IA 1AB4A 2RH6A 4BXXC 1IW7A 4GTAA 1USMA 5M5XK 2JA6K 3AQOA 2YU9C 1F7VA 2WB1D 1IQ0A 4A3BK 2CFAA 2E2HK 1O2FB 3GTMC 2CW0D 5IORA 4G0WA 4KB4A 4FYDA 2GAGC 4GTEA 1O28A 3MAQA 4GZYA 3TFHA 2JA6A 4A3JK 3S14K 2Y0SA 2WB1A 1A36A 2E2HA 1G51A 1XZPB 3ADAC 4AH6A 2E2IA 4C2MA 1JOEA 1IW7D 4G7OA 3K5NA 3LHPS 3GTKK 3GTOK 2A6ED 4NOIA 5IOTA 4A3FK 2E2IK 3HOVC 2PMZA 2JA8C 3GTJA 4C2MK 5C3EC 2GSNA 3M3YK 4BY7C 2FQOA 3S2HK 1VH2A 1K83K 1WOOA 4A3DK 3S1NK 2O5JD 2JA7K 1RU0A 2D6FC 2VUMC 4BLBA 4A93K 2PA8L 3GTJK 3HKZD 4QCLA 1K83A 4M1XA 3S1MK 1XXCA 4KM9A 3NUHA 2NVTK 3HOZC 1K4SA 2JA7A 3T01A 4KN7A 4LOWA 5C4JC 4AYBA 3TFIA 3S2HC 4J3NA 3GTGK 3S0XA 4IP8A 3K7AK 3WVOA 4YFKA 5IP7C 3A8KA 3N0BA 2NVXA 1EK8A 4G7HA 3IPJA 5IYBC 1USOA 2V6SA 1SFOA 2Y3PA 2A68A 4O2DA 3K5OA 4FXDA 2B63K 3RZDK 4QJVA 1BDFA 1K4TA 4EJ3A 4F3EA 1O26A 3S1NC 5IYDC 2NVQK 5FLMC 3GSIA 3S1RC 5C3EK 3CQZC 1VJEA 4BKWA 2YU9K 3HKZA 4A3FC 4GTBA 3LAJA 1WOSA 4O26A 4A3IC 2O5JA 3GTKC 4ZH4A 4C3JC 4A3EK 2YU9A 1TWHC 1YNNA 1TWFA 4FM9A 2PMZL 1ISEA 1IL2A 3HKZL 5TJ3A 3EQLA 3S1QC 2E2HC 2E2JC 1VLOA 4X6AC 2R92A 3WODA 5L46A 3AD8C 3DU5A 1XXBA 4Y7NK 1SMYA 4GTFA 3GTPC 3HOYK 3S17C 3S15C 1WQFA 3HOXK 1J6XA 1ZYRA 2R92K 2BE5A 3GIRA 4GT9A 1I6VA 4BBRK 1SFOC 1Y1WA 3H0GC 5IYDK 5C44C 3BUEA 3P9AA 3CAGA 1TGOA 4FGUA 3IAYA 2WAQD 3RZDC 3AH5A 1WQGA 1TWHK 1ZVUA 2P8TA 5TMFA 1O2AA 3A8IA 1DCOA 2V6UA 3FOEA 4MQ9A 5JFEA 5D4DA 1Y698 2V6TA 4A3KC 1TWHA 5FJ8K 3GTLC 5JVOA 1XZQB 4KMUA 4OINA 3CQZK 1EH1A 4JLRC 2B9SB 4WJ4A 4BBSK 5FLMK 1I6HK 3HOWC 4OIQA 1RR8C 1I3QK 1TWCC 1Y1VA 4RMFA 3BP8C 4KARA 1DCHA 5EGEA 4LK1A 4YFXA 3AD9C 3GDZA 2PPBA 1V9MA 2R7ZK 5IYBK 1TWCK 3OREA 4KMHA 3T02A 2XCRB 3V4GA 4A3DC 5M5WK 1EFWA 4A3CK 1F9NA 2Y0SL 1J6WA 3M3YC 3K5MA 5CQGA 3BP3A 3FHZA 2R7ZA 4P5BA 2R93A 3GTQK 2WAQA 2GSUA 2NVXC 4Q5VA 4MEYA 3HOZK 1PJ6A 1R5ZA 3PO2K 1I6VD 1ZYRD 2A69A 1SMYD 4QIWA 3FKIK 1XZPA 1IS1A 4XSXA 3JSTA 5M3MK 5M3FK 3S16K 4BBRC 3PO3C 1EJ9A 3GTLK 4Y7NC 1TWGK 2CFAB 3H3VD 3TFJA 2W7VA 1YNND 3H0GA 1ZQ1C 1Y1WC 1WORA 4D3ZA 2PHCB 2GAHC 4D3YA 3VA7A 1BS2A 4Y52C 1HQMD 1WOPA 4QJVB 2R4GA 3H0GK 1F93A 3GTMK 2RGRA 1R49A 4OYDB 3FOFA 3S15K 2NVYA 3HOYC 1O29A 5TMCA 4YFNA 4A3IK 1T8IA 3GTMA 3SZZA 4BXXK 3QX3A 4KMDA 3MMLB 2NVYK 3G4AA 3S16C 1YCLA 3M4OK 5HL8A 4KB2A 3L4KA 3GEHA 4KAWX 3L4JA 3GTKA 4A3LK 1BJTA 3SZYA 4QIWL 4A3EC 2JA5K 3LF9A 3N3YA 4WILA 1UV7A 4KDDA 3OPFA 1WCMC 5EGHA 1IBAA 1L0WA 4YG2A 5C4XC 1GE9A 2JA5A 1JVIA 3M4AA 4A3CC 1A35A 3OEPA 3S1RK 4H3TA 3GTOA 3FKIC 1KQ4A 3AQPA 2NVTC 5CJ9A 3HXAA 4C3IK 4BY1C 4LR2A 1I50C 3S2DC 2B63C 2PMZD 2A6HD 2R93C 3GTJC 1O27A 4GTDA 3GTGA 4OIPA 4KC6A 4C3HK 3I4NK 2XCQA 4XSZA 2NVXK 1ZXOA 1XPPA 2PA8D 1ZBSA 1IE0A 1B4AA 4BLAA 4C45A 4G7ZA 2E2IC 4A3KK 1Y1VC 1Q8IA 4Q5SA 1WCMK 1J6VA 5C4JK 4AYBL 4ILDA 1HI9A 1RRJA 4LQYA 2ZUFA 4PABA 3I4MK 3N0CA 2P5MA 4LK0A 4KM8A 3Q3QA 1WCMA 4A3JC 4A93C 4C3IC 5IYCK 4BY1K 1I3QC 3ERED 4AHCA 1PJ7A 3T00A 4A3MC 1SFOK 4MEXA 1R9TA 1XXAA 2B63A 2JA8K 5CHPA 1O2BA 2A6HA 3GTPK 1TWFK 3RZOK 1LPQA 3GTOC 1F7UA 1O25A 4KN4A 1SC7A 1R9TK 2XCOA 2E2JK 3GTPA 2KWAA 4JK1A 3G4CA 4A3GK 4LLGA 4Q4ZA 3SJRA 1A31A 2R92C 3K57A 3HOXC 1NH3A 3S17K 5MLC9 1R9TC 3KYLA 1TWGC 4XCHA 1JQWA 1TWFC 5JSNB 4PAAA 2ZUEA 5IP9K 1TWAA 4G0VA 4FZBA 2ZFZA 4OIRA 1WSRA 1YNJD 1XZQA 5M5YK 5C9HA 4A3GC 4AYBD 1BGWA 4Y52K 1PJ5A 3LAPA 1TWAK 2BE5D 1X31C 3I4MC 3LPXA 4C3JK 2F4QA 4LMOA 2WB1L 3GEEA 4DDQA 1Y1WK 3CQZA 4NOMA 1INNA 4NOLA 1YX2A 1HQMA 4P9SA 3RZOC 2JH3A 5IP7K 3GTQC 1Y1VK 3GTGC 5IOQA 3PO3K 1I50A 4A3MK 2NVQC 3AD7C 1VRQC 2A6EA 3I4NC 4P5AA 5IYCC 1TL8A 4G0UA 1V5VA 2R7ZC 3S1MC 3GEIA 4GTCA 1I50K 3S2DK 2VUMK 2Y0SD 2JA7C 3PO2C 1I3QA 3GTQA 4NOKA 4GTLA 1I6HC 1K83C 1C0AA 4QIWD 2CW0A 3HOUK 3K7AC 2VUMA 2A69D 2EBBA 3HOUC 1TWCA 1WIHA 4IP9A 1J98A 4C3HC 1EI6A 2A68D 1YNJA
chains in the Genus database with same CATH topology
2Y3PA 2P5MA 3K5OA 4FXDA 3Q3QA 4KM8A 1SMYD 1WCMA 1WQHA 4QIWA 3K58A 4L8IA 1K4TA 4C3IC 4EJ3A 4F3EA 1O26A 1TWGA 1IS1A 4AHCA 3ERED 4Q5GA 1R9TA 4C2MC 1XXAA 2B63A 1EJ9A 4BKWA 5CHPA 3HKZA 1O2BA 5IOSA 4GTBA 3LAJA 4O26A 3FKIA 1LPQA 5JSBB 1O25A 2CFAB 1SC7A 4KMAA 1B4BA 4C3JC 1YNND 3H0GA 2XCOA 2YU9A 3GTLA 4D3ZA 3GTPA 3K59A 2PHCB 4GFQA 4D3YA 2KWAA 1TWFA 4FM9A 3VA7A 1DD5A 1ISEA 1O24A 1HQMD 1MIUA 3DU6A 3K5LA 3G4CA 2R4GA 1SEUA 5TJ3A 3SJRA 4KATA 1R49A 4AN8A 1A31A 2RGRA 4OYDB 3K57A 4KASA 3FOFA 2GSOA 1NH3A 2R92A 5MLC9 2NVYA 1AB4A 1O29A 2RH6A 3KYLA 3DU5A 1T8IA 3GTMA 4GTAA 1XXBA 5JSNB 4GTFA 3QX3A 4KMDA 1TWAA 4G0VA 3AQOA 1WQFA 4FZBA 2ZFZA 3MMLB 1YNJD 2CFAA 4GT9A 3G4AA 2CW0D 5IORA 1Y1WA 4KB4A 4FYDA 5C9HA 4G0WA 1BGWA 4KB2A 1O28A 3BUEA 4GTEA 3L4KA 3P9AA 3MAQA 1TGOA 4FGUA 3CAGA 4KAWX 3IAYA 3GTKA 3LAPA 2JA6A 3L4JA 2BE5D 2Y0SA 2WB1A 3AH5A 1WQGA 1A36A 2E2HA 1BJTA 1ZVUA 2E2IA 1O2AA 2F4QA 4LMOA 3LPXA 4DDQA 3FOEA 3CQZA 4C2MA 4NOMA 3LF9A 3N3YA 1IW7D 4NOLA 4KDDA 3K5NA 3LHPS 5JFEA 3OPFA 1Y698 5EGHA 2JH3A 2A6ED 5IOTA 1TWHA 5JVOA 5IOQA 1GE9A 2PMZA 3GTJA 2JA5A 1EH1A 3M4AA 2GSNA 4JLRC 2B9SB 1A35A 3OEPA 4H3TA 1I50A 3GTOA 1KQ4A 1RR8C 3AQPA 4P5AA 5CJ9A 1TL8A 1Y1VA 2O5JD 4G0UA 4LR2A 4BLBA 4KARA 5EGEA 2A6HD 4GTCA 4QCLA 1O27A 1K83A 4GTDA 4M1XA 3GTGA 1V9MA 4KC6A 1XXCA 4KM9A 3NUHA 1I3QA 3GTQA 3OREA 1K4SA 2JA7A 4NOKA 2XCQA 4KMHA 2XCRB 4GTLA 3V4GA 4AYBA 1F9NA 1ZXOA 4J3NA 3K5MA 5CQGA 1ZBSA 2VUMA 2A69D 1B4AA 2R7ZA 4IP8A 4BLAA 3S0XA 3FHZA 4P5BA 3WVOA 2R93A 1TWCA 1WIHA 1Q8IA 2WAQA 4IP9A 2GSUA 3N0BA 4Q5VA 2NVXA 4ILDA 4C3HC 1EK8A 1R5ZA 1RRJA 1I6VD 4LQYA 2A68D 1SFOA 3N0CA 1ZYRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGW A;  4KB2 A;  2Y3P A;  2P5M A;  3BUE A;  3VA7 A;  3L4K A;  3CAG A;  4FM9 A;  1DD5 A;  4KAW X;  3L4J A;  1ISE A;  3LAP A;  1WQH A;  4L8I A;  1WQG A;  1BJT A;  4KC6 A;  1XXC A;  1ZVU A;  2RGR A;  3LPX A;  3NUH A;  4G0W A;  3ERE D;  1IS1 A;  4DDQ A;  3ORE A;  4OYD B;  2XCQ A;  3FOE A;  3LF9 A;  2XCR B;  3V4G A;  3FOF A;  4KDD A;  1XXA A;  3LHP S;  5MLC 9;  1AB4 A;  3OPF A;  1F9N A;  1Y69 8;  4J3N A;  5CJ9 A;  3LAJ A;  3FHZ A;  1B4A A;  1XXB A;  5JSN B;  5JVO A;  5JSB B;  3QX3 A;  1WIH A;  1GE9 A;  1EH1 A;  4G0V A;  1WQF A;  4JLR C;  2ZFZ A;  3OEP A;  1B4B A;  3MML B;  1EK8 A;  2XCO A;  2PHC B;  4KB4 A;  4G0U A;  4GFQ A;  2KWA A; 
#chains in the Genus database with same CATH topology
 2WAQ L;  2R93 K;  4A3L C;  1EQR A;  3TTG A;  3S14 C;  1WQH A;  3K58 A;  4L8I A;  3DXJ A;  3M4O C;  3HOW K;  1TWG A;  4Q5G A;  4BBS C;  4BY7 K;  2NVY C;  4A3B C;  4C2M C;  3HOV K;  5C4X K;  2JA6 C;  2FQT A;  5IOS A;  4XLN A;  1DCP A;  4WJ3 M;  3FKI A;  5JSB B;  4KMA A;  2JA5 C;  1B4B A;  1VGX A;  4X6A K;  3GTL A;  3K59 A;  3S1Q K;  4GFQ A;  3H3V L;  1TWA C;  1DD5 A;  1WSV A;  4OIO A;  1O24 A;  5C44 K;  1MIU A;  3DU6 A;  3K5L A;  1SEU A;  3A8J A;  4KAT A;  4LJZ A;  4AN8 A;  5E68 A;  4KAS A;  2GSO A;  4XLP A;  5IP9 C;  2O5I A;  1AB4 A;  2RH6 A;  4BXX C;  1IW7 A;  4GTA A;  1USM A;  5M5X K;  2JA6 K;  3AQO A;  2YU9 C;  1F7V A;  2WB1 D;  1IQ0 A;  4A3B K;  2CFA A;  2E2H K;  1O2F B;  3GTM C;  2CW0 D;  5IOR A;  4G0W A;  4KB4 A;  4FYD A;  2GAG C;  4GTE A;  1O28 A;  3MAQ A;  4GZY A;  3TFH A;  2JA6 A;  4A3J K;  3S14 K;  2Y0S A;  2WB1 A;  1A36 A;  2E2H A;  1G51 A;  1XZP B;  3ADA C;  4AH6 A;  2E2I A;  4C2M A;  1JOE A;  1IW7 D;  4G7O A;  3K5N A;  3LHP S;  3GTK K;  3GTO K;  2A6E D;  4NOI A;  5IOT A;  4A3F K;  2E2I K;  3HOV C;  2PMZ A;  2JA8 C;  3GTJ A;  4C2M K;  5C3E C;  2GSN A;  3M3Y K;  4BY7 C;  2FQO A;  3S2H K;  1VH2 A;  1K83 K;  1WOO A;  4A3D K;  3S1N K;  2O5J D;  2JA7 K;  1RU0 A;  2D6F C;  2VUM C;  4BLB A;  4A93 K;  2PA8 L;  3GTJ K;  3HKZ D;  4QCL A;  1K83 A;  4M1X A;  3S1M K;  1XXC A;  4KM9 A;  3NUH A;  2NVT K;  3HOZ C;  1K4S A;  2JA7 A;  3T01 A;  4KN7 A;  4LOW A;  5C4J C;  4AYB A;  3TFI A;  3S2H C;  4J3N A;  3GTG K;  3S0X A;  4IP8 A;  3K7A K;  3WVO A;  4YFK A;  5IP7 C;  3A8K A;  3N0B A;  2NVX A;  1EK8 A;  4G7H A;  3IPJ A;  5IYB C;  1USO A;  2V6S A;  1SFO A;  2Y3P A;  2A68 A;  4O2D A;  3K5O A;  4FXD A;  2B63 K;  3RZD K;  4QJV A;  1BDF A;  1K4T A;  4EJ3 A;  4F3E A;  1O26 A;  3S1N C;  5IYD C;  2NVQ K;  5FLM C;  3GSI A;  3S1R C;  5C3E K;  3CQZ C;  1VJE A;  4BKW A;  2YU9 K;  3HKZ A;  4A3F C;  4GTB A;  3LAJ A;  1WOS A;  4O26 A;  4A3I C;  2O5J A;  3GTK C;  4ZH4 A;  4C3J C;  4A3E K;  2YU9 A;  1TWH C;  1YNN A;  1TWF A;  4FM9 A;  2PMZ L;  1ISE A;  1IL2 A;  3HKZ L;  5TJ3 A;  3EQL A;  3S1Q C;  2E2H C;  2E2J C;  1VLO A;  4X6A C;  2R92 A;  3WOD A;  5L46 A;  3AD8 C;  3DU5 A;  1XXB A;  4Y7N K;  1SMY A;  4GTF A;  3GTP C;  3HOY K;  3S17 C;  3S15 C;  1WQF A;  3HOX K;  1J6X A;  1ZYR A;  2R92 K;  2BE5 A;  3GIR A;  4GT9 A;  1I6V A;  4BBR K;  1SFO C;  1Y1W A;  3H0G C;  5IYD K;  5C44 C;  3BUE A;  3P9A A;  3CAG A;  1TGO A;  4FGU A;  3IAY A;  2WAQ D;  3RZD C;  3AH5 A;  1WQG A;  1TWH K;  1ZVU A;  2P8T A;  5TMF A;  1O2A A;  3A8I A;  1DCO A;  2V6U A;  3FOE A;  4MQ9 A;  5JFE A;  5D4D A;  1Y69 8;  2V6T A;  4A3K C;  1TWH A;  5FJ8 K;  3GTL C;  5JVO A;  1XZQ B;  4KMU A;  4OIN A;  3CQZ K;  1EH1 A;  4JLR C;  2B9S B;  4WJ4 A;  4BBS K;  5FLM K;  1I6H K;  3HOW C;  4OIQ A;  1RR8 C;  1I3Q K;  1TWC C;  1Y1V A;  4RMF A;  3BP8 C;  4KAR A;  1DCH A;  5EGE A;  4LK1 A;  4YFX A;  3AD9 C;  3GDZ A;  2PPB A;  1V9M A;  2R7Z K;  5IYB K;  1TWC K;  3ORE A;  4KMH A;  3T02 A;  2XCR B;  3V4G A;  4A3D C;  5M5W K;  1EFW A;  4A3C K;  1F9N A;  2Y0S L;  1J6W A;  3M3Y C;  3K5M A;  5CQG A;  3BP3 A;  3FHZ A;  2R7Z A;  4P5B A;  2R93 A;  3GTQ K;  2WAQ A;  2GSU A;  2NVX C;  4Q5V A;  4MEY A;  3HOZ K;  1PJ6 A;  1R5Z A;  3PO2 K;  1I6V D;  1ZYR D;  2A69 A;  1SMY D;  4QIW A;  3FKI K;  1XZP A;  1IS1 A;  4XSX A;  3JST A;  5M3M K;  5M3F K;  3S16 K;  4BBR C;  3PO3 C;  1EJ9 A;  3GTL K;  4Y7N C;  1TWG K;  2CFA B;  3H3V D;  3TFJ A;  2W7V A;  1YNN D;  3H0G A;  1ZQ1 C;  1Y1W C;  1WOR A;  4D3Z A;  2PHC B;  2GAH C;  4D3Y A;  3VA7 A;  1BS2 A;  4Y52 C;  1HQM D;  1WOP A;  4QJV B;  2R4G A;  3H0G K;  1F93 A;  3GTM K;  2RGR A;  1R49 A;  4OYD B;  3FOF A;  3S15 K;  2NVY A;  3HOY C;  1O29 A;  5TMC A;  4YFN A;  4A3I K;  1T8I A;  3GTM A;  3SZZ A;  4BXX K;  3QX3 A;  4KMD A;  3MML B;  2NVY K;  3G4A A;  3S16 C;  1YCL A;  3M4O K;  5HL8 A;  4KB2 A;  3L4K A;  3GEH A;  4KAW X;  3L4J A;  3GTK A;  4A3L K;  1BJT A;  3SZY A;  4QIW L;  4A3E C;  2JA5 K;  3LF9 A;  3N3Y A;  4WIL A;  1UV7 A;  4KDD A;  3OPF A;  1WCM C;  5EGH A;  1IBA A;  1L0W A;  4YG2 A;  5C4X C;  1GE9 A;  2JA5 A;  1JVI A;  3M4A A;  4A3C C;  1A35 A;  3OEP A;  3S1R K;  4H3T A;  3GTO A;  3FKI C;  1KQ4 A;  3AQP A;  2NVT C;  5CJ9 A;  3HXA A;  4C3I K;  4BY1 C;  4LR2 A;  1I50 C;  3S2D C;  2B63 C;  2PMZ D;  2A6H D;  2R93 C;  3GTJ C;  1O27 A;  4GTD A;  3GTG A;  4OIP A;  4KC6 A;  4C3H K;  3I4N K;  2XCQ A;  4XSZ A;  2NVX K;  1ZXO A;  1XPP A;  2PA8 D;  1ZBS A;  1IE0 A;  1B4A A;  4BLA A;  4C45 A;  4G7Z A;  2E2I C;  4A3K K;  1Y1V C;  1Q8I A;  4Q5S A;  1WCM K;  1J6V A;  5C4J K;  4AYB L;  4ILD A;  1HI9 A;  1RRJ A;  4LQY A;  2ZUF A;  4PAB A;  3I4M K;  3N0C A;  2P5M A;  4LK0 A;  4KM8 A;  3Q3Q A;  1WCM A;  4A3J C;  4A93 C;  4C3I C;  5IYC K;  4BY1 K;  1I3Q C;  3ERE D;  4AHC A;  1PJ7 A;  3T00 A;  4A3M C;  1SFO K;  4MEX A;  1R9T A;  1XXA A;  2B63 A;  2JA8 K;  5CHP A;  1O2B A;  2A6H A;  3GTP K;  1TWF K;  3RZO K;  1LPQ A;  3GTO C;  1F7U A;  1O25 A;  4KN4 A;  1SC7 A;  1R9T K;  2XCO A;  2E2J K;  3GTP A;  2KWA A;  4JK1 A;  3G4C A;  4A3G K;  4LLG A;  4Q4Z A;  3SJR A;  1A31 A;  2R92 C;  3K57 A;  3HOX C;  1NH3 A;  3S17 K;  5MLC 9;  1R9T C;  3KYL A;  1TWG C;  4XCH A;  1JQW A;  1TWF C;  5JSN B;  4PAA A;  2ZUE A;  5IP9 K;  1TWA A;  4G0V A;  4FZB A;  2ZFZ A;  4OIR A;  1WSR A;  1YNJ D;  1XZQ A;  5M5Y K;  5C9H A;  4A3G C;  4AYB D;  1BGW A;  4Y52 K;  1PJ5 A;  3LAP A;  1TWA K;  2BE5 D;  1X31 C;  3I4M C;  3LPX A;  4C3J K;  2F4Q A;  4LMO A;  2WB1 L;  3GEE A;  4DDQ A;  1Y1W K;  3CQZ A;  4NOM A;  1INN A;  4NOL A;  1YX2 A;  1HQM A;  4P9S A;  3RZO C;  2JH3 A;  5IP7 K;  3GTQ C;  1Y1V K;  3GTG C;  5IOQ A;  3PO3 K;  1I50 A;  4A3M K;  2NVQ C;  3AD7 C;  1VRQ C;  2A6E A;  3I4N C;  4P5A A;  5IYC C;  1TL8 A;  4G0U A;  1V5V A;  2R7Z C;  3S1M C;  3GEI A;  4GTC A;  1I50 K;  3S2D K;  2VUM K;  2Y0S D;  2JA7 C;  3PO2 C;  1I3Q A;  3GTQ A;  4NOK A;  4GTL A;  1I6H C;  1K83 C;  1C0A A;  4QIW D;  2CW0 A;  3HOU K;  3K7A C;  2VUM A;  2A69 D;  2EBB A;  3HOU C;  1TWC A;  1WIH A;  4IP9 A;  1J98 A;  4C3H C;  1EI6 A;  2A68 D;  1YNJ A; 
#chains in the Genus database with same CATH homology
 2Y3P A;  2P5M A;  3K5O A;  4FXD A;  3Q3Q A;  4KM8 A;  1SMY D;  1WCM A;  1WQH A;  4QIW A;  3K58 A;  4L8I A;  1K4T A;  4C3I C;  4EJ3 A;  4F3E A;  1O26 A;  1TWG A;  1IS1 A;  4AHC A;  3ERE D;  4Q5G A;  1R9T A;  4C2M C;  1XXA A;  2B63 A;  1EJ9 A;  4BKW A;  5CHP A;  3HKZ A;  1O2B A;  5IOS A;  4GTB A;  3LAJ A;  4O26 A;  3FKI A;  1LPQ A;  5JSB B;  1O25 A;  2CFA B;  1SC7 A;  4KMA A;  1B4B A;  4C3J C;  1YNN D;  3H0G A;  2XCO A;  2YU9 A;  3GTL A;  4D3Z A;  3GTP A;  3K59 A;  2PHC B;  4GFQ A;  4D3Y A;  2KWA A;  1TWF A;  4FM9 A;  3VA7 A;  1DD5 A;  1ISE A;  1O24 A;  1HQM D;  1MIU A;  3DU6 A;  3K5L A;  3G4C A;  2R4G A;  1SEU A;  5TJ3 A;  3SJR A;  4KAT A;  1R49 A;  4AN8 A;  1A31 A;  2RGR A;  4OYD B;  3K57 A;  4KAS A;  3FOF A;  2GSO A;  1NH3 A;  2R92 A;  5MLC 9;  2NVY A;  1AB4 A;  1O29 A;  2RH6 A;  3KYL A;  3DU5 A;  1T8I A;  3GTM A;  4GTA A;  1XXB A;  5JSN B;  4GTF A;  3QX3 A;  4KMD A;  1TWA A;  4G0V A;  3AQO A;  1WQF A;  4FZB A;  2ZFZ A;  3MML B;  1YNJ D;  2CFA A;  4GT9 A;  3G4A A;  2CW0 D;  5IOR A;  1Y1W A;  4KB4 A;  4FYD A;  5C9H A;  4G0W A;  1BGW A;  4KB2 A;  1O28 A;  3BUE A;  4GTE A;  3L4K A;  3P9A A;  3MAQ A;  1TGO A;  4FGU A;  3CAG A;  4KAW X;  3IAY A;  3GTK A;  3LAP A;  2JA6 A;  3L4J A;  2BE5 D;  2Y0S A;  2WB1 A;  3AH5 A;  1WQG A;  1A36 A;  2E2H A;  1BJT A;  1ZVU A;  2E2I A;  1O2A A;  2F4Q A;  4LMO A;  3LPX A;  4DDQ A;  3FOE A;  3CQZ A;  4C2M A;  4NOM A;  3LF9 A;  3N3Y A;  1IW7 D;  4NOL A;  4KDD A;  3K5N A;  3LHP S;  5JFE A;  3OPF A;  1Y69 8;  5EGH A;  2JH3 A;  2A6E D;  5IOT A;  1TWH A;  5JVO A;  5IOQ A;  1GE9 A;  2PMZ A;  3GTJ A;  2JA5 A;  1EH1 A;  3M4A A;  2GSN A;  4JLR C;  2B9S B;  1A35 A;  3OEP A;  4H3T A;  1I50 A;  3GTO A;  1KQ4 A;  1RR8 C;  3AQP A;  4P5A A;  5CJ9 A;  1TL8 A;  1Y1V A;  2O5J D;  4G0U A;  4LR2 A;  4BLB A;  4KAR A;  5EGE A;  2A6H D;  4GTC A;  4QCL A;  1O27 A;  1K83 A;  4GTD A;  4M1X A;  3GTG A;  1V9M A;  4KC6 A;  1XXC A;  4KM9 A;  3NUH A;  1I3Q A;  3GTQ A;  3ORE A;  1K4S A;  2JA7 A;  4NOK A;  2XCQ A;  4KMH A;  2XCR B;  4GTL A;  3V4G A;  4AYB A;  1F9N A;  1ZXO A;  4J3N A;  3K5M A;  5CQG A;  1ZBS A;  2VUM A;  2A69 D;  1B4A A;  2R7Z A;  4IP8 A;  4BLA A;  3S0X A;  3FHZ A;  4P5B A;  3WVO A;  2R93 A;  1TWC A;  1WIH A;  1Q8I A;  2WAQ A;  4IP9 A;  2GSU A;  3N0B A;  4Q5V A;  2NVX A;  4ILD A;  4C3H C;  1EK8 A;  1R5Z A;  1RRJ A;  1I6V D;  4LQY A;  2A68 D;  1SFO A;  3N0C A;  1ZYR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...