4LMOA

Structure of a vertebrate rna binding domain of telomerase (trbd)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
251
structure length
251
Chain Sequence
SQSFMRTLGFLYGGRGMRSFLLNRKKKTAEGFRKIQGRDLIRIVFFEGVLYLNGLERKPKKLPRRFFNMVPLFSQLLRQHRRCPYSRLLQKTCPLVGIKDAGQAELSSFLPQHCGSHRVYLFVRECLLAVIPQELWGSEHNRLLYFARVRFFLRSGKFERLSVAELMWKIKVNNCDWLKISKTGRVPPSELSYRTQILGQFLAWLLDGFVVGLVRACFYATESMGQKNAIRFYRQEVWAKLQDLAFRSHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase reverse transcriptase
publication title A Motif in the Vertebrate Telomerase N-Terminal Linker of TERT Contributes to RNA Binding and Telomerase Activity and Processivity.
pubmed doi rcsb
source organism Takifugu rubripes
molecule tags Rna binding protein
total genus 75
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.70 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4lmoA00
4O26A 4LMOA 5CQGA 5C9HA 3DU6A 2R4GA 3KYLA 3DU5A
chains in the Genus database with same CATH superfamily
4C2MA 1ZYRD 4KB2A 3GTMA 2R4GA 1I6VD 1RR8C 3IAYA 2A6ED 1WQFA 4FXDA 3K5LA 2VUMA 4KC6A 2JA7A 1TWCA 3K5NA 4AYBA 2E2IA 2A69D 3MAQA 1EH1A 1YNND 3SJRA 1IW7D 2NVXA 4H3TA 1A35A 2A68D 2O5JD 3M4AA 1EJ9A 4FGUA 2CW0D 1K4TA 1TWGA 3HKZA 4QIWA 5C9HA 1TWHA 4AHCA 3KYLA 1Q8IA 5JSBB 1IS1A 1EK8A 1TGOA 4KDDA 4F3EA 5CQGA 1R9TA 1WQHA 3WVOA 1TWAA 3K58A 4OYDB 2R93A 1DD5A 1WCMA 4NOLA 1R5ZA 2A6HD 4QCLA 3GTJA 4NOKA 2B63A 3LF9A 3K5MA 3GTLA 4AN8A 1ISEA 4NOMA 3FKIA 3H0GA 2NVYA 4D3ZA 1Y698 1WQGA 2Y0SA 3GTGA 4IP9A 1K4SA 1SFOA 4KAWX 2R92A 4EJ3A 1A36A 2R7ZA 4D3YA 3GTOA 2JA6A 3LHPS 1T8IA 2YU9A 5MLC9 3CQZA 4Q5GA 2PMZA 1YNJD 1GE9A 1TL8A 2BE5D 4JLRC 1Y1WA 4FYDA 1SMYD 1SEUA 3GTPA 1LPQA 3K5OA 2WB1A 1I3QA 5JSNB 1TWFA 1HQMD 3P9AA 3GTQA 2WAQA 4Q5VA 3K59A 1RRJA 1MIUA 4GFQA 1R49A 2JA5A 4O26A 1NH3A 3DU6A 4KB4A 3DU5A 1I50A 4LMOA 3K57A 1SC7A 1A31A 2F4QA 1V9MA 1Y1VA 3GTKA 2E2HA 4L8IA 4IP8A 2B9SB 1K83A
chains in the Genus database with same CATH topology
4C2MA 1ZYRD 4KB2A 3GTMA 2R4GA 1I6VD 1RR8C 3IAYA 2A6ED 1WQFA 4FXDA 3K5LA 2VUMA 4KC6A 2JA7A 1TWCA 3K5NA 4AYBA 2E2IA 2A69D 3MAQA 1EH1A 1YNND 3SJRA 1IW7D 2NVXA 4H3TA 1A35A 2A68D 2O5JD 3M4AA 1EJ9A 4FGUA 2CW0D 1K4TA 1TWGA 3HKZA 4QIWA 5C9HA 1TWHA 4AHCA 3KYLA 1Q8IA 5JSBB 1IS1A 1EK8A 1TGOA 4KDDA 4F3EA 5CQGA 1R9TA 1WQHA 3WVOA 1TWAA 3K58A 4OYDB 2R93A 1DD5A 1WCMA 4NOLA 1R5ZA 2A6HD 4QCLA 3GTJA 4NOKA 2B63A 3LF9A 3K5MA 3GTLA 4AN8A 1ISEA 4NOMA 3FKIA 3H0GA 2NVYA 4D3ZA 1Y698 1WQGA 2Y0SA 3GTGA 4IP9A 1K4SA 1SFOA 4KAWX 2R92A 4EJ3A 1A36A 2R7ZA 4D3YA 3GTOA 2JA6A 3LHPS 1T8IA 2YU9A 5MLC9 3CQZA 4Q5GA 2PMZA 1YNJD 1GE9A 1TL8A 2BE5D 4JLRC 1Y1WA 4FYDA 1SMYD 1SEUA 3GTPA 1LPQA 3K5OA 2WB1A 1I3QA 5JSNB 1TWFA 1HQMD 3P9AA 3GTQA 2WAQA 4Q5VA 3K59A 1RRJA 1MIUA 4GFQA 1R49A 2JA5A 4O26A 1NH3A 3DU6A 4KB4A 3DU5A 1I50A 4LMOA 3K57A 1SC7A 1A31A 2F4QA 1V9MA 1Y1VA 3GTKA 2E2HA 4L8IA 4IP8A 2B9SB 1K83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O26 A;  4LMO A;  5CQG A;  5C9H A;  3DU6 A;  2R4G A;  3KYL A;  3DU5 A; 
#chains in the Genus database with same CATH topology
 4C2M A;  1ZYR D;  4KB2 A;  3GTM A;  2R4G A;  1I6V D;  1RR8 C;  3IAY A;  2A6E D;  1WQF A;  4FXD A;  3K5L A;  2VUM A;  4KC6 A;  2JA7 A;  1TWC A;  3K5N A;  4AYB A;  2E2I A;  2A69 D;  3MAQ A;  1EH1 A;  1YNN D;  3SJR A;  1IW7 D;  2NVX A;  4H3T A;  1A35 A;  2A68 D;  2O5J D;  3M4A A;  1EJ9 A;  4FGU A;  2CW0 D;  1K4T A;  1TWG A;  3HKZ A;  4QIW A;  5C9H A;  1TWH A;  4AHC A;  3KYL A;  1Q8I A;  5JSB B;  1IS1 A;  1EK8 A;  1TGO A;  4KDD A;  4F3E A;  5CQG A;  1R9T A;  1WQH A;  3WVO A;  1TWA A;  3K58 A;  4OYD B;  2R93 A;  1DD5 A;  1WCM A;  4NOL A;  1R5Z A;  2A6H D;  4QCL A;  3GTJ A;  4NOK A;  2B63 A;  3LF9 A;  3K5M A;  3GTL A;  4AN8 A;  1ISE A;  4NOM A;  3FKI A;  3H0G A;  2NVY A;  4D3Z A;  1Y69 8;  1WQG A;  2Y0S A;  3GTG A;  4IP9 A;  1K4S A;  1SFO A;  4KAW X;  2R92 A;  4EJ3 A;  1A36 A;  2R7Z A;  4D3Y A;  3GTO A;  2JA6 A;  3LHP S;  1T8I A;  2YU9 A;  5MLC 9;  3CQZ A;  4Q5G A;  2PMZ A;  1YNJ D;  1GE9 A;  1TL8 A;  2BE5 D;  4JLR C;  1Y1W A;  4FYD A;  1SMY D;  1SEU A;  3GTP A;  1LPQ A;  3K5O A;  2WB1 A;  1I3Q A;  5JSN B;  1TWF A;  1HQM D;  3P9A A;  3GTQ A;  2WAQ A;  4Q5V A;  3K59 A;  1RRJ A;  1MIU A;  4GFQ A;  1R49 A;  2JA5 A;  4O26 A;  1NH3 A;  3DU6 A;  4KB4 A;  3DU5 A;  1I50 A;  4LMO A;  3K57 A;  1SC7 A;  1A31 A;  2F4Q A;  1V9M A;  1Y1V A;  3GTK A;  2E2H A;  4L8I A;  4IP8 A;  2B9S B;  1K83 A; 
#chains in the Genus database with same CATH homology
 4C2M A;  1ZYR D;  4KB2 A;  3GTM A;  2R4G A;  1I6V D;  1RR8 C;  3IAY A;  2A6E D;  1WQF A;  4FXD A;  3K5L A;  2VUM A;  4KC6 A;  2JA7 A;  1TWC A;  3K5N A;  4AYB A;  2E2I A;  2A69 D;  3MAQ A;  1EH1 A;  1YNN D;  3SJR A;  1IW7 D;  2NVX A;  4H3T A;  1A35 A;  2A68 D;  2O5J D;  3M4A A;  1EJ9 A;  4FGU A;  2CW0 D;  1K4T A;  1TWG A;  3HKZ A;  4QIW A;  5C9H A;  1TWH A;  4AHC A;  3KYL A;  1Q8I A;  5JSB B;  1IS1 A;  1EK8 A;  1TGO A;  4KDD A;  4F3E A;  5CQG A;  1R9T A;  1WQH A;  3WVO A;  1TWA A;  3K58 A;  4OYD B;  2R93 A;  1DD5 A;  1WCM A;  4NOL A;  1R5Z A;  2A6H D;  4QCL A;  3GTJ A;  4NOK A;  2B63 A;  3LF9 A;  3K5M A;  3GTL A;  4AN8 A;  1ISE A;  4NOM A;  3FKI A;  3H0G A;  2NVY A;  4D3Z A;  1Y69 8;  1WQG A;  2Y0S A;  3GTG A;  4IP9 A;  1K4S A;  1SFO A;  4KAW X;  2R92 A;  4EJ3 A;  1A36 A;  2R7Z A;  4D3Y A;  3GTO A;  2JA6 A;  3LHP S;  1T8I A;  2YU9 A;  5MLC 9;  3CQZ A;  4Q5G A;  2PMZ A;  1YNJ D;  1GE9 A;  1TL8 A;  2BE5 D;  4JLR C;  1Y1W A;  4FYD A;  1SMY D;  1SEU A;  3GTP A;  1LPQ A;  3K5O A;  2WB1 A;  1I3Q A;  5JSN B;  1TWF A;  1HQM D;  3P9A A;  3GTQ A;  2WAQ A;  4Q5V A;  3K59 A;  1RRJ A;  1MIU A;  4GFQ A;  1R49 A;  2JA5 A;  4O26 A;  1NH3 A;  3DU6 A;  4KB4 A;  3DU5 A;  1I50 A;  4LMO A;  3K57 A;  1SC7 A;  1A31 A;  2F4Q A;  1V9M A;  1Y1V A;  3GTK A;  2E2H A;  4L8I A;  4IP8 A;  2B9S B;  1K83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...