1WQFA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome recycling factor
publication title X-ray structural studies of Mycobacterium tuberculosis RRF and a comparative study of RRFs of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 62
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqfA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqfA02
1DD5A 1WQHA 1XXAA 4DDQA 5MLC9 1F9NA 1GE9A 2XCQA 2KWAA 3MMLB 5CJ9A 3LAPA 1WIHA 4OYDB 1XXCA 3FOFA 3LAJA 3L4KA 4G0UA 1AB4A 1WQFA 1BJTA 4GFQA 3LHPS 4KC6A 4KAWX 1WQGA 2ZFZA 3OEPA 1Y698 3OREA 2RGRA 3V4GA 3L4JA 2XCRB 4G0VA 4J3NA 1EK8A 3LPXA 3FHZA 5JSBB 1ISEA 4KDDA 1IS1A 3OPFA 4JLRC 1B4BA 2XCOA 1EH1A 4KB2A 3NUHA 3ERED 2P5MA 3QX3A 1BGWA 5JVOA 2PHCB 1B4AA 4KB4A 2Y3PA 3BUEA 4L8IA 1XXBA 3LF9A 1ZVUA 3FOEA 4FM9A 5JSNB 3CAGA 4G0WA 3VA7A
chains in the Genus database with same CATH superfamily
1O29A 3EQLA 2A6HD 3N3YA 1R9TK 1EJ9A 3GTMK 4AH6A 4A3KC 1I6HK 2YU9C 3N0CA 4IP8A 3FOFA 3A8KA 1MIUA 3P9AA 1K83C 3GTGC 3GTLK 2JH3A 2JA7C 2R93K 3GTKK 2JA5C 1EFWA 1V5VA 5EGHA 1YNNA 5IP7K 3S2HK 5M3FK 5C3EC 1Y1WC 1SFOK 2P5MA 2A68D 3S1RK 5EGEA 2FQTA 4G7HA 4KARA 1XXAA 2R7ZA 3S2DK 5M5XK 2XCQA 1XZPA 1TWCC 1I3QK 1WSRA 3DU5A 4P5AA 2E2HA 1LPQA 2B63A 3OREA 3K5NA 5D4DA 5M5WK 4JK1A 1YNJA 1K4TA 2PA8D 4C2MA 1SEUA 3NUHA 4XSXA 3I4NK 2W7VA 4A3JC 1KQ4A 2WB1L 2PPBA 4KMUA 1R49A 1ZYRD 3VA7A 1XZQA 2Y0SD 3Q3QA 1TWGK 1J6WA 4A3IK 4OIQA 2A68A 4Q4ZA 4A3MK 4KAWX 3IAYA 3PO3C 3S17C 5IYCC 2R92C 1TWAK 3M3YC 4QIWL 2R7ZK 4A93K 4OIPA 1I50A 2WAQD 1TWFC 3FKIK 5L46A 4LQYA 2NVXC 3TFHA 4BBSK 2B63K 4G7OA 4GTFA 2NVQC 1X31C 3HOVC 1O26A 3GTPC 3H3VD 4C2MK 1R9TC 3GTMC 1XZPB 4YFXA 4A3BK 3LAJA 3AD9C 1BJTA 2E2IA 4X6AC 2Y0SA 4O26A 3H0GA 2CW0A 3GTLC 3KYLA 2R93C 1YX2A 5JSBB 2JA6A 1JVIA 5IORA 5IP7C 3S2HC 4QJVA 4YFNA 4GTLA 1O24A 1WOSA 3DXJA 1EH1A 1SFOC 4A3DC 4KN4A 3I4MK 3GTOK 2PMZD 4OINA 3T01A 4L8IA 5IYDK 3K59A 1O28A 4FM9A 1XZQB 1SMYA 2B9SB 2WAQA 3HOYK 3S2DC 3LAPA 2JA8K 1I3QC 4YG2A 4PABA 4IP9A 3L4JA 4BKWA 4BY1K 4KM8A 4XLNA 3K5LA 3S1MK 5C4JK 3GTJA 3GDZA 3S14K 3JSTA 3K5OA 2E2IK 4A3LC 3T00A 4Q5GA 2PHCB 4KB4A 5C44C 2FQOA 1ZVUA 2NVTK 2JA6K 1TL8A 1A31A 2P8TA 1TWGC 1GE9A 2PMZA 4OYDB 4WJ3M 4GFQA 4AYBA 4C45A 4A3MC 4AHCA 2GSOA 4ZH4A 4LJZA 3HKZD 1TWAC 2RH6A 2R7ZC 4KM9A 4QJVB 3OPFA 5CHPA 3FKIC 4NOLA 3AQPA 4A3EK 1USOA 4KASA 1TWHA 1VJEA 4KATA 4BBSC 2B63C 1VRQC 4C3IC 5JFEA 3PO2K 1VGXA 2O5JD 1BDFA 3HXAA 3GTJK 1IL2A 1WQHA 1Y1VC 4D3YA 4DDQA 5CJ9A 4NOKA 4C3JK 1A35A 4A3BC 4GT9A 4G0UA 1HQMD 1WQFA 1AB4A 4O2DA 2VUMC 4XLPA 2ZUEA 3CQZA 5CQGA 4OIRA 3SZZA 2A6HA 3G4CA 3LPXA 3A8JA 3GEIA 3HKZA 3S1QK 1K83A 1ZBSA 3GTOC 5IYDC 5JSNB 5C9HA 4J3NA 3HOYC 1F93A 3S15K 2A6ED 4KN7A 4BY7K 3L4KA 4G7ZA 2JA8C 2O5JA 5IOQA 4KMDA 3GEHA 4FZBA 3K58A 3A8IA 4KMAA 4H3TA 3SJRA 1PJ6A 2R4GA 1DCHA 2WAQL 3K5MA 4WJ4A 3S1MC 1IW7D 3AD7C 4OIOA 5M5YK 1F7UA 3S14C 5IP9K 5E68A 1HQMA 4A3GK 4MEXA 4LK1A 4MQ9A 1TWCA 1YCLA 1ZXOA 2E2HK 1BGWA 4LK0A 3CQZK 3H3VL 4EJ3A 1XXBA 3LF9A 3K7AK 2NVTC 2JA6C 1R5ZA 4Q5SA 1DD5A 4FXDA 4LLGA 1INNA 3MAQA 5IOTA 4C3HK 2CFAA 1K83K 4RMFA 1I6HC 2ZUFA 2RGRA 3HOZK 3HOWK 1ZYRA 1WORA 1WSVA 1EK8A 3G4AA 2A6EA 3AD8C 4MEYA 3GTKC 4QIWD 5C3EK 4F3EA 3N0BA 2NVYA 2GAHC 4GTCA 4A3EC 4KB2A 1V9MA 4AYBL 1J6XA 2R92A 3PO2C 1JQWA 3FOEA 2V6TA 3S1RC 4BLBA 1G51A 1I50K 1TWCK 1WIHA 3GEEA 4A3FK 5M3MK 2A69D 3K57A 3GTQA 4BBRK 4GTEA 4P9SA 1VLOA 3GTPA 5IYBK 1R9TA 3T02A 3ERED 4A3JK 3I4NC 4D3ZA 3H0GK 3BUEA 1XPPA 4QIWA 1I6VD 2NVYK 1NH3A 4Y52K 4Q5VA 4FYDA 5TMFA 4A3IC 3S15C 2CFAB 4BY7C 1IE0A 3HKZL 2R92K 3M3YK 4FGUA 3IPJA 1RR8C 1RRJA 2V6SA 1ISEA 1SC7A 4A93C 5IP9C 1JOEA 4A3GC 4LOWA 4LR2A 1I3QA 2E2HC 3GTQK 4BXXK 2NVQK 4AN8A 3ADAC 1EQRA 3RZDK 1T8IA 3S16K 4GZYA 2KWAA 3RZOK 4C2MC 1YNJD 5TMCA 3BP3A 1XXCA 4C3HC 3TFJA 1WCMA 4X6AK 2EBBA 1DCOA 3AQOA 3HOZC 1I6VA 3HOWC 2BE5D 5C4XK 2PA8L 1WOOA 1TWGA 2GSNA 4WILA 4A3DK 1PJ7A 2YU9A 5FLMK 1J98A 4NOIA 3I4MC 3GTGA 3M4OK 2Y0SL 1TWAA 2JA7A 2F4QA 2JA5A 4GTAA 4A3CK 1I50C 3FKIA 1TWHK 1EI6A 1Y1WA 3HOUK 4GTBA 3WODA 4Y7NK 3LHPS 4A3FC 2ZFZA 1Y698 3WVOA 2GAGC 4BBRC 1BS2A 2XCRB 3HOXK 2E2JK 4BY1C 1USMA 1Y1VA 5IYBC 4BLAA 1RU0A 5C4JC 4JLRC 1WCMK 1B4BA 4A3LK 3GSIA 2XCOA 3QX3A 5C44K 2BE5A 3S1NK 3SZYA 2E2IC 2VUMA 3H0GC 4YFKA 1IQ0A 1ZQ1C 2CW0D 1J6VA 2WB1D 1UV7A 2NVYC 4A3KK 3BP8C 4Y52C 2V6UA 2YU9K 4GTDA 3GTGK 3GTOA 2JA7K 2JA5K 5FJ8K 1PJ5A 1SMYD 3AH5A 1VH2A 1Y1WK 5HL8A 2PMZL 4C3IK 3M4AA 3GTQC 1B4AA 4BXXC 2Y3PA 1O27A 1IW7A 3RZDC 1Y1VK 4G0WA 3S16C 4NOMA 3GTJC 1F7VA 1F9NA 3MMLB 3RZOC 1TWFA 1O2AA 2NVXA 4ILDA 4C3JC 2VUMK 1WQGA 3OEPA 2WB1A 3V4GA 1C0AA 4M1XA 5C4XC 4KDDA 1IS1A 3GTMA 1A36A 1DCPA 5JVOA 5FLMC 3DU6A 1O2BA 3S1QC 4AYBD 3M4OC 3GTLA 1O2FB 1WOPA 3GIRA 3CAGA 3S0XA 2R93A 3GTKA 4A3CC 3TTGA 5MLC9 1HI9A 1Q8IA 1IBAA 1YNND 1TWHC 4PAAA 1SFOA 3HOUC 4KC6A 1K4SA 4Y7NC 5TJ3A 3S17K 3PO3K 2GSUA 3TFIA 5IYCK 4G0VA 2O5IA 3HOXC 2E2JC 3FHZA 1TWFK 2D6FC 2NVXK 1O25A 1TGOA 1WCMC 1L0WA 4KMHA 4P5BA 4QCLA 2A69A 4XCHA 4LMOA 3S1NC 3HOVK 3CQZC 4XSZA 3GTPK 3K7AC 5IOSA
chains in the Genus database with same CATH topology
1DD5A 4GTAA 1O29A 4FXDA 2A6HD 3N3YA 1EJ9A 3MAQA 3FKIA 5IOTA 3LAPA 3N0CA 4IP8A 1Y1WA 3FOFA 2CFAA 4GTBA 1MIUA 3P9AA 3LHPS 4IP9A 2ZFZA 1Y698 2RGRA 3WVOA 3L4JA 4BKWA 2JH3A 2XCRB 4KM8A 1EK8A 3K5LA 3G4AA 1Y1VA 3GTJA 4BLAA 5EGHA 4F3EA 3N0BA 2NVYA 4KMAA 4JLRC 1B4BA 4GTCA 2XCOA 4KB2A 3K5OA 2P5MA 3QX3A 1V9MA 4Q5GA 2PHCB 2A68D 4KB4A 2R92A 2VUMA 1ZVUA 3FOEA 2CW0D 5EGEA 1TL8A 1A31A 4BLBA 4KARA 1XXAA 2R7ZA 1GE9A 2XCQA 2PMZA 1WIHA 4OYDB 4P5AA 3DU5A 2E2HA 1LPQA 4GTDA 4GFQA 4AYBA 3GTOA 2B63A 2A69D 4AHCA 3K57A 3GTQA 2GSOA 3OREA 4GTEA 3K5NA 2RH6A 3GTPA 1SMYD 3AH5A 4KM9A 1R9TA 3OPFA 1K4TA 5CHPA 4C2MA 4NOLA 3AQPA 4KATA 4KASA 1TWHA 1SEUA 3NUHA 3ERED 3M4AA 1B4AA 4C3IC 2Y3PA 4D3ZA 1KQ4A 5JFEA 3BUEA 2O5JD 4QIWA 1O27A 1R49A 1ZYRD 4G0WA 3VA7A 1WQHA 4NOMA 1I6VD 4D3YA 3Q3QA 1NH3A 4DDQA 1F9NA 5CJ9A 4Q5VA 4NOKA 4FYDA 3MMLB 1TWFA 1O2AA 1A35A 2CFAB 2NVXA 4ILDA 4GT9A 4C3JC 4G0UA 1HQMD 1WQFA 1AB4A 4KAWX 1WQGA 3IAYA 3OEPA 2WB1A 3V4GA 4FGUA 3CQZA 5CQGA 3G4CA 3LPXA 1RR8C 5IOSA 4M1XA 1RRJA 1ISEA 4KDDA 1SC7A 1IS1A 1I50A 3GTMA 1A36A 4LQYA 4LR2A 1I3QA 3HKZA 5JVOA 1K83A 1ZBSA 3DU6A 1O2BA 4GTFA 4AN8A 3GTLA 5JSNB 5C9HA 3CAGA 4J3NA 1T8IA 2R93A 1O26A 3GTKA 3S0XA 5MLC9 2KWAA 1Q8IA 2A6ED 4C2MC 1YNJD 4C3HC 1XXCA 1YNND 3L4KA 3LAJA 1WCMA 1SFOA 5IOQA 1BJTA 4FZBA 4KC6A 3K58A 1K4SA 4KMDA 2E2IA 4H3TA 3SJRA 2Y0SA 2B9SB 3H0GA 4O26A 2GSUA 3AQOA 5TJ3A 4G0VA 3KYLA 2BE5D 2R4GA 3K5MA 3FHZA 5JSBB 2JA6A 1IW7D 5IORA 1TWGA 2GSNA 1O25A 1TGOA 4GTLA 1TWCA 1O24A 1EH1A 4KMHA 2YU9A 4QCLA 1ZXOA 4P5BA 1BGWA 4LMOA 4EJ3A 4L8IA 3GTGA 3LF9A 1XXBA 3K59A 1TWAA 1O28A 2JA7A 2F4QA 2WAQA 4FM9A 1R5ZA 2JA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DD5 A;  1WQH A;  1XXA A;  4DDQ A;  5MLC 9;  1F9N A;  1GE9 A;  2XCQ A;  2KWA A;  3MML B;  5CJ9 A;  3LAP A;  1WIH A;  4OYD B;  1XXC A;  3FOF A;  3LAJ A;  3L4K A;  4G0U A;  1AB4 A;  1WQF A;  1BJT A;  4GFQ A;  3LHP S;  4KC6 A;  4KAW X;  1WQG A;  2ZFZ A;  3OEP A;  1Y69 8;  3ORE A;  2RGR A;  3V4G A;  3L4J A;  2XCR B;  4G0V A;  4J3N A;  1EK8 A;  3LPX A;  3FHZ A;  5JSB B;  1ISE A;  4KDD A;  1IS1 A;  3OPF A;  4JLR C;  1B4B A;  2XCO A;  1EH1 A;  4KB2 A;  3NUH A;  3ERE D;  2P5M A;  3QX3 A;  1BGW A;  5JVO A;  2PHC B;  1B4A A;  4KB4 A;  2Y3P A;  3BUE A;  4L8I A;  1XXB A;  3LF9 A;  1ZVU A;  3FOE A;  4FM9 A;  5JSN B;  3CAG A;  4G0W A;  3VA7 A; 
#chains in the Genus database with same CATH topology
 1O29 A;  3EQL A;  2A6H D;  3N3Y A;  1R9T K;  1EJ9 A;  3GTM K;  4AH6 A;  4A3K C;  1I6H K;  2YU9 C;  3N0C A;  4IP8 A;  3FOF A;  3A8K A;  1MIU A;  3P9A A;  1K83 C;  3GTG C;  3GTL K;  2JH3 A;  2JA7 C;  2R93 K;  3GTK K;  2JA5 C;  1EFW A;  1V5V A;  5EGH A;  1YNN A;  5IP7 K;  3S2H K;  5M3F K;  5C3E C;  1Y1W C;  1SFO K;  2P5M A;  2A68 D;  3S1R K;  5EGE A;  2FQT A;  4G7H A;  4KAR A;  1XXA A;  2R7Z A;  3S2D K;  5M5X K;  2XCQ A;  1XZP A;  1TWC C;  1I3Q K;  1WSR A;  3DU5 A;  4P5A A;  2E2H A;  1LPQ A;  2B63 A;  3ORE A;  3K5N A;  5D4D A;  5M5W K;  4JK1 A;  1YNJ A;  1K4T A;  2PA8 D;  4C2M A;  1SEU A;  3NUH A;  4XSX A;  3I4N K;  2W7V A;  4A3J C;  1KQ4 A;  2WB1 L;  2PPB A;  4KMU A;  1R49 A;  1ZYR D;  3VA7 A;  1XZQ A;  2Y0S D;  3Q3Q A;  1TWG K;  1J6W A;  4A3I K;  4OIQ A;  2A68 A;  4Q4Z A;  4A3M K;  4KAW X;  3IAY A;  3PO3 C;  3S17 C;  5IYC C;  2R92 C;  1TWA K;  3M3Y C;  4QIW L;  2R7Z K;  4A93 K;  4OIP A;  1I50 A;  2WAQ D;  1TWF C;  3FKI K;  5L46 A;  4LQY A;  2NVX C;  3TFH A;  4BBS K;  2B63 K;  4G7O A;  4GTF A;  2NVQ C;  1X31 C;  3HOV C;  1O26 A;  3GTP C;  3H3V D;  4C2M K;  1R9T C;  3GTM C;  1XZP B;  4YFX A;  4A3B K;  3LAJ A;  3AD9 C;  1BJT A;  2E2I A;  4X6A C;  2Y0S A;  4O26 A;  3H0G A;  2CW0 A;  3GTL C;  3KYL A;  2R93 C;  1YX2 A;  5JSB B;  2JA6 A;  1JVI A;  5IOR A;  5IP7 C;  3S2H C;  4QJV A;  4YFN A;  4GTL A;  1O24 A;  1WOS A;  3DXJ A;  1EH1 A;  1SFO C;  4A3D C;  4KN4 A;  3I4M K;  3GTO K;  2PMZ D;  4OIN A;  3T01 A;  4L8I A;  5IYD K;  3K59 A;  1O28 A;  4FM9 A;  1XZQ B;  1SMY A;  2B9S B;  2WAQ A;  3HOY K;  3S2D C;  3LAP A;  2JA8 K;  1I3Q C;  4YG2 A;  4PAB A;  4IP9 A;  3L4J A;  4BKW A;  4BY1 K;  4KM8 A;  4XLN A;  3K5L A;  3S1M K;  5C4J K;  3GTJ A;  3GDZ A;  3S14 K;  3JST A;  3K5O A;  2E2I K;  4A3L C;  3T00 A;  4Q5G A;  2PHC B;  4KB4 A;  5C44 C;  2FQO A;  1ZVU A;  2NVT K;  2JA6 K;  1TL8 A;  1A31 A;  2P8T A;  1TWG C;  1GE9 A;  2PMZ A;  4OYD B;  4WJ3 M;  4GFQ A;  4AYB A;  4C45 A;  4A3M C;  4AHC A;  2GSO A;  4ZH4 A;  4LJZ A;  3HKZ D;  1TWA C;  2RH6 A;  2R7Z C;  4KM9 A;  4QJV B;  3OPF A;  5CHP A;  3FKI C;  4NOL A;  3AQP A;  4A3E K;  1USO A;  4KAS A;  1TWH A;  1VJE A;  4KAT A;  4BBS C;  2B63 C;  1VRQ C;  4C3I C;  5JFE A;  3PO2 K;  1VGX A;  2O5J D;  1BDF A;  3HXA A;  3GTJ K;  1IL2 A;  1WQH A;  1Y1V C;  4D3Y A;  4DDQ A;  5CJ9 A;  4NOK A;  4C3J K;  1A35 A;  4A3B C;  4GT9 A;  4G0U A;  1HQM D;  1WQF A;  1AB4 A;  4O2D A;  2VUM C;  4XLP A;  2ZUE A;  3CQZ A;  5CQG A;  4OIR A;  3SZZ A;  2A6H A;  3G4C A;  3LPX A;  3A8J A;  3GEI A;  3HKZ A;  3S1Q K;  1K83 A;  1ZBS A;  3GTO C;  5IYD C;  5JSN B;  5C9H A;  4J3N A;  3HOY C;  1F93 A;  3S15 K;  2A6E D;  4KN7 A;  4BY7 K;  3L4K A;  4G7Z A;  2JA8 C;  2O5J A;  5IOQ A;  4KMD A;  3GEH A;  4FZB A;  3K58 A;  3A8I A;  4KMA A;  4H3T A;  3SJR A;  1PJ6 A;  2R4G A;  1DCH A;  2WAQ L;  3K5M A;  4WJ4 A;  3S1M C;  1IW7 D;  3AD7 C;  4OIO A;  5M5Y K;  1F7U A;  3S14 C;  5IP9 K;  5E68 A;  1HQM A;  4A3G K;  4MEX A;  4LK1 A;  4MQ9 A;  1TWC A;  1YCL A;  1ZXO A;  2E2H K;  1BGW A;  4LK0 A;  3CQZ K;  3H3V L;  4EJ3 A;  1XXB A;  3LF9 A;  3K7A K;  2NVT C;  2JA6 C;  1R5Z A;  4Q5S A;  1DD5 A;  4FXD A;  4LLG A;  1INN A;  3MAQ A;  5IOT A;  4C3H K;  2CFA A;  1K83 K;  4RMF A;  1I6H C;  2ZUF A;  2RGR A;  3HOZ K;  3HOW K;  1ZYR A;  1WOR A;  1WSV A;  1EK8 A;  3G4A A;  2A6E A;  3AD8 C;  4MEY A;  3GTK C;  4QIW D;  5C3E K;  4F3E A;  3N0B A;  2NVY A;  2GAH C;  4GTC A;  4A3E C;  4KB2 A;  1V9M A;  4AYB L;  1J6X A;  2R92 A;  3PO2 C;  1JQW A;  3FOE A;  2V6T A;  3S1R C;  4BLB A;  1G51 A;  1I50 K;  1TWC K;  1WIH A;  3GEE A;  4A3F K;  5M3M K;  2A69 D;  3K57 A;  3GTQ A;  4BBR K;  4GTE A;  4P9S A;  1VLO A;  3GTP A;  5IYB K;  1R9T A;  3T02 A;  3ERE D;  4A3J K;  3I4N C;  4D3Z A;  3H0G K;  3BUE A;  1XPP A;  4QIW A;  1I6V D;  2NVY K;  1NH3 A;  4Y52 K;  4Q5V A;  4FYD A;  5TMF A;  4A3I C;  3S15 C;  2CFA B;  4BY7 C;  1IE0 A;  3HKZ L;  2R92 K;  3M3Y K;  4FGU A;  3IPJ A;  1RR8 C;  1RRJ A;  2V6S A;  1ISE A;  1SC7 A;  4A93 C;  5IP9 C;  1JOE A;  4A3G C;  4LOW A;  4LR2 A;  1I3Q A;  2E2H C;  3GTQ K;  4BXX K;  2NVQ K;  4AN8 A;  3ADA C;  1EQR A;  3RZD K;  1T8I A;  3S16 K;  4GZY A;  2KWA A;  3RZO K;  4C2M C;  1YNJ D;  5TMC A;  3BP3 A;  1XXC A;  4C3H C;  3TFJ A;  1WCM A;  4X6A K;  2EBB A;  1DCO A;  3AQO A;  3HOZ C;  1I6V A;  3HOW C;  2BE5 D;  5C4X K;  2PA8 L;  1WOO A;  1TWG A;  2GSN A;  4WIL A;  4A3D K;  1PJ7 A;  2YU9 A;  5FLM K;  1J98 A;  4NOI A;  3I4M C;  3GTG A;  3M4O K;  2Y0S L;  1TWA A;  2JA7 A;  2F4Q A;  2JA5 A;  4GTA A;  4A3C K;  1I50 C;  3FKI A;  1TWH K;  1EI6 A;  1Y1W A;  3HOU K;  4GTB A;  3WOD A;  4Y7N K;  3LHP S;  4A3F C;  2ZFZ A;  1Y69 8;  3WVO A;  2GAG C;  4BBR C;  1BS2 A;  2XCR B;  3HOX K;  2E2J K;  4BY1 C;  1USM A;  1Y1V A;  5IYB C;  4BLA A;  1RU0 A;  5C4J C;  4JLR C;  1WCM K;  1B4B A;  4A3L K;  3GSI A;  2XCO A;  3QX3 A;  5C44 K;  2BE5 A;  3S1N K;  3SZY A;  2E2I C;  2VUM A;  3H0G C;  4YFK A;  1IQ0 A;  1ZQ1 C;  2CW0 D;  1J6V A;  2WB1 D;  1UV7 A;  2NVY C;  4A3K K;  3BP8 C;  4Y52 C;  2V6U A;  2YU9 K;  4GTD A;  3GTG K;  3GTO A;  2JA7 K;  2JA5 K;  5FJ8 K;  1PJ5 A;  1SMY D;  3AH5 A;  1VH2 A;  1Y1W K;  5HL8 A;  2PMZ L;  4C3I K;  3M4A A;  3GTQ C;  1B4A A;  4BXX C;  2Y3P A;  1O27 A;  1IW7 A;  3RZD C;  1Y1V K;  4G0W A;  3S16 C;  4NOM A;  3GTJ C;  1F7V A;  1F9N A;  3MML B;  3RZO C;  1TWF A;  1O2A A;  2NVX A;  4ILD A;  4C3J C;  2VUM K;  1WQG A;  3OEP A;  2WB1 A;  3V4G A;  1C0A A;  4M1X A;  5C4X C;  4KDD A;  1IS1 A;  3GTM A;  1A36 A;  1DCP A;  5JVO A;  5FLM C;  3DU6 A;  1O2B A;  3S1Q C;  4AYB D;  3M4O C;  3GTL A;  1O2F B;  1WOP A;  3GIR A;  3CAG A;  3S0X A;  2R93 A;  3GTK A;  4A3C C;  3TTG A;  5MLC 9;  1HI9 A;  1Q8I A;  1IBA A;  1YNN D;  1TWH C;  4PAA A;  1SFO A;  3HOU C;  4KC6 A;  1K4S A;  4Y7N C;  5TJ3 A;  3S17 K;  3PO3 K;  2GSU A;  3TFI A;  5IYC K;  4G0V A;  2O5I A;  3HOX C;  2E2J C;  3FHZ A;  1TWF K;  2D6F C;  2NVX K;  1O25 A;  1TGO A;  1WCM C;  1L0W A;  4KMH A;  4P5B A;  4QCL A;  2A69 A;  4XCH A;  4LMO A;  3S1N C;  3HOV K;  3CQZ C;  4XSZ A;  3GTP K;  3K7A C;  5IOS A; 
#chains in the Genus database with same CATH homology
 1DD5 A;  4GTA A;  1O29 A;  4FXD A;  2A6H D;  3N3Y A;  1EJ9 A;  3MAQ A;  3FKI A;  5IOT A;  3LAP A;  3N0C A;  4IP8 A;  1Y1W A;  3FOF A;  2CFA A;  4GTB A;  1MIU A;  3P9A A;  3LHP S;  4IP9 A;  2ZFZ A;  1Y69 8;  2RGR A;  3WVO A;  3L4J A;  4BKW A;  2JH3 A;  2XCR B;  4KM8 A;  1EK8 A;  3K5L A;  3G4A A;  1Y1V A;  3GTJ A;  4BLA A;  5EGH A;  4F3E A;  3N0B A;  2NVY A;  4KMA A;  4JLR C;  1B4B A;  4GTC A;  2XCO A;  4KB2 A;  3K5O A;  2P5M A;  3QX3 A;  1V9M A;  4Q5G A;  2PHC B;  2A68 D;  4KB4 A;  2R92 A;  2VUM A;  1ZVU A;  3FOE A;  2CW0 D;  5EGE A;  1TL8 A;  1A31 A;  4BLB A;  4KAR A;  1XXA A;  2R7Z A;  1GE9 A;  2XCQ A;  2PMZ A;  1WIH A;  4OYD B;  4P5A A;  3DU5 A;  2E2H A;  1LPQ A;  4GTD A;  4GFQ A;  4AYB A;  3GTO A;  2B63 A;  2A69 D;  4AHC A;  3K57 A;  3GTQ A;  2GSO A;  3ORE A;  4GTE A;  3K5N A;  2RH6 A;  3GTP A;  1SMY D;  3AH5 A;  4KM9 A;  1R9T A;  3OPF A;  1K4T A;  5CHP A;  4C2M A;  4NOL A;  3AQP A;  4KAT A;  4KAS A;  1TWH A;  1SEU A;  3NUH A;  3ERE D;  3M4A A;  1B4A A;  4C3I C;  2Y3P A;  4D3Z A;  1KQ4 A;  5JFE A;  3BUE A;  2O5J D;  4QIW A;  1O27 A;  1R49 A;  1ZYR D;  4G0W A;  3VA7 A;  1WQH A;  4NOM A;  1I6V D;  4D3Y A;  3Q3Q A;  1NH3 A;  4DDQ A;  1F9N A;  5CJ9 A;  4Q5V A;  4NOK A;  4FYD A;  3MML B;  1TWF A;  1O2A A;  1A35 A;  2CFA B;  2NVX A;  4ILD A;  4GT9 A;  4C3J C;  4G0U A;  1HQM D;  1WQF A;  1AB4 A;  4KAW X;  1WQG A;  3IAY A;  3OEP A;  2WB1 A;  3V4G A;  4FGU A;  3CQZ A;  5CQG A;  3G4C A;  3LPX A;  1RR8 C;  5IOS A;  4M1X A;  1RRJ A;  1ISE A;  4KDD A;  1SC7 A;  1IS1 A;  1I50 A;  3GTM A;  1A36 A;  4LQY A;  4LR2 A;  1I3Q A;  3HKZ A;  5JVO A;  1K83 A;  1ZBS A;  3DU6 A;  1O2B A;  4GTF A;  4AN8 A;  3GTL A;  5JSN B;  5C9H A;  3CAG A;  4J3N A;  1T8I A;  2R93 A;  1O26 A;  3GTK A;  3S0X A;  5MLC 9;  2KWA A;  1Q8I A;  2A6E D;  4C2M C;  1YNJ D;  4C3H C;  1XXC A;  1YNN D;  3L4K A;  3LAJ A;  1WCM A;  1SFO A;  5IOQ A;  1BJT A;  4FZB A;  4KC6 A;  3K58 A;  1K4S A;  4KMD A;  2E2I A;  4H3T A;  3SJR A;  2Y0S A;  2B9S B;  3H0G A;  4O26 A;  2GSU A;  3AQO A;  5TJ3 A;  4G0V A;  3KYL A;  2BE5 D;  2R4G A;  3K5M A;  3FHZ A;  5JSB B;  2JA6 A;  1IW7 D;  5IOR A;  1TWG A;  2GSN A;  1O25 A;  1TGO A;  4GTL A;  1TWC A;  1O24 A;  1EH1 A;  4KMH A;  2YU9 A;  4QCL A;  1ZXO A;  4P5B A;  1BGW A;  4LMO A;  4EJ3 A;  4L8I A;  3GTG A;  3LF9 A;  1XXB A;  3K59 A;  1TWA A;  1O28 A;  2JA7 A;  2F4Q A;  2WAQ A;  4FM9 A;  1R5Z A;  2JA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...