1WQFA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
183
structure length
183
Chain Sequence
b'IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome recycling factor
publication title X-ray structural studies of Mycobacterium tuberculosis RRF and a comparative study of RRFs of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 62
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqfA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqfA02
3LF9A 1AB4A 1B4BA 1XXCA 3L4KA 3MMLB 3FHZA 3NUHA 3V4GA 2XCQA 1B4AA 3OEPA 3QX3A 4G0VA 3FOFA 3LPXA 1DD5A 4G0UA 1WIHA 2XCOA 4DDQA 3LAJA 4J3NA 4G0WA 2PHCB 2P5MA 3BUEA 1WQFA 3OREA 2RGRA 4KDDA 2Y3PA 5MLC9 1BGWA 4KC6A 4KAWX 1ZVUA 1BJTA 1EH1A 3CAGA 4JLRC 1XXAA 2KWAA 4OYDB 4KB4A 5JVOA 3FOEA 3OPFA 1WQHA 1EK8A 3LHPS 4GFQA 3LAPA 3L4JA 4KB2A 4FM9A 5JSNB 1ISEA 2ZFZA 5JSBB 3VA7A 1IS1A 1WQGA 1XXBA 1Y698 1F9NA 3ERED 1GE9A 2XCRB 5CJ9A 4L8IA
chains in the Genus database with same CATH superfamily
2GAGC 2A69D 2E2IC 3H3VL 2WB1L 2BE5A 4LMOA 1ZBSA 4XSZA 1EI6A 2XCOA 5C44K 3K57A 2PHCB 4QIWD 2O5JA 1TWCC 4A3IC 3GTKK 1A35A 1SFOK 4BXXK 1TL8A 5IYBC 3GTOA 4NOLA 2Y0SL 2V6UA 1YNJD 5IP9C 3S2DC 1TWFC 5FLMK 5TMCA 3H0GC 3CQZA 4A3CK 3GTLK 4Q5VA 2R7ZK 4AH6A 1AB4A 3GTQC 2A6HD 4C3JC 4BY7K 3I4NK 4G7ZA 2E2JC 1IW7A 3TFIA 1WOOA 4C2MC 2P5MA 4KDDA 4KM8A 1K4SA 5M5WK 2KWAA 3HKZA 4IP9A 1WQHA 3N0BA 1RRJA 2PMZL 2R93K 3VA7A 3S17C 1IS1A 2B9SB 4A3KK 3S16C 4O2DA 4O26A 1IE0A 3M4OC 2CW0D 4A3BC 4P9SA 1A36A 3V4GA 5EGHA 1TWGA 5M5XK 3HOUK 4G0VA 3A8JA 4G0UA 2R92K 1WCMA 4NOMA 1O26A 3GTGK 4D3ZA 4A3MK 4BY1K 1XPPA 3CQZC 1J6VA 4ZH4A 4KB2A 1HQMA 3JSTA 2ZFZA 2O5IA 3GTPA 4OIQA 2BE5D 1J6XA 3ERED 3LF9A 3M3YC 4IP8A 1XXCA 3K5OA 1ZQ1C 3FHZA 1I3QK 2O5JD 1ZYRD 4OINA 4AN8A 2D6FC 1PJ5A 3GTJA 4G0WA 3S2HK 3ADAC 1USMA 2E2IA 5CHPA 4A3FC 4KAWX 3MAQA 2CFAB 3FKIA 3K5LA 1YX2A 3K7AK 3RZDC 4BBSC 1K83K 1O27A 3L4JA 2NVYK 3A8IA 4A3JC 1TWCA 4Q4ZA 1IW7D 1TWGC 1WOPA 1YCLA 1XZPA 4L8IA 1TWAK 5CJ9A 2ZUFA 2NVTK 3GTMK 3PO3K 1TWFA 1Y1VC 4KMUA 3AQPA 4KM9A 4NOIA 4OIOA 3HKZD 2P8TA 3GTQA 1I50A 3RZOK 2A6EA 1L0WA 5IOSA 1I6HC 5C3EC 1JQWA 3HOXC 3S1NC 3GTPC 1A31A 2JA5K 4MEYA 1EK8A 3PO2K 3S14K 3N0CA 1ISEA 4YFNA 3Q3QA 2PA8D 4GTDA 5L46A 3K59A 4A3DC 3GTJC 2B63A 3IAYA 2R7ZA 2JA6K 2NVQC 2VUMK 3GIRA 3QX3A 3FKIC 4GTLA 1F7VA 4JK1A 2RGRA 4XLNA 1SEUA 1IQ0A 3BP3A 1HQMD 4A3EC 1ZYRA 3A8KA 1T8IA 4OIPA 5IYCC 4FZBA 5M5YK 4C3HK 1EFWA 1G51A 4KARA 5IYBK 5IP7C 5IP9K 1XZPB 5C4XC 3S2DK 2NVXK 1XZQB 3H0GK 4AYBA 1VGXA 1HI9A 1O2FB 2XCRB 1I50C 3MMLB 4C3JK 4KN4A 2WAQL 5C44C 1VJEA 3LPXA 3HOZC 1DD5A 1F93A 5EGEA 3AD9C 4DDQA 3EQLA 4C2MK 3BUEA 2V6TA 2R92A 1O25A 4X6AK 5CQGA 2WB1A 1K4TA 4LQYA 4A3GC 4KB4A 3GEIA 3OPFA 2CFAA 3LHPS 5FLMC 2B63C 1R9TK 1NH3A 1O24A 2R7ZC 3S17K 1Y698 1TGOA 1GE9A 3FOEA 4BY7C 4KATA 4Y7NK 3I4NC 2A6ED 2Y0SA 4XSXA 4QJVB 4A3BK 1B4AA 3LAJA 3HOWC 2JA8K 4QIWL 3GTOK 4WILA 5MLC9 3SZYA 1Y1VA 4LK1A 4Y52K 4D3YA 1XXAA 1Y1WK 4PAAA 3AQOA 3CQZK 2R93C 4G7OA 4GFQA 3WODA 2FQOA 1RR8C 4NOKA 1MIUA 3DU6A 2YU9A 3S1QK 2PMZA 3TTGA 2R92C 2W7VA 1EQRA 2JH3A 2JA7K 5IYDK 3OREA 3KYLA 1SC7A 3GTGC 4BY1C 4A3FK 3HOVK 4AYBD 3TFJA 5HL8A 5IOTA 3RZDK 4OIRA 4A3JK 4P5BA 1WQGA 1PJ6A 4GTBA 4A93K 1TWGK 1B4BA 4GTEA 3L4KA 1BS2A 1XZQA 1TWHA 1WCMK 3SZZA 3H3VD 1BDFA 2WB1D 3S15K 1EJ9A 4BBRC 2E2HK 3S2HC 1WIHA 3HOYC 1RU0A 3BP8C 4M1XA 2RH6A 4YFKA 1ZVUA 5C3EK 3CAGA 4ILDA 3S1NK 3GTPK 4OYDB 4C3IK 4P5AA 3S1RK 3S1MC 4MQ9A 5C4JK 4LOWA 3GTKA 4FXDA 1SFOA 2Y0SD 2YU9C 4Q5GA 3TFHA 3P9AA 5C9HA 2NVTC 4YFXA 4A3LC 1F9NA 4GTFA 4A3DK 1VRQC 4F3EA 3GTJK 3GSIA 1USOA 3GTLA 2XCQA 2NVQK 3OEPA 2E2IK 3FOFA 3RZOC 3AD7C 4QJVA 4BLAA 5TMFA 2Y3PA 4YG2A 2JA5C 4A3EK 3I4MC 2V6SA 1TWCK 5M3FK 4A3IK 4FYDA 4GZYA 3S14C 4KMDA 4G7HA 5JSNB 5JFEA 4BKWA 2EBBA 2PMZD 4Q5SA 1TWHC 3GEHA 1TWFK 5TJ3A 1R9TA 2ZUEA 2R93A 1IL2A 2JA6C 3T00A 2GSOA 2VUMC 1I50K 3GTQK 3S0XA 1O2AA 5M3MK 3HKZL 2E2JK 1PJ7A 3HOZK 1YNNA 4J3NA 1O2BA 5IOQA 2GAHC 3GTKC 3DU5A 1SFOC 4BXXC 4C3HC 4FGUA 2F4QA 4GT9A 4A3GK 1WSVA 1IBAA 3GTGA 3LAPA 4FM9A 1Y1WA 2NVXC 2B63K 5JSBB 4A3CC 3GTLC 1XXBA 4GTCA 2PA8L 2FQTA 2R4GA 1WOSA 1LPQA 3S16K 2A68D 4XLPA 1UV7A 2PPBA 3M4OK 4H3TA 3G4AA 3AH5A 4EJ3A 1DCPA 4WJ3M 1J6WA 4X6AC 1R5ZA 1I3QA 3HOWK 1J98A 3M4AA 3WVOA 2JA7A 1EH1A 1WSRA 5IORA 4JLRC 2WAQA 1SMYA 1JVIA 1KQ4A 1R9TC 3GDZA 1I6VA 4C45A 4A3KC 2GSNA 4Y7NC 1K83A 2NVYA 3T01A 3M3YK 4AHCA 3HOUC 1V5VA 1TWAA 2JA8C 3GTMA 1WORA 4KN7A 1F7UA 3GTOC 1O29A 2A69A 4Y52C 2E2HA 3K5NA 4KC6A 1BGWA 4A3MC 1Y1WC 4PABA 5E68A 5FJ8K 4QIWA 2GSUA 4BBSK 4LR2A 2JA5A 3S1QC 1YNND 4QCLA 1YNJA 1I3QC 3IPJA 1INNA 3K5MA 1C0AA 3N3YA 5IYDC 2JA7C 1Y1VK 1Q8IA 4LK0A 4BBRK 2A6HA 2JA6A 3SJRA 1WQFA 4KMAA 5D4DA 3HOYK 2A68A 1X31C 2VUMA 4KMHA 3K58A 3HOVC 1I6HK 1DCHA 3K7AC 5JVOA 1VH2A 3HOXK 1K83C 2NVYC 1DCOA 3S1MK 4KASA 4LLGA 3DXJA 4A93C 2YU9K 4XCHA 1ZXOA 1TWAC 3T02A 3GTMC 3PO3C 4MEXA 4A3LK 1VLOA 4BLBA 1WCMC 3S15C 2NVXA 3NUHA 3H0GA 2E2HC 2WAQD 1SMYD 3FKIK 2CW0A 4LJZA 3G4CA 3HXAA 1I6VD 4RMFA 1BJTA 4C3IC 4AYBL 3S1RC 1R49A 4C2MA 5C4JC 1V9MA 3I4MK 3PO2C 5IYCK 3AD8C 5IP7K 3GEEA 1TWHK 5C4XK 1JOEA 1O28A 4GTAA 4WJ4A
chains in the Genus database with same CATH topology
1LPQA 3DU6A 2A68D 2A69D 2YU9A 2PMZA 1TWFA 4H3TA 3G4AA 3AH5A 4EJ3A 3AQPA 4LMOA 1ZBSA 4KM9A 2JH3A 2XCOA 3K57A 1R5ZA 1I3QA 1I50A 3KYLA 1SC7A 3GTQA 2PHCB 3OREA 3M4AA 5IOSA 3WVOA 2JA7A 1EH1A 5IORA 1A35A 1A31A 4JLRC 2WAQA 1TL8A 3GTOA 1KQ4A 5IOTA 1EK8A 4NOLA 1YNJD 3N0CA 1ISEA 4P5BA 1WQGA 2GSNA 3CQZA 4GTBA 3Q3QA 1K83A 4Q5VA 2NVYA 4GTDA 3K59A 1AB4A 2A6HD 1B4BA 2B63A 4GTEA 4C3JC 3L4KA 3IAYA 2R7ZA 1TWHA 4AHCA 3QX3A 1TWAA 3GTMA 1EJ9A 1WIHA 4C2MC 1O29A 4GTLA 2P5MA 4M1XA 2RGRA 4KDDA 1SEUA 2RH6A 2E2HA 3K5NA 4KC6A 1HQMD 1K4SA 1BGWA 1ZVUA 4KM8A 3CAGA 1T8IA 4ILDA 2KWAA 4FZBA 3HKZA 4IP9A 4OYDB 4P5AA 4KARA 1WQHA 1O28A 3N0BA 4QIWA 1RRJA 2GSUA 3GTKA 4FXDA 1SFOA 4LR2A 4Q5GA 3VA7A 2JA5A 1IS1A 3P9AA 2B9SB 5C9HA 4AYBA 1F9NA 4GTFA 2XCRB 1YNND 4O26A 4QCLA 2CW0D 4F3EA 3MMLB 3K5MA 3GTLA 1A36A 3V4GA 5EGHA 2XCQA 1TWGA 3OEPA 3N3YA 3FOFA 3LPXA 4G0VA 1DD5A 1Q8IA 5EGEA 4G0UA 4DDQA 2JA6A 3SJRA 1WQFA 3BUEA 4KMAA 4BLAA 1WCMA 4NOMA 2Y3PA 2R92A 2VUMA 1O25A 4KMHA 5CQGA 3K58A 1O26A 2WB1A 4D3ZA 1K4TA 4LQYA 4KB4A 4FYDA 5JVOA 3OPFA 2CFAA 3LHPS 4KMDA 4KASA 4KB2A 5JSNB 2ZFZA 5JFEA 1NH3A 4BKWA 3GTPA 1O24A 2BE5D 1ZXOA 1Y698 5TJ3A 1R9TA 3ERED 1TGOA 1GE9A 3FOEA 3LF9A 4KATA 2R93A 4BLBA 4IP8A 2A6ED 1XXCA 2GSOA 2Y0SA 3K5OA 3FHZA 2NVXA 2O5JD 1ZYRD 3H0GA 3NUHA 3S0XA 1B4AA 1O2AA 4AN8A 1SMYD 3GTJA 4G0WA 3LAJA 4J3NA 1O2BA 3G4CA 5IOQA 2E2IA 5CHPA 1I6VD 5MLC9 4KAWX 3MAQA 2CFAB 1Y1VA 3DU5A 1BJTA 4D3YA 4C3IC 3FKIA 4C3HC 4FGUA 1R49A 4C2MA 1XXAA 2F4QA 1V9MA 3K5LA 3AQOA 4GT9A 3GTGA 1O27A 4GFQA 3LAPA 3L4JA 1Y1WA 4FM9A 1RR8C 1TWCA 4NOKA 5JSBB 1XXBA 4GTCA 1IW7D 1MIUA 2R4GA 4GTAA 5CJ9A 4L8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LF9 A;  1AB4 A;  1B4B A;  1XXC A;  3L4K A;  3MML B;  3FHZ A;  3NUH A;  3V4G A;  2XCQ A;  1B4A A;  3OEP A;  3QX3 A;  4G0V A;  3FOF A;  3LPX A;  1DD5 A;  4G0U A;  1WIH A;  2XCO A;  4DDQ A;  3LAJ A;  4J3N A;  4G0W A;  2PHC B;  2P5M A;  3BUE A;  1WQF A;  3ORE A;  2RGR A;  4KDD A;  2Y3P A;  5MLC 9;  1BGW A;  4KC6 A;  4KAW X;  1ZVU A;  1BJT A;  1EH1 A;  3CAG A;  4JLR C;  1XXA A;  2KWA A;  4OYD B;  4KB4 A;  5JVO A;  3FOE A;  3OPF A;  1WQH A;  1EK8 A;  3LHP S;  4GFQ A;  3LAP A;  3L4J A;  4KB2 A;  4FM9 A;  5JSN B;  1ISE A;  2ZFZ A;  5JSB B;  3VA7 A;  1IS1 A;  1WQG A;  1XXB A;  1Y69 8;  1F9N A;  3ERE D;  1GE9 A;  2XCR B;  5CJ9 A;  4L8I A; 
#chains in the Genus database with same CATH topology
 2GAG C;  2A69 D;  2E2I C;  3H3V L;  2WB1 L;  2BE5 A;  4LMO A;  1ZBS A;  4XSZ A;  1EI6 A;  2XCO A;  5C44 K;  3K57 A;  2PHC B;  4QIW D;  2O5J A;  1TWC C;  4A3I C;  3GTK K;  1A35 A;  1SFO K;  4BXX K;  1TL8 A;  5IYB C;  3GTO A;  4NOL A;  2Y0S L;  2V6U A;  1YNJ D;  5IP9 C;  3S2D C;  1TWF C;  5FLM K;  5TMC A;  3H0G C;  3CQZ A;  4A3C K;  3GTL K;  4Q5V A;  2R7Z K;  4AH6 A;  1AB4 A;  3GTQ C;  2A6H D;  4C3J C;  4BY7 K;  3I4N K;  4G7Z A;  2E2J C;  1IW7 A;  3TFI A;  1WOO A;  4C2M C;  2P5M A;  4KDD A;  4KM8 A;  1K4S A;  5M5W K;  2KWA A;  3HKZ A;  4IP9 A;  1WQH A;  3N0B A;  1RRJ A;  2PMZ L;  2R93 K;  3VA7 A;  3S17 C;  1IS1 A;  2B9S B;  4A3K K;  3S16 C;  4O2D A;  4O26 A;  1IE0 A;  3M4O C;  2CW0 D;  4A3B C;  4P9S A;  1A36 A;  3V4G A;  5EGH A;  1TWG A;  5M5X K;  3HOU K;  4G0V A;  3A8J A;  4G0U A;  2R92 K;  1WCM A;  4NOM A;  1O26 A;  3GTG K;  4D3Z A;  4A3M K;  4BY1 K;  1XPP A;  3CQZ C;  1J6V A;  4ZH4 A;  4KB2 A;  1HQM A;  3JST A;  2ZFZ A;  2O5I A;  3GTP A;  4OIQ A;  2BE5 D;  1J6X A;  3ERE D;  3LF9 A;  3M3Y C;  4IP8 A;  1XXC A;  3K5O A;  1ZQ1 C;  3FHZ A;  1I3Q K;  2O5J D;  1ZYR D;  4OIN A;  4AN8 A;  2D6F C;  1PJ5 A;  3GTJ A;  4G0W A;  3S2H K;  3ADA C;  1USM A;  2E2I A;  5CHP A;  4A3F C;  4KAW X;  3MAQ A;  2CFA B;  3FKI A;  3K5L A;  1YX2 A;  3K7A K;  3RZD C;  4BBS C;  1K83 K;  1O27 A;  3L4J A;  2NVY K;  3A8I A;  4A3J C;  1TWC A;  4Q4Z A;  1IW7 D;  1TWG C;  1WOP A;  1YCL A;  1XZP A;  4L8I A;  1TWA K;  5CJ9 A;  2ZUF A;  2NVT K;  3GTM K;  3PO3 K;  1TWF A;  1Y1V C;  4KMU A;  3AQP A;  4KM9 A;  4NOI A;  4OIO A;  3HKZ D;  2P8T A;  3GTQ A;  1I50 A;  3RZO K;  2A6E A;  1L0W A;  5IOS A;  1I6H C;  5C3E C;  1JQW A;  3HOX C;  3S1N C;  3GTP C;  1A31 A;  2JA5 K;  4MEY A;  1EK8 A;  3PO2 K;  3S14 K;  3N0C A;  1ISE A;  4YFN A;  3Q3Q A;  2PA8 D;  4GTD A;  5L46 A;  3K59 A;  4A3D C;  3GTJ C;  2B63 A;  3IAY A;  2R7Z A;  2JA6 K;  2NVQ C;  2VUM K;  3GIR A;  3QX3 A;  3FKI C;  4GTL A;  1F7V A;  4JK1 A;  2RGR A;  4XLN A;  1SEU A;  1IQ0 A;  3BP3 A;  1HQM D;  4A3E C;  1ZYR A;  3A8K A;  1T8I A;  4OIP A;  5IYC C;  4FZB A;  5M5Y K;  4C3H K;  1EFW A;  1G51 A;  4KAR A;  5IYB K;  5IP7 C;  5IP9 K;  1XZP B;  5C4X C;  3S2D K;  2NVX K;  1XZQ B;  3H0G K;  4AYB A;  1VGX A;  1HI9 A;  1O2F B;  2XCR B;  1I50 C;  3MML B;  4C3J K;  4KN4 A;  2WAQ L;  5C44 C;  1VJE A;  3LPX A;  3HOZ C;  1DD5 A;  1F93 A;  5EGE A;  3AD9 C;  4DDQ A;  3EQL A;  4C2M K;  3BUE A;  2V6T A;  2R92 A;  1O25 A;  4X6A K;  5CQG A;  2WB1 A;  1K4T A;  4LQY A;  4A3G C;  4KB4 A;  3GEI A;  3OPF A;  2CFA A;  3LHP S;  5FLM C;  2B63 C;  1R9T K;  1NH3 A;  1O24 A;  2R7Z C;  3S17 K;  1Y69 8;  1TGO A;  1GE9 A;  3FOE A;  4BY7 C;  4KAT A;  4Y7N K;  3I4N C;  2A6E D;  2Y0S A;  4XSX A;  4QJV B;  4A3B K;  1B4A A;  3LAJ A;  3HOW C;  2JA8 K;  4QIW L;  3GTO K;  4WIL A;  5MLC 9;  3SZY A;  1Y1V A;  4LK1 A;  4Y52 K;  4D3Y A;  1XXA A;  1Y1W K;  4PAA A;  3AQO A;  3CQZ K;  2R93 C;  4G7O A;  4GFQ A;  3WOD A;  2FQO A;  1RR8 C;  4NOK A;  1MIU A;  3DU6 A;  2YU9 A;  3S1Q K;  2PMZ A;  3TTG A;  2R92 C;  2W7V A;  1EQR A;  2JH3 A;  2JA7 K;  5IYD K;  3ORE A;  3KYL A;  1SC7 A;  3GTG C;  4BY1 C;  4A3F K;  3HOV K;  4AYB D;  3TFJ A;  5HL8 A;  5IOT A;  3RZD K;  4OIR A;  4A3J K;  4P5B A;  1WQG A;  1PJ6 A;  4GTB A;  4A93 K;  1TWG K;  1B4B A;  4GTE A;  3L4K A;  1BS2 A;  1XZQ A;  1TWH A;  1WCM K;  3SZZ A;  3H3V D;  1BDF A;  2WB1 D;  3S15 K;  1EJ9 A;  4BBR C;  2E2H K;  3S2H C;  1WIH A;  3HOY C;  1RU0 A;  3BP8 C;  4M1X A;  2RH6 A;  4YFK A;  1ZVU A;  5C3E K;  3CAG A;  4ILD A;  3S1N K;  3GTP K;  4OYD B;  4C3I K;  4P5A A;  3S1R K;  3S1M C;  4MQ9 A;  5C4J K;  4LOW A;  3GTK A;  4FXD A;  1SFO A;  2Y0S D;  2YU9 C;  4Q5G A;  3TFH A;  3P9A A;  5C9H A;  2NVT C;  4YFX A;  4A3L C;  1F9N A;  4GTF A;  4A3D K;  1VRQ C;  4F3E A;  3GTJ K;  3GSI A;  1USO A;  3GTL A;  2XCQ A;  2NVQ K;  3OEP A;  2E2I K;  3FOF A;  3RZO C;  3AD7 C;  4QJV A;  4BLA A;  5TMF A;  2Y3P A;  4YG2 A;  2JA5 C;  4A3E K;  3I4M C;  2V6S A;  1TWC K;  5M3F K;  4A3I K;  4FYD A;  4GZY A;  3S14 C;  4KMD A;  4G7H A;  5JSN B;  5JFE A;  4BKW A;  2EBB A;  2PMZ D;  4Q5S A;  1TWH C;  3GEH A;  1TWF K;  5TJ3 A;  1R9T A;  2ZUE A;  2R93 A;  1IL2 A;  2JA6 C;  3T00 A;  2GSO A;  2VUM C;  1I50 K;  3GTQ K;  3S0X A;  1O2A A;  5M3M K;  3HKZ L;  2E2J K;  1PJ7 A;  3HOZ K;  1YNN A;  4J3N A;  1O2B A;  5IOQ A;  2GAH C;  3GTK C;  3DU5 A;  1SFO C;  4BXX C;  4C3H C;  4FGU A;  2F4Q A;  4GT9 A;  4A3G K;  1WSV A;  1IBA A;  3GTG A;  3LAP A;  4FM9 A;  1Y1W A;  2NVX C;  2B63 K;  5JSB B;  4A3C C;  3GTL C;  1XXB A;  4GTC A;  2PA8 L;  2FQT A;  2R4G A;  1WOS A;  1LPQ A;  3S16 K;  2A68 D;  4XLP A;  1UV7 A;  2PPB A;  3M4O K;  4H3T A;  3G4A A;  3AH5 A;  4EJ3 A;  1DCP A;  4WJ3 M;  1J6W A;  4X6A C;  1R5Z A;  1I3Q A;  3HOW K;  1J98 A;  3M4A A;  3WVO A;  2JA7 A;  1EH1 A;  1WSR A;  5IOR A;  4JLR C;  2WAQ A;  1SMY A;  1JVI A;  1KQ4 A;  1R9T C;  3GDZ A;  1I6V A;  4C45 A;  4A3K C;  2GSN A;  4Y7N C;  1K83 A;  2NVY A;  3T01 A;  3M3Y K;  4AHC A;  3HOU C;  1V5V A;  1TWA A;  2JA8 C;  3GTM A;  1WOR A;  4KN7 A;  1F7U A;  3GTO C;  1O29 A;  2A69 A;  4Y52 C;  2E2H A;  3K5N A;  4KC6 A;  1BGW A;  4A3M C;  1Y1W C;  4PAB A;  5E68 A;  5FJ8 K;  4QIW A;  2GSU A;  4BBS K;  4LR2 A;  2JA5 A;  3S1Q C;  1YNN D;  4QCL A;  1YNJ A;  1I3Q C;  3IPJ A;  1INN A;  3K5M A;  1C0A A;  3N3Y A;  5IYD C;  2JA7 C;  1Y1V K;  1Q8I A;  4LK0 A;  4BBR K;  2A6H A;  2JA6 A;  3SJR A;  1WQF A;  4KMA A;  5D4D A;  3HOY K;  2A68 A;  1X31 C;  2VUM A;  4KMH A;  3K58 A;  3HOV C;  1I6H K;  1DCH A;  3K7A C;  5JVO A;  1VH2 A;  3HOX K;  1K83 C;  2NVY C;  1DCO A;  3S1M K;  4KAS A;  4LLG A;  3DXJ A;  4A93 C;  2YU9 K;  4XCH A;  1ZXO A;  1TWA C;  3T02 A;  3GTM C;  3PO3 C;  4MEX A;  4A3L K;  1VLO A;  4BLB A;  1WCM C;  3S15 C;  2NVX A;  3NUH A;  3H0G A;  2E2H C;  2WAQ D;  1SMY D;  3FKI K;  2CW0 A;  4LJZ A;  3G4C A;  3HXA A;  1I6V D;  4RMF A;  1BJT A;  4C3I C;  4AYB L;  3S1R C;  1R49 A;  4C2M A;  5C4J C;  1V9M A;  3I4M K;  3PO2 C;  5IYC K;  3AD8 C;  5IP7 K;  3GEE A;  1TWH K;  5C4X K;  1JOE A;  1O28 A;  4GTA A;  4WJ4 A; 
#chains in the Genus database with same CATH homology
 1LPQ A;  3DU6 A;  2A68 D;  2A69 D;  2YU9 A;  2PMZ A;  1TWF A;  4H3T A;  3G4A A;  3AH5 A;  4EJ3 A;  3AQP A;  4LMO A;  1ZBS A;  4KM9 A;  2JH3 A;  2XCO A;  3K57 A;  1R5Z A;  1I3Q A;  1I50 A;  3KYL A;  1SC7 A;  3GTQ A;  2PHC B;  3ORE A;  3M4A A;  5IOS A;  3WVO A;  2JA7 A;  1EH1 A;  5IOR A;  1A35 A;  1A31 A;  4JLR C;  2WAQ A;  1TL8 A;  3GTO A;  1KQ4 A;  5IOT A;  1EK8 A;  4NOL A;  1YNJ D;  3N0C A;  1ISE A;  4P5B A;  1WQG A;  2GSN A;  3CQZ A;  4GTB A;  3Q3Q A;  1K83 A;  4Q5V A;  2NVY A;  4GTD A;  3K59 A;  1AB4 A;  2A6H D;  1B4B A;  2B63 A;  4GTE A;  4C3J C;  3L4K A;  3IAY A;  2R7Z A;  1TWH A;  4AHC A;  3QX3 A;  1TWA A;  3GTM A;  1EJ9 A;  1WIH A;  4C2M C;  1O29 A;  4GTL A;  2P5M A;  4M1X A;  2RGR A;  4KDD A;  1SEU A;  2RH6 A;  2E2H A;  3K5N A;  4KC6 A;  1HQM D;  1K4S A;  1BGW A;  1ZVU A;  4KM8 A;  3CAG A;  1T8I A;  4ILD A;  2KWA A;  4FZB A;  3HKZ A;  4IP9 A;  4OYD B;  4P5A A;  4KAR A;  1WQH A;  1O28 A;  3N0B A;  4QIW A;  1RRJ A;  2GSU A;  3GTK A;  4FXD A;  1SFO A;  4LR2 A;  4Q5G A;  3VA7 A;  2JA5 A;  1IS1 A;  3P9A A;  2B9S B;  5C9H A;  4AYB A;  1F9N A;  4GTF A;  2XCR B;  1YNN D;  4O26 A;  4QCL A;  2CW0 D;  4F3E A;  3MML B;  3K5M A;  3GTL A;  1A36 A;  3V4G A;  5EGH A;  2XCQ A;  1TWG A;  3OEP A;  3N3Y A;  3FOF A;  3LPX A;  4G0V A;  1DD5 A;  1Q8I A;  5EGE A;  4G0U A;  4DDQ A;  2JA6 A;  3SJR A;  1WQF A;  3BUE A;  4KMA A;  4BLA A;  1WCM A;  4NOM A;  2Y3P A;  2R92 A;  2VUM A;  1O25 A;  4KMH A;  5CQG A;  3K58 A;  1O26 A;  2WB1 A;  4D3Z A;  1K4T A;  4LQY A;  4KB4 A;  4FYD A;  5JVO A;  3OPF A;  2CFA A;  3LHP S;  4KMD A;  4KAS A;  4KB2 A;  5JSN B;  2ZFZ A;  5JFE A;  1NH3 A;  4BKW A;  3GTP A;  1O24 A;  2BE5 D;  1ZXO A;  1Y69 8;  5TJ3 A;  1R9T A;  3ERE D;  1TGO A;  1GE9 A;  3FOE A;  3LF9 A;  4KAT A;  2R93 A;  4BLB A;  4IP8 A;  2A6E D;  1XXC A;  2GSO A;  2Y0S A;  3K5O A;  3FHZ A;  2NVX A;  2O5J D;  1ZYR D;  3H0G A;  3NUH A;  3S0X A;  1B4A A;  1O2A A;  4AN8 A;  1SMY D;  3GTJ A;  4G0W A;  3LAJ A;  4J3N A;  1O2B A;  3G4C A;  5IOQ A;  2E2I A;  5CHP A;  1I6V D;  5MLC 9;  4KAW X;  3MAQ A;  2CFA B;  1Y1V A;  3DU5 A;  1BJT A;  4D3Y A;  4C3I C;  3FKI A;  4C3H C;  4FGU A;  1R49 A;  4C2M A;  1XXA A;  2F4Q A;  1V9M A;  3K5L A;  3AQO A;  4GT9 A;  3GTG A;  1O27 A;  4GFQ A;  3LAP A;  3L4J A;  1Y1W A;  4FM9 A;  1RR8 C;  1TWC A;  4NOK A;  5JSB B;  1XXB A;  4GTC A;  1IW7 D;  1MIU A;  2R4G A;  4GTA A;  5CJ9 A;  4L8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...