4LMOA

Structure of a vertebrate rna binding domain of telomerase (trbd)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
251
structure length
251
Chain Sequence
SQSFMRTLGFLYGGRGMRSFLLNRKKKTAEGFRKIQGRDLIRIVFFEGVLYLNGLERKPKKLPRRFFNMVPLFSQLLRQHRRCPYSRLLQKTCPLVGIKDAGQAELSSFLPQHCGSHRVYLFVRECLLAVIPQELWGSEHNRLLYFARVRFFLRSGKFERLSVAELMWKIKVNNCDWLKISKTGRVPPSELSYRTQILGQFLAWLLDGFVVGLVRACFYATESMGQKNAIRFYRQEVWAKLQDLAFRSHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Motif in the Vertebrate Telomerase N-Terminal Linker of TERT Contributes to RNA Binding and Telomerase Activity and Processivity.
pubmed doi rcsb
source organism Takifugu rubripes
molecule tags Rna binding protein
molecule keywords Telomerase reverse transcriptase
total genus 75
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.70 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4lmoA00
3DU5A 5C9HA 4LMOA 3KYLA 4O26A 3DU6A 2R4GA 5CQGA
chains in the Genus database with same CATH superfamily
4FYDA 2B63A 4FXDA 2Y0SA 1SC7A 4NOMA 4KB2A 1TWCA 1SEUA 1YNND 1I3QA 3M4AA 1R9TA 1Y1VA 4H3TA 4O26A 3DU6A 3GTQA 1I50A 1R49A 2JA7A 3GTMA 3GTLA 4KC6A 2A68D 1TWGA 2JA5A 2WB1A 3WVOA 3K5NA 4EJ3A 3H0GA 4L8IA 4OYDB 1EJ9A 5JSBB 2R7ZA 1TWFA 4AYBA 1ZYRD 3K58A 5JSNB 4AHCA 1Y1WA 5CQGA 1T8IA 3K5OA 1K4SA 3DU5A 3K59A 1A35A 5C9HA 3GTKA 1GE9A 3LHPS 1R5ZA 3K57A 4KB4A 2VUMA 1IW7D 4F3EA 2R92A 4Q5VA 2JA6A 2E2HA 3IAYA 1TWHA 1HQMD 1WCMA 4KDDA 4IP9A 4NOKA 3CQZA 1K4TA 3P9AA 4LMOA 1Q8IA 4QIWA 4D3ZA 2A6ED 1NH3A 1DD5A 2PMZA 1TWAA 2CW0D 2R93A 4AN8A 3MAQA 3K5LA 1TL8A 5MLC9 1ISEA 1IS1A 1LPQA 3GTPA 2NVXA 2NVYA 1WQHA 2A69D 3K5MA 2E2IA 1YNJD 4GFQA 3FKIA 3GTOA 2O5JD 4D3YA 2WAQA 1Y698 4NOLA 1TGOA 2R4GA 1A36A 1RR8C 1EK8A 3SJRA 2YU9A 3GTGA 1RRJA 2A6HD 3GTJA 4QCLA 2F4QA 2B9SB 1MIUA 3KYLA 1K83A 1SMYD 3LF9A 1SFOA 4IP8A 4JLRC 1A31A 4FGUA 1V9MA 4Q5GA 3HKZA 4KAWX 1WQGA 1I6VD 1EH1A 1WQFA 2BE5D 4C2MA
chains in the Genus database with same CATH topology
4FYDA 2B63A 4FXDA 2Y0SA 1SC7A 4NOMA 4KB2A 1TWCA 1SEUA 1YNND 1I3QA 3M4AA 1R9TA 1Y1VA 4H3TA 4O26A 3DU6A 3GTQA 1I50A 1R49A 2JA7A 3GTMA 3GTLA 4KC6A 2A68D 1TWGA 2JA5A 2WB1A 3WVOA 3K5NA 4EJ3A 3H0GA 4L8IA 4OYDB 1EJ9A 5JSBB 2R7ZA 1TWFA 4AYBA 1ZYRD 3K58A 5JSNB 4AHCA 1Y1WA 5CQGA 1T8IA 3K5OA 1K4SA 3DU5A 3K59A 1A35A 5C9HA 3GTKA 1GE9A 3LHPS 1R5ZA 3K57A 4KB4A 2VUMA 1IW7D 4F3EA 2R92A 4Q5VA 2JA6A 2E2HA 3IAYA 1TWHA 1HQMD 1WCMA 4KDDA 4IP9A 4NOKA 3CQZA 1K4TA 3P9AA 4LMOA 1Q8IA 4QIWA 4D3ZA 2A6ED 1NH3A 1DD5A 2PMZA 1TWAA 2CW0D 2R93A 4AN8A 3MAQA 3K5LA 1TL8A 5MLC9 1ISEA 1IS1A 1LPQA 3GTPA 2NVXA 2NVYA 1WQHA 2A69D 3K5MA 2E2IA 1YNJD 4GFQA 3FKIA 3GTOA 2O5JD 4D3YA 2WAQA 1Y698 4NOLA 1TGOA 2R4GA 1A36A 1RR8C 1EK8A 3SJRA 2YU9A 3GTGA 1RRJA 2A6HD 3GTJA 4QCLA 2F4QA 2B9SB 1MIUA 3KYLA 1K83A 1SMYD 3LF9A 1SFOA 4IP8A 4JLRC 1A31A 4FGUA 1V9MA 4Q5GA 3HKZA 4KAWX 1WQGA 1I6VD 1EH1A 1WQFA 2BE5D 4C2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DU5 A;  5C9H A;  4LMO A;  3KYL A;  4O26 A;  3DU6 A;  2R4G A;  5CQG A; 
#chains in the Genus database with same CATH topology
 4FYD A;  2B63 A;  4FXD A;  2Y0S A;  1SC7 A;  4NOM A;  4KB2 A;  1TWC A;  1SEU A;  1YNN D;  1I3Q A;  3M4A A;  1R9T A;  1Y1V A;  4H3T A;  4O26 A;  3DU6 A;  3GTQ A;  1I50 A;  1R49 A;  2JA7 A;  3GTM A;  3GTL A;  4KC6 A;  2A68 D;  1TWG A;  2JA5 A;  2WB1 A;  3WVO A;  3K5N A;  4EJ3 A;  3H0G A;  4L8I A;  4OYD B;  1EJ9 A;  5JSB B;  2R7Z A;  1TWF A;  4AYB A;  1ZYR D;  3K58 A;  5JSN B;  4AHC A;  1Y1W A;  5CQG A;  1T8I A;  3K5O A;  1K4S A;  3DU5 A;  3K59 A;  1A35 A;  5C9H A;  3GTK A;  1GE9 A;  3LHP S;  1R5Z A;  3K57 A;  4KB4 A;  2VUM A;  1IW7 D;  4F3E A;  2R92 A;  4Q5V A;  2JA6 A;  2E2H A;  3IAY A;  1TWH A;  1HQM D;  1WCM A;  4KDD A;  4IP9 A;  4NOK A;  3CQZ A;  1K4T A;  3P9A A;  4LMO A;  1Q8I A;  4QIW A;  4D3Z A;  2A6E D;  1NH3 A;  1DD5 A;  2PMZ A;  1TWA A;  2CW0 D;  2R93 A;  4AN8 A;  3MAQ A;  3K5L A;  1TL8 A;  5MLC 9;  1ISE A;  1IS1 A;  1LPQ A;  3GTP A;  2NVX A;  2NVY A;  1WQH A;  2A69 D;  3K5M A;  2E2I A;  1YNJ D;  4GFQ A;  3FKI A;  3GTO A;  2O5J D;  4D3Y A;  2WAQ A;  1Y69 8;  4NOL A;  1TGO A;  2R4G A;  1A36 A;  1RR8 C;  1EK8 A;  3SJR A;  2YU9 A;  3GTG A;  1RRJ A;  2A6H D;  3GTJ A;  4QCL A;  2F4Q A;  2B9S B;  1MIU A;  3KYL A;  1K83 A;  1SMY D;  3LF9 A;  1SFO A;  4IP8 A;  4JLR C;  1A31 A;  4FGU A;  1V9M A;  4Q5G A;  3HKZ A;  4KAW X;  1WQG A;  1I6V D;  1EH1 A;  1WQF A;  2BE5 D;  4C2M A; 
#chains in the Genus database with same CATH homology
 4FYD A;  2B63 A;  4FXD A;  2Y0S A;  1SC7 A;  4NOM A;  4KB2 A;  1TWC A;  1SEU A;  1YNN D;  1I3Q A;  3M4A A;  1R9T A;  1Y1V A;  4H3T A;  4O26 A;  3DU6 A;  3GTQ A;  1I50 A;  1R49 A;  2JA7 A;  3GTM A;  3GTL A;  4KC6 A;  2A68 D;  1TWG A;  2JA5 A;  2WB1 A;  3WVO A;  3K5N A;  4EJ3 A;  3H0G A;  4L8I A;  4OYD B;  1EJ9 A;  5JSB B;  2R7Z A;  1TWF A;  4AYB A;  1ZYR D;  3K58 A;  5JSN B;  4AHC A;  1Y1W A;  5CQG A;  1T8I A;  3K5O A;  1K4S A;  3DU5 A;  3K59 A;  1A35 A;  5C9H A;  3GTK A;  1GE9 A;  3LHP S;  1R5Z A;  3K57 A;  4KB4 A;  2VUM A;  1IW7 D;  4F3E A;  2R92 A;  4Q5V A;  2JA6 A;  2E2H A;  3IAY A;  1TWH A;  1HQM D;  1WCM A;  4KDD A;  4IP9 A;  4NOK A;  3CQZ A;  1K4T A;  3P9A A;  4LMO A;  1Q8I A;  4QIW A;  4D3Z A;  2A6E D;  1NH3 A;  1DD5 A;  2PMZ A;  1TWA A;  2CW0 D;  2R93 A;  4AN8 A;  3MAQ A;  3K5L A;  1TL8 A;  5MLC 9;  1ISE A;  1IS1 A;  1LPQ A;  3GTP A;  2NVX A;  2NVY A;  1WQH A;  2A69 D;  3K5M A;  2E2I A;  1YNJ D;  4GFQ A;  3FKI A;  3GTO A;  2O5J D;  4D3Y A;  2WAQ A;  1Y69 8;  4NOL A;  1TGO A;  2R4G A;  1A36 A;  1RR8 C;  1EK8 A;  3SJR A;  2YU9 A;  3GTG A;  1RRJ A;  2A6H D;  3GTJ A;  4QCL A;  2F4Q A;  2B9S B;  1MIU A;  3KYL A;  1K83 A;  1SMY D;  3LF9 A;  1SFO A;  4IP8 A;  4JLR C;  1A31 A;  4FGU A;  1V9M A;  4Q5G A;  3HKZ A;  4KAW X;  1WQG A;  1I6V D;  1EH1 A;  1WQF A;  2BE5 D;  4C2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...