1WQFA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Ribosome recycling factor
publication title X-ray structural studies of Mycobacterium tuberculosis RRF and a comparative study of RRFs of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 62
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqfA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqfA02
4L8IA 3LF9A 4JLRC 3OREA 2RGRA 5MLC9 1ZVUA 4G0WA 1EH1A 4GFQA 5JSBB 4G0VA 5JVOA 2PHCB 3LHPS 3LPXA 3OPFA 3LAJA 1B4BA 3VA7A 3NUHA 3L4KA 3FOEA 1WQHA 3L4JA 4KB4A 3CAGA 4KAWX 3ERED 1DD5A 1B4AA 3QX3A 4KDDA 1BJTA 1WIHA 1XXAA 2P5MA 5CJ9A 2KWAA 2Y3PA 1ISEA 1F9NA 4OYDB 4KB2A 5JSNB 2XCRB 4FM9A 2XCOA 4KC6A 4DDQA 1AB4A 3OEPA 2XCQA 3FOFA 1Y698 3V4GA 1IS1A 4G0UA 1WQFA 3BUEA 1EK8A 1XXBA 3MMLB 3FHZA 3LAPA 4J3NA 2ZFZA 1WQGA 1XXCA 1BGWA 1GE9A
chains in the Genus database with same CATH superfamily
3OREA 4FGUA 1I50C 1O27A 1O2FB 1DCOA 5JSBB 1XPPA 2D6FC 4KM8A 3FKIC 4BBRC 3N0CA 5L46A 1R9TC 5C4JK 4KAWX 1J98A 2PMZL 2KWAA 2R4GA 1V9MA 2CFAB 1TWAK 4A3JC 3AD7C 2E2JC 2F4QA 3S1RK 1EK8A 1O29A 3GDZA 3GTMA 1O28A 4A3BC 4IP8A 1USMA 1UV7A 4ZH4A 5C3EC 3K5MA 1Y1VC 2RGRA 3HOWK 1WOPA 4C3HK 4QJVB 1F7UA 1O2AA 2YU9C 4A3GC 4A3MC 4A3IK 3M4AA 1VLOA 5C4JC 1WOSA 2JA7A 2NVQK 4XCHA 2XCOA 4KC6A 3OEPA 4A3CC 1TWHK 3GTKK 4Q4ZA 1TWCA 3K7AK 2B63K 4C3IK 5IYBK 2JA5A 3G4CA 5M5WK 1A35A 4X6AK 1TWGK 5EGEA 4C3HC 2E2IA 2V6TA 3HOZC 5CJ9A 4A3IC 3WVOA 5IYDK 4EJ3A 3K5NA 1I6HC 4AN8A 3GTLA 4A3LK 1A36A 4LK1A 2NVXA 4BXXC 2NVQC 4YFNA 1RR8C 3LAPA 4D3YA 1XXCA 2A69D 1SFOA 3GTOK 5IYCK 3A8IA 2B63C 3I4MK 4C2MK 1RRJA 3GTPC 1HQMD 4KN7A 2JA8K 3K58A 3LAJA 3AH5A 1JQWA 2A69A 3GSIA 2R93C 3QX3A 4GZYA 2R92A 2CW0D 3EQLA 3CQZK 2GAGC 3S1QC 4KMHA 1HQMA 1TWFA 5CHPA 3GTQC 1XZQB 3GTGK 4AYBD 1XZPA 1INNA 4MEXA 2NVTK 3TFHA 1I3QK 3S14K 3HOXK 1K83A 2CW0A 3S15C 3S1NC 4XLNA 4WJ3M 1C0AA 1GE9A 4L8IA 3K5LA 3GTOC 1KQ4A 4AYBA 1PJ6A 5JFEA 3I4MC 4C2MC 1I6VD 5IP9C 1WQHA 1R5ZA 1B4AA 1HI9A 2JA8C 4KDDA 4OINA 3S16K 1WORA 4FYDA 3PO2K 4G7ZA 3CQZC 4C3JK 2FQTA 1I6VA 5TJ3A 2A68D 2RH6A 4GTBA 3K57A 3GTMK 2GSUA 2NVTC 2PA8D 3S14C 4OIRA 4GTLA 1F93A 5M3MK 3LF9A 2JA6C 2VUMC 3H3VD 3HKZL 1IQ0A 2A68A 1EQRA 3RZDK 4BY1K 3CAGA 4MEYA 1XXAA 1LPQA 1YNJD 3TFIA 3TFJA 2JA7K 4QIWD 2NVYC 2WAQD 3Q3QA 2Y0SD 4OIQA 4O2DA 4A3FK 3BP8C 3BUEA 1Y1WC 3K5OA 1TWCK 3GTJC 3S1MK 4A3KK 4J3NA 4GTAA 1WQGA 1I50A 1YNJA 3IAYA 3HOUK 3S2DC 4O26A 4QIWA 3DU6A 3IPJA 4Y52C 3GTMC 2WAQA 3FKIA 2JA5K 2Y0SA 3T02A 1R9TA 1JVIA 2CFAA 4LR2A 3M3YK 4BY7K 3M4OK 4OIOA 2WB1D 1VJEA 2E2IK 3AQOA 4QCLA 5TMCA 3N3YA 4BY1C 5M3FK 3GTLK 3S2HK 4G7OA 3SJRA 4P9SA 4GT9A 2NVXK 3HOVK 2ZUEA 2WB1A 4LJZA 3PO3K 2P8TA 1TWAC 4WJ4A 1VGXA 4A3FC 3JSTA 1SFOK 1IW7D 1IBAA 3S1RC 1TWCC 4A93K 1SEUA 2R7ZA 3WODA 4A3KC 2YU9A 3HOUC 4NOKA 2FQOA 1EH1A 1WCMA 5JVOA 3HOWC 1IW7A 2B9SB 2R92K 3A8JA 3AD9C 4GTFA 2E2IC 3TTGA 1TWFK 4KB2A 4FM9A 1MIUA 4G0UA 2E2HA 1J6VA 3S2HC 3H0GA 1EJ9A 3HOVC 2NVXC 1K83K 1TWHC 3GTKC 3GIRA 1BGWA 3GEHA 3K7AC 1ZVUA 4C3IC 4D3ZA 5IYBC 3DXJA 3T01A 4X6AC 4Y7NK 1DCPA 1TWGC 4KATA 5C9HA 1O25A 1BS2A 2R92C 1V5VA 4A3DK 4WILA 4KM9A 5IYDC 4XSZA 5IOSA 1TWFC 2ZUFA 4A3LC 4AHCA 4KASA 3S17K 3S0XA 3GTPA 1G51A 1J6XA 5IOQA 1ZYRD 1ZXOA 2V6SA 1X31C 1SC7A 5IYCC 2R93A 4LLGA 4LMOA 2JH3A 3DU5A 5M5XK 4FZBA 1ZYRA 3GTQA 4GTEA 4GTDA 4OYDB 4F3EA 1F7VA 1IL2A 2XCQA 4AYBL 4NOMA 4KN4A 4M1XA 1Q8IA 1I50K 3HXAA 3GTGC 3FKIK 3S17C 1I3QC 4P5BA 3HOXC 1R9TK 5MLC9 4KMDA 3MAQA 3LHPS 1J6WA 5D4DA 3L4KA 4GTCA 2E2JK 2PMZD 2Y3PA 5CQGA 3V4GA 3S16C 4KMUA 3PO2C 4RMFA 4P5AA 4C3JC 5M5YK 2PMZA 2JA6A 2O5IA 2VUMA 2PA8L 2R7ZK 3FOFA 1WSRA 2YU9K 4A3GK 1VH2A 3SZZA 4JLRC 4A3MK 3H3VL 4XSXA 1WCMK 3RZOK 1YX2A 2W7VA 5HL8A 5IORA 3OPFA 4G7HA 3FOEA 3P9AA 4NOIA 1DD5A 2NVYA 3RZDC 1RU0A 2GSNA 4A3CK 4QIWL 3SZYA 4A3EK 2WAQL 1Y1WA 2Y0SL 4Q5VA 3GTJA 4LOWA 4C45A 2E2HK 1Y698 1IS1A 4BKWA 4PABA 3H0GK 1WQFA 2JA7C 3KYLA 4QJVA 1ZQ1C 3MMLB 3FHZA 3AD8C 3AQPA 1ZBSA 1Y1VA 1R49A 3S1MC 2R7ZC 4PAAA 3HOZK 2GAHC 1T8IA 3GEIA 1O2BA 2WB1L 2JA5C 4NOLA 3VA7A 1WCMC 3RZOC 3NUHA 1I6HK 3M3YC 5FJ8K 4BY7C 1JOEA 1BJTA 1WIHA 2P5MA 4ILDA 1USOA 4AH6A 4MQ9A 3M4OC 4BXXK 1O26A 3T00A 1TWAA 5IOTA 4A3EC 4YFKA 4LK0A 4BLBA 4LQYA 3GTLC 2E2HC 1DCHA 3GTPK 3H0GC 3PO3C 4H3TA 1SFOC 3N0BA 4GFQA 4A93C 4G0VA 4BBSK 2R93K 3A8KA 1B4BA 3S1QK 3L4JA 4YG2A 3GTQK 1A31A 1ISEA 1K4TA 5JSNB 4KMAA 5IP7K 4DDQA 1AB4A 3S15K 3HOYK 3S1NK 1TWHA 3GTKA 1VRQC 5EGHA 2ZFZA 2B63A 5C4XK 1YNND 2GSOA 1K83C 5IP9K 1XZPB 4KARA 2PHCB 1BDFA 1IE0A 4XLPA 1TWGA 1XZQA 4BBSC 4KB4A 3ERED 3I4NK 1YNNA 4YFXA 1F9NA 5C44K 5E68A 5FLMK 1K4SA 1SMYD 1WSVA 4Y7NC 3ADAC 1TGOA 3G4AA 5IP7C 4A3DC 3HOYC 2JA6K 2V6UA 2A6HD 2VUMK 1WOOA 3GTOA 3GEEA 2EBBA 2BE5D 1SMYA 4BBRK 4C2MA 5TMFA 4BLAA 5C4XC 4G0WA 4Q5GA 1NH3A 2PPBA 3HKZD 3LPXA 1PJ7A 2A6HA 2NVYK 2A6ED 4A3JK 2BE5A 3CQZA 1EI6A 3BP3A 2O5JD 3I4NC 4Q5SA 4FXDA 1Y1WK 3K59A 2XCRB 3GTJK 3HKZA 1EFWA 5C44C 3GTGA 5FLMC 3S2DK 4IP9A 4A3BK 4Y52K 1PJ5A 2A6EA 1XXBA 5C3EK 1TL8A 1I3QA 1YCLA 1O24A 1Y1VK 4JK1A 2O5JA 4OIPA 1L0WA
chains in the Genus database with same CATH topology
4L8IA 4FGUA 3K5LA 3OREA 1O27A 1KQ4A 4AYBA 1ZVUA 4C3IC 5JSBB 4KM8A 1T8IA 4D3ZA 4C2MC 1O2BA 5JFEA 3N0CA 4NOLA 3VA7A 1I6VD 3NUHA 1WQHA 1R5ZA 4KAWX 1B4AA 4KDDA 1BJTA 1WIHA 2P5MA 5C9HA 1O25A 4ILDA 2KWAA 4KATA 2R4GA 4FYDA 1O26A 1V9MA 2CFAB 1TWAA 5IOTA 4KM9A 2F4QA 5IOSA 1EK8A 4BLBA 4LQYA 1O29A 5TJ3A 2A68D 4AHCA 4KASA 2RH6A 4GTBA 3K57A 3S0XA 3GTPA 3GTMA 1O28A 2GSUA 4H3TA 4IP8A 5IOQA 1ZYRD 1ZXOA 3K5MA 4GTLA 3LF9A 2RGRA 3N0BA 1SC7A 4GFQA 4G0VA 2R93A 1O2AA 4LMOA 1B4BA 3M4AA 2JH3A 3L4JA 3CAGA 3DU5A 4FZBA 1XXAA 1LPQA 1A31A 3GTQA 1YNJD 4GTEA 1ISEA 1K4TA 4GTDA 2JA7A 4OYDB 5JSNB 4KMAA 4F3EA 3Q3QA 2XCOA 4KC6A 4DDQA 1AB4A 3OEPA 2XCQA 4NOMA 3BUEA 1TWHA 3GTKA 3K5OA 4M1XA 1TWCA 5EGHA 1Q8IA 4J3NA 2ZFZA 1WQGA 1I50A 2B63A 4GTAA 3IAYA 4O26A 1YNND 3DU6A 4QIWA 2GSOA 2WAQA 3FKIA 4P5BA 2Y0SA 2JA5A 3G4CA 5MLC9 4KMDA 1R9TA 2CFAA 4LR2A 3MAQA 1A35A 4KARA 2PHCB 3LHPS 5EGEA 1TWGA 4C3HC 3L4KA 4KB4A 2E2IA 3ERED 3AQOA 4QCLA 4GTCA 5CJ9A 3WVOA 3N3YA 4EJ3A 2Y3PA 3K5NA 5CQGA 4AN8A 1F9NA 3GTLA 1K4SA 1A36A 1SMYD 3SJRA 4GT9A 2NVXA 3V4GA 2WB1A 3G4AA 1TGOA 4P5AA 4C3JC 1RR8C 3LAPA 4D3YA 1XXCA 2A6HD 2PMZA 1IW7D 2A69D 2JA6A 1SFOA 2VUMA 3GTOA 1SEUA 2R7ZA 3FOFA 2BE5D 1RRJA 4JLRC 4C2MA 2YU9A 4BLAA 4NOKA 4G0WA 1EH1A 1HQMD 4Q5GA 1WCMA 1NH3A 5JVOA 3LPXA 5IORA 3K58A 3OPFA 3LAJA 3AH5A 3FOEA 3P9AA 2B9SB 1DD5A 2A6ED 3QX3A 2NVYA 2R92A 2CW0D 3CQZA 2GSNA 4GTFA 2O5JD 4KMHA 4FXDA 3K59A 4KB2A 4FM9A 1Y1WA 1TWFA 2XCRB 1MIUA 4Q5VA 3GTJA 3HKZA 5CHPA 2E2HA 4G0UA 1Y698 1IS1A 4BKWA 3GTGA 1WQFA 3H0GA 4IP9A 3KYLA 1EJ9A 1XXBA 3MMLB 1TL8A 1I3QA 1K83A 3AQPA 3FHZA 1ZBSA 1O24A 1Y1VA 1R49A 1BGWA 1GE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8I A;  3LF9 A;  4JLR C;  3ORE A;  2RGR A;  5MLC 9;  1ZVU A;  4G0W A;  1EH1 A;  4GFQ A;  5JSB B;  4G0V A;  5JVO A;  2PHC B;  3LHP S;  3LPX A;  3OPF A;  3LAJ A;  1B4B A;  3VA7 A;  3NUH A;  3L4K A;  3FOE A;  1WQH A;  3L4J A;  4KB4 A;  3CAG A;  4KAW X;  3ERE D;  1DD5 A;  1B4A A;  3QX3 A;  4KDD A;  1BJT A;  1WIH A;  1XXA A;  2P5M A;  5CJ9 A;  2KWA A;  2Y3P A;  1ISE A;  1F9N A;  4OYD B;  4KB2 A;  5JSN B;  2XCR B;  4FM9 A;  2XCO A;  4KC6 A;  4DDQ A;  1AB4 A;  3OEP A;  2XCQ A;  3FOF A;  1Y69 8;  3V4G A;  1IS1 A;  4G0U A;  1WQF A;  3BUE A;  1EK8 A;  1XXB A;  3MML B;  3FHZ A;  3LAP A;  4J3N A;  2ZFZ A;  1WQG A;  1XXC A;  1BGW A;  1GE9 A; 
#chains in the Genus database with same CATH topology
 3ORE A;  4FGU A;  1I50 C;  1O27 A;  1O2F B;  1DCO A;  5JSB B;  1XPP A;  2D6F C;  4KM8 A;  3FKI C;  4BBR C;  3N0C A;  5L46 A;  1R9T C;  5C4J K;  4KAW X;  1J98 A;  2PMZ L;  2KWA A;  2R4G A;  1V9M A;  2CFA B;  1TWA K;  4A3J C;  3AD7 C;  2E2J C;  2F4Q A;  3S1R K;  1EK8 A;  1O29 A;  3GDZ A;  3GTM A;  1O28 A;  4A3B C;  4IP8 A;  1USM A;  1UV7 A;  4ZH4 A;  5C3E C;  3K5M A;  1Y1V C;  2RGR A;  3HOW K;  1WOP A;  4C3H K;  4QJV B;  1F7U A;  1O2A A;  2YU9 C;  4A3G C;  4A3M C;  4A3I K;  3M4A A;  1VLO A;  5C4J C;  1WOS A;  2JA7 A;  2NVQ K;  4XCH A;  2XCO A;  4KC6 A;  3OEP A;  4A3C C;  1TWH K;  3GTK K;  4Q4Z A;  1TWC A;  3K7A K;  2B63 K;  4C3I K;  5IYB K;  2JA5 A;  3G4C A;  5M5W K;  1A35 A;  4X6A K;  1TWG K;  5EGE A;  4C3H C;  2E2I A;  2V6T A;  3HOZ C;  5CJ9 A;  4A3I C;  3WVO A;  5IYD K;  4EJ3 A;  3K5N A;  1I6H C;  4AN8 A;  3GTL A;  4A3L K;  1A36 A;  4LK1 A;  2NVX A;  4BXX C;  2NVQ C;  4YFN A;  1RR8 C;  3LAP A;  4D3Y A;  1XXC A;  2A69 D;  1SFO A;  3GTO K;  5IYC K;  3A8I A;  2B63 C;  3I4M K;  4C2M K;  1RRJ A;  3GTP C;  1HQM D;  4KN7 A;  2JA8 K;  3K58 A;  3LAJ A;  3AH5 A;  1JQW A;  2A69 A;  3GSI A;  2R93 C;  3QX3 A;  4GZY A;  2R92 A;  2CW0 D;  3EQL A;  3CQZ K;  2GAG C;  3S1Q C;  4KMH A;  1HQM A;  1TWF A;  5CHP A;  3GTQ C;  1XZQ B;  3GTG K;  4AYB D;  1XZP A;  1INN A;  4MEX A;  2NVT K;  3TFH A;  1I3Q K;  3S14 K;  3HOX K;  1K83 A;  2CW0 A;  3S15 C;  3S1N C;  4XLN A;  4WJ3 M;  1C0A A;  1GE9 A;  4L8I A;  3K5L A;  3GTO C;  1KQ4 A;  4AYB A;  1PJ6 A;  5JFE A;  3I4M C;  4C2M C;  1I6V D;  5IP9 C;  1WQH A;  1R5Z A;  1B4A A;  1HI9 A;  2JA8 C;  4KDD A;  4OIN A;  3S16 K;  1WOR A;  4FYD A;  3PO2 K;  4G7Z A;  3CQZ C;  4C3J K;  2FQT A;  1I6V A;  5TJ3 A;  2A68 D;  2RH6 A;  4GTB A;  3K57 A;  3GTM K;  2GSU A;  2NVT C;  2PA8 D;  3S14 C;  4OIR A;  4GTL A;  1F93 A;  5M3M K;  3LF9 A;  2JA6 C;  2VUM C;  3H3V D;  3HKZ L;  1IQ0 A;  2A68 A;  1EQR A;  3RZD K;  4BY1 K;  3CAG A;  4MEY A;  1XXA A;  1LPQ A;  1YNJ D;  3TFI A;  3TFJ A;  2JA7 K;  4QIW D;  2NVY C;  2WAQ D;  3Q3Q A;  2Y0S D;  4OIQ A;  4O2D A;  4A3F K;  3BP8 C;  3BUE A;  1Y1W C;  3K5O A;  1TWC K;  3GTJ C;  3S1M K;  4A3K K;  4J3N A;  4GTA A;  1WQG A;  1I50 A;  1YNJ A;  3IAY A;  3HOU K;  3S2D C;  4O26 A;  4QIW A;  3DU6 A;  3IPJ A;  4Y52 C;  3GTM C;  2WAQ A;  3FKI A;  2JA5 K;  2Y0S A;  3T02 A;  1R9T A;  1JVI A;  2CFA A;  4LR2 A;  3M3Y K;  4BY7 K;  3M4O K;  4OIO A;  2WB1 D;  1VJE A;  2E2I K;  3AQO A;  4QCL A;  5TMC A;  3N3Y A;  4BY1 C;  5M3F K;  3GTL K;  3S2H K;  4G7O A;  3SJR A;  4P9S A;  4GT9 A;  2NVX K;  3HOV K;  2ZUE A;  2WB1 A;  4LJZ A;  3PO3 K;  2P8T A;  1TWA C;  4WJ4 A;  1VGX A;  4A3F C;  3JST A;  1SFO K;  1IW7 D;  1IBA A;  3S1R C;  1TWC C;  4A93 K;  1SEU A;  2R7Z A;  3WOD A;  4A3K C;  2YU9 A;  3HOU C;  4NOK A;  2FQO A;  1EH1 A;  1WCM A;  5JVO A;  3HOW C;  1IW7 A;  2B9S B;  2R92 K;  3A8J A;  3AD9 C;  4GTF A;  2E2I C;  3TTG A;  1TWF K;  4KB2 A;  4FM9 A;  1MIU A;  4G0U A;  2E2H A;  1J6V A;  3S2H C;  3H0G A;  1EJ9 A;  3HOV C;  2NVX C;  1K83 K;  1TWH C;  3GTK C;  3GIR A;  1BGW A;  3GEH A;  3K7A C;  1ZVU A;  4C3I C;  4D3Z A;  5IYB C;  3DXJ A;  3T01 A;  4X6A C;  4Y7N K;  1DCP A;  1TWG C;  4KAT A;  5C9H A;  1O25 A;  1BS2 A;  2R92 C;  1V5V A;  4A3D K;  4WIL A;  4KM9 A;  5IYD C;  4XSZ A;  5IOS A;  1TWF C;  2ZUF A;  4A3L C;  4AHC A;  4KAS A;  3S17 K;  3S0X A;  3GTP A;  1G51 A;  1J6X A;  5IOQ A;  1ZYR D;  1ZXO A;  2V6S A;  1X31 C;  1SC7 A;  5IYC C;  2R93 A;  4LLG A;  4LMO A;  2JH3 A;  3DU5 A;  5M5X K;  4FZB A;  1ZYR A;  3GTQ A;  4GTE A;  4GTD A;  4OYD B;  4F3E A;  1F7V A;  1IL2 A;  2XCQ A;  4AYB L;  4NOM A;  4KN4 A;  4M1X A;  1Q8I A;  1I50 K;  3HXA A;  3GTG C;  3FKI K;  3S17 C;  1I3Q C;  4P5B A;  3HOX C;  1R9T K;  5MLC 9;  4KMD A;  3MAQ A;  3LHP S;  1J6W A;  5D4D A;  3L4K A;  4GTC A;  2E2J K;  2PMZ D;  2Y3P A;  5CQG A;  3V4G A;  3S16 C;  4KMU A;  3PO2 C;  4RMF A;  4P5A A;  4C3J C;  5M5Y K;  2PMZ A;  2JA6 A;  2O5I A;  2VUM A;  2PA8 L;  2R7Z K;  3FOF A;  1WSR A;  2YU9 K;  4A3G K;  1VH2 A;  3SZZ A;  4JLR C;  4A3M K;  3H3V L;  4XSX A;  1WCM K;  3RZO K;  1YX2 A;  2W7V A;  5HL8 A;  5IOR A;  3OPF A;  4G7H A;  3FOE A;  3P9A A;  4NOI A;  1DD5 A;  2NVY A;  3RZD C;  1RU0 A;  2GSN A;  4A3C K;  4QIW L;  3SZY A;  4A3E K;  2WAQ L;  1Y1W A;  2Y0S L;  4Q5V A;  3GTJ A;  4LOW A;  4C45 A;  2E2H K;  1Y69 8;  1IS1 A;  4BKW A;  4PAB A;  3H0G K;  1WQF A;  2JA7 C;  3KYL A;  4QJV A;  1ZQ1 C;  3MML B;  3FHZ A;  3AD8 C;  3AQP A;  1ZBS A;  1Y1V A;  1R49 A;  3S1M C;  2R7Z C;  4PAA A;  3HOZ K;  2GAH C;  1T8I A;  3GEI A;  1O2B A;  2WB1 L;  2JA5 C;  4NOL A;  3VA7 A;  1WCM C;  3RZO C;  3NUH A;  1I6H K;  3M3Y C;  5FJ8 K;  4BY7 C;  1JOE A;  1BJT A;  1WIH A;  2P5M A;  4ILD A;  1USO A;  4AH6 A;  4MQ9 A;  3M4O C;  4BXX K;  1O26 A;  3T00 A;  1TWA A;  5IOT A;  4A3E C;  4YFK A;  4LK0 A;  4BLB A;  4LQY A;  3GTL C;  2E2H C;  1DCH A;  3GTP K;  3H0G C;  3PO3 C;  4H3T A;  1SFO C;  3N0B A;  4GFQ A;  4A93 C;  4G0V A;  4BBS K;  2R93 K;  3A8K A;  1B4B A;  3S1Q K;  3L4J A;  4YG2 A;  3GTQ K;  1A31 A;  1ISE A;  1K4T A;  5JSN B;  4KMA A;  5IP7 K;  4DDQ A;  1AB4 A;  3S15 K;  3HOY K;  3S1N K;  1TWH A;  3GTK A;  1VRQ C;  5EGH A;  2ZFZ A;  2B63 A;  5C4X K;  1YNN D;  2GSO A;  1K83 C;  5IP9 K;  1XZP B;  4KAR A;  2PHC B;  1BDF A;  1IE0 A;  4XLP A;  1TWG A;  1XZQ A;  4BBS C;  4KB4 A;  3ERE D;  3I4N K;  1YNN A;  4YFX A;  1F9N A;  5C44 K;  5E68 A;  5FLM K;  1K4S A;  1SMY D;  1WSV A;  4Y7N C;  3ADA C;  1TGO A;  3G4A A;  5IP7 C;  4A3D C;  3HOY C;  2JA6 K;  2V6U A;  2A6H D;  2VUM K;  1WOO A;  3GTO A;  3GEE A;  2EBB A;  2BE5 D;  1SMY A;  4BBR K;  4C2M A;  5TMF A;  4BLA A;  5C4X C;  4G0W A;  4Q5G A;  1NH3 A;  2PPB A;  3HKZ D;  3LPX A;  1PJ7 A;  2A6H A;  2NVY K;  2A6E D;  4A3J K;  2BE5 A;  3CQZ A;  1EI6 A;  3BP3 A;  2O5J D;  3I4N C;  4Q5S A;  4FXD A;  1Y1W K;  3K59 A;  2XCR B;  3GTJ K;  3HKZ A;  1EFW A;  5C44 C;  3GTG A;  5FLM C;  3S2D K;  4IP9 A;  4A3B K;  4Y52 K;  1PJ5 A;  2A6E A;  1XXB A;  5C3E K;  1TL8 A;  1I3Q A;  1YCL A;  1O24 A;  1Y1V K;  4JK1 A;  2O5J A;  4OIP A;  1L0W A; 
#chains in the Genus database with same CATH homology
 4L8I A;  4FGU A;  3K5L A;  3ORE A;  1O27 A;  1KQ4 A;  4AYB A;  1ZVU A;  4C3I C;  5JSB B;  4KM8 A;  1T8I A;  4D3Z A;  4C2M C;  1O2B A;  5JFE A;  3N0C A;  4NOL A;  3VA7 A;  1I6V D;  3NUH A;  1WQH A;  1R5Z A;  4KAW X;  1B4A A;  4KDD A;  1BJT A;  1WIH A;  2P5M A;  5C9H A;  1O25 A;  4ILD A;  2KWA A;  4KAT A;  2R4G A;  4FYD A;  1O26 A;  1V9M A;  2CFA B;  1TWA A;  5IOT A;  4KM9 A;  2F4Q A;  5IOS A;  1EK8 A;  4BLB A;  4LQY A;  1O29 A;  5TJ3 A;  2A68 D;  4AHC A;  4KAS A;  2RH6 A;  4GTB A;  3K57 A;  3S0X A;  3GTP A;  3GTM A;  1O28 A;  2GSU A;  4H3T A;  4IP8 A;  5IOQ A;  1ZYR D;  1ZXO A;  3K5M A;  4GTL A;  3LF9 A;  2RGR A;  3N0B A;  1SC7 A;  4GFQ A;  4G0V A;  2R93 A;  1O2A A;  4LMO A;  1B4B A;  3M4A A;  2JH3 A;  3L4J A;  3CAG A;  3DU5 A;  4FZB A;  1XXA A;  1LPQ A;  1A31 A;  3GTQ A;  1YNJ D;  4GTE A;  1ISE A;  1K4T A;  4GTD A;  2JA7 A;  4OYD B;  5JSN B;  4KMA A;  4F3E A;  3Q3Q A;  2XCO A;  4KC6 A;  4DDQ A;  1AB4 A;  3OEP A;  2XCQ A;  4NOM A;  3BUE A;  1TWH A;  3GTK A;  3K5O A;  4M1X A;  1TWC A;  5EGH A;  1Q8I A;  4J3N A;  2ZFZ A;  1WQG A;  1I50 A;  2B63 A;  4GTA A;  3IAY A;  4O26 A;  1YNN D;  3DU6 A;  4QIW A;  2GSO A;  2WAQ A;  3FKI A;  4P5B A;  2Y0S A;  2JA5 A;  3G4C A;  5MLC 9;  4KMD A;  1R9T A;  2CFA A;  4LR2 A;  3MAQ A;  1A35 A;  4KAR A;  2PHC B;  3LHP S;  5EGE A;  1TWG A;  4C3H C;  3L4K A;  4KB4 A;  2E2I A;  3ERE D;  3AQO A;  4QCL A;  4GTC A;  5CJ9 A;  3WVO A;  3N3Y A;  4EJ3 A;  2Y3P A;  3K5N A;  5CQG A;  4AN8 A;  1F9N A;  3GTL A;  1K4S A;  1A36 A;  1SMY D;  3SJR A;  4GT9 A;  2NVX A;  3V4G A;  2WB1 A;  3G4A A;  1TGO A;  4P5A A;  4C3J C;  1RR8 C;  3LAP A;  4D3Y A;  1XXC A;  2A6H D;  2PMZ A;  1IW7 D;  2A69 D;  2JA6 A;  1SFO A;  2VUM A;  3GTO A;  1SEU A;  2R7Z A;  3FOF A;  2BE5 D;  1RRJ A;  4JLR C;  4C2M A;  2YU9 A;  4BLA A;  4NOK A;  4G0W A;  1EH1 A;  1HQM D;  4Q5G A;  1WCM A;  1NH3 A;  5JVO A;  3LPX A;  5IOR A;  3K58 A;  3OPF A;  3LAJ A;  3AH5 A;  3FOE A;  3P9A A;  2B9S B;  1DD5 A;  2A6E D;  3QX3 A;  2NVY A;  2R92 A;  2CW0 D;  3CQZ A;  2GSN A;  4GTF A;  2O5J D;  4KMH A;  4FXD A;  3K59 A;  4KB2 A;  4FM9 A;  1Y1W A;  1TWF A;  2XCR B;  1MIU A;  4Q5V A;  3GTJ A;  3HKZ A;  5CHP A;  2E2H A;  4G0U A;  1Y69 8;  1IS1 A;  4BKW A;  3GTG A;  1WQF A;  3H0G A;  4IP9 A;  3KYL A;  1EJ9 A;  1XXB A;  3MML B;  1TL8 A;  1I3Q A;  1K83 A;  3AQP A;  3FHZ A;  1ZBS A;  1O24 A;  1Y1V A;  1R49 A;  1BGW A;  1GE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...