2B9SB

Crystal structure of heterodimeric l. donovani topoisomerase i-vanadate-dna complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
b'KAVSLGTSKINYIDPRIICSWAKAQDVPINKIFSATIQKKFPWAMNAENFDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*TP*T)-3'
molecule tags Isomerase/dna
source organism Leishmania donovani
publication title The Structure of the Transition State of the Heterodimeric Topoisomerase I of Leishmania donovani as a Vanadate Complex with Nicked DNA.
pubmed doi rcsb
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 2005-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.10 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 2b9sB00
1K4TA 1R49A 1T8IA 1A35A 1EJ9A 2B9SB 1RR8C 1K4SA 1RRJA 1TL8A 1A36A 1A31A 1SEUA 1NH3A 1SC7A 1LPQA
chains in the Genus database with same CATH superfamily
1EH1A 2VUMA 1R9TA 2A6HD 4Q5VA 2B63A 4KDDA 3K58A 1WQHA 1TWAA 2A68D 4EJ3A 3GTPA 1RRJA 4O26A 1GE9A 4LMOA 1LPQA 1YNND 3GTQA 1Q8IA 3P9AA 3IAYA 1K4TA 3GTJA 4H3TA 3M4AA 1K4SA 5JSNB 2PMZA 2E2HA 1SC7A 4KC6A 2B9SB 3K5OA 1ZYRD 2F4QA 3DU6A 2R92A 4KB4A 2O5JD 1WCMA 2E2IA 4L8IA 2R4GA 4GFQA 1TGOA 5JSBB 1R5ZA 5CQGA 2NVYA 4C2MA 1R49A 1I50A 1WQGA 3K59A 4KB2A 3K57A 3K5LA 1A36A 5MLC9 4QCLA 4IP9A 1MIUA 4F3EA 3SJRA 1A31A 1SEUA 3DU5A 2WAQA 1V9MA 1T8IA 2CW0D 1IS1A 4D3ZA 1K83A 3LHPS 1YNJD 2NVXA 4OYDB 3GTOA 1I6VD 1A35A 3GTKA 1I3QA 1Y1VA 3KYLA 3K5NA 3CQZA 3K5MA 4FYDA 3GTLA 1Y1WA 3H0GA 4QIWA 2A69D 2JA6A 3MAQA 2R93A 1DD5A 3FKIA 4AN8A 1EK8A 1EJ9A 4KAWX 3WVOA 1SMYD 1SFOA 1RR8C 1ISEA 1TWHA 2A6ED 2BE5D 4FXDA 1TWCA 4NOMA 1TWFA 4D3YA 3LF9A 1WQFA 1TL8A 1IW7D 4AYBA 3GTGA 2WB1A 2R7ZA 4AHCA 2JA7A 1Y698 2Y0SA 4NOLA 4FGUA 1TWGA 5C9HA 4JLRC 4IP8A 3HKZA 1HQMD 4Q5GA 3GTMA 2YU9A 2JA5A 1NH3A 4NOKA
chains in the Genus database with same CATH topology
1EH1A 2VUMA 1R9TA 2A6HD 4Q5VA 2B63A 4KDDA 3K58A 1WQHA 1TWAA 2A68D 4EJ3A 3GTPA 1RRJA 4O26A 1GE9A 4LMOA 1LPQA 1YNND 3GTQA 1Q8IA 3P9AA 3IAYA 1K4TA 3GTJA 4H3TA 3M4AA 1K4SA 5JSNB 2PMZA 2E2HA 1SC7A 4KC6A 2B9SB 3K5OA 1ZYRD 2F4QA 3DU6A 2R92A 4KB4A 2O5JD 1WCMA 2E2IA 4L8IA 2R4GA 4GFQA 1TGOA 5JSBB 1R5ZA 5CQGA 2NVYA 4C2MA 1R49A 1I50A 1WQGA 3K59A 4KB2A 3K57A 3K5LA 1A36A 5MLC9 4QCLA 4IP9A 1MIUA 4F3EA 3SJRA 1A31A 1SEUA 3DU5A 2WAQA 1V9MA 1T8IA 2CW0D 1IS1A 4D3ZA 1K83A 3LHPS 1YNJD 2NVXA 4OYDB 3GTOA 1I6VD 1A35A 3GTKA 1I3QA 1Y1VA 3KYLA 3K5NA 3CQZA 3K5MA 4FYDA 3GTLA 1Y1WA 3H0GA 4QIWA 2A69D 2JA6A 3MAQA 2R93A 1DD5A 3FKIA 4AN8A 1EK8A 1EJ9A 4KAWX 3WVOA 1SMYD 1SFOA 1RR8C 1ISEA 1TWHA 2A6ED 2BE5D 4FXDA 1TWCA 4NOMA 1TWFA 4D3YA 3LF9A 1WQFA 1TL8A 1IW7D 4AYBA 3GTGA 2WB1A 2R7ZA 4AHCA 2JA7A 1Y698 2Y0SA 4NOLA 4FGUA 1TWGA 5C9HA 4JLRC 4IP8A 3HKZA 1HQMD 4Q5GA 3GTMA 2YU9A 2JA5A 1NH3A 4NOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4T A;  1R49 A;  1T8I A;  1A35 A;  1EJ9 A;  2B9S B;  1RR8 C;  1K4S A;  1RRJ A;  1TL8 A;  1A36 A;  1A31 A;  1SEU A;  1NH3 A;  1SC7 A;  1LPQ A; 
#chains in the Genus database with same CATH topology
 1EH1 A;  2VUM A;  1R9T A;  2A6H D;  4Q5V A;  2B63 A;  4KDD A;  3K58 A;  1WQH A;  1TWA A;  2A68 D;  4EJ3 A;  3GTP A;  1RRJ A;  4O26 A;  1GE9 A;  4LMO A;  1LPQ A;  1YNN D;  3GTQ A;  1Q8I A;  3P9A A;  3IAY A;  1K4T A;  3GTJ A;  4H3T A;  3M4A A;  1K4S A;  5JSN B;  2PMZ A;  2E2H A;  1SC7 A;  4KC6 A;  2B9S B;  3K5O A;  1ZYR D;  2F4Q A;  3DU6 A;  2R92 A;  4KB4 A;  2O5J D;  1WCM A;  2E2I A;  4L8I A;  2R4G A;  4GFQ A;  1TGO A;  5JSB B;  1R5Z A;  5CQG A;  2NVY A;  4C2M A;  1R49 A;  1I50 A;  1WQG A;  3K59 A;  4KB2 A;  3K57 A;  3K5L A;  1A36 A;  5MLC 9;  4QCL A;  4IP9 A;  1MIU A;  4F3E A;  3SJR A;  1A31 A;  1SEU A;  3DU5 A;  2WAQ A;  1V9M A;  1T8I A;  2CW0 D;  1IS1 A;  4D3Z A;  1K83 A;  3LHP S;  1YNJ D;  2NVX A;  4OYD B;  3GTO A;  1I6V D;  1A35 A;  3GTK A;  1I3Q A;  1Y1V A;  3KYL A;  3K5N A;  3CQZ A;  3K5M A;  4FYD A;  3GTL A;  1Y1W A;  3H0G A;  4QIW A;  2A69 D;  2JA6 A;  3MAQ A;  2R93 A;  1DD5 A;  3FKI A;  4AN8 A;  1EK8 A;  1EJ9 A;  4KAW X;  3WVO A;  1SMY D;  1SFO A;  1RR8 C;  1ISE A;  1TWH A;  2A6E D;  2BE5 D;  4FXD A;  1TWC A;  4NOM A;  1TWF A;  4D3Y A;  3LF9 A;  1WQF A;  1TL8 A;  1IW7 D;  4AYB A;  3GTG A;  2WB1 A;  2R7Z A;  4AHC A;  2JA7 A;  1Y69 8;  2Y0S A;  4NOL A;  4FGU A;  1TWG A;  5C9H A;  4JLR C;  4IP8 A;  3HKZ A;  1HQM D;  4Q5G A;  3GTM A;  2YU9 A;  2JA5 A;  1NH3 A;  4NOK A; 
#chains in the Genus database with same CATH homology
 1EH1 A;  2VUM A;  1R9T A;  2A6H D;  4Q5V A;  2B63 A;  4KDD A;  3K58 A;  1WQH A;  1TWA A;  2A68 D;  4EJ3 A;  3GTP A;  1RRJ A;  4O26 A;  1GE9 A;  4LMO A;  1LPQ A;  1YNN D;  3GTQ A;  1Q8I A;  3P9A A;  3IAY A;  1K4T A;  3GTJ A;  4H3T A;  3M4A A;  1K4S A;  5JSN B;  2PMZ A;  2E2H A;  1SC7 A;  4KC6 A;  2B9S B;  3K5O A;  1ZYR D;  2F4Q A;  3DU6 A;  2R92 A;  4KB4 A;  2O5J D;  1WCM A;  2E2I A;  4L8I A;  2R4G A;  4GFQ A;  1TGO A;  5JSB B;  1R5Z A;  5CQG A;  2NVY A;  4C2M A;  1R49 A;  1I50 A;  1WQG A;  3K59 A;  4KB2 A;  3K57 A;  3K5L A;  1A36 A;  5MLC 9;  4QCL A;  4IP9 A;  1MIU A;  4F3E A;  3SJR A;  1A31 A;  1SEU A;  3DU5 A;  2WAQ A;  1V9M A;  1T8I A;  2CW0 D;  1IS1 A;  4D3Z A;  1K83 A;  3LHP S;  1YNJ D;  2NVX A;  4OYD B;  3GTO A;  1I6V D;  1A35 A;  3GTK A;  1I3Q A;  1Y1V A;  3KYL A;  3K5N A;  3CQZ A;  3K5M A;  4FYD A;  3GTL A;  1Y1W A;  3H0G A;  4QIW A;  2A69 D;  2JA6 A;  3MAQ A;  2R93 A;  1DD5 A;  3FKI A;  4AN8 A;  1EK8 A;  1EJ9 A;  4KAW X;  3WVO A;  1SMY D;  1SFO A;  1RR8 C;  1ISE A;  1TWH A;  2A6E D;  2BE5 D;  4FXD A;  1TWC A;  4NOM A;  1TWF A;  4D3Y A;  3LF9 A;  1WQF A;  1TL8 A;  1IW7 D;  4AYB A;  3GTG A;  2WB1 A;  2R7Z A;  4AHC A;  2JA7 A;  1Y69 8;  2Y0S A;  4NOL A;  4FGU A;  1TWG A;  5C9H A;  4JLR C;  4IP8 A;  3HKZ A;  1HQM D;  4Q5G A;  3GTM A;  2YU9 A;  2JA5 A;  1NH3 A;  4NOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...