2B9SB

Crystal structure of heterodimeric l. donovani topoisomerase i-vanadate-dna complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
KAVSLGTSKINYIDPRIICSWAKAQDVPINKIFSATIQKKFPWAMNAENFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Transition State of the Heterodimeric Topoisomerase I of Leishmania donovani as a Vanadate Complex with Nicked DNA.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Isomerase/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*TP*T)-3'
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 2005-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.10 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 2b9sB00
1A36A 1RRJA 1NH3A 1SEUA 1TL8A 1SC7A 1R49A 2B9SB 1A35A 1T8IA 1A31A 1K4TA 1RR8C 1LPQA 1EJ9A 1K4SA
chains in the Genus database with same CATH superfamily
4NOLA 2YU9A 1TL8A 3K5MA 4O26A 3GTGA 4IP9A 4KC6A 1MIUA 1SFOA 3DU6A 4H3TA 1I50A 1RRJA 1TWGA 1WCMA 3K5LA 3KYLA 2VUMA 4C2MA 2CW0D 3GTLA 1TWHA 2R4GA 2E2IA 1I6VD 2B9SB 2JA6A 4IP8A 1TWFA 3CQZA 1NH3A 1IW7D 4OYDB 1IS1A 5MLC9 2A6ED 4JLRC 2E2HA 2NVYA 1SEUA 1SMYD 4KB4A 2F4QA 1ISEA 4KDDA 3K57A 2A69D 1YNND 1EH1A 2A68D 4LMOA 1Y1WA 3GTQA 1V9MA 3LF9A 1R9TA 1I3QA 3GTMA 4FYDA 4NOKA 1Y698 1WQFA 4D3ZA 4FGUA 3DU5A 3K58A 2NVXA 1LPQA 1EJ9A 4Q5VA 1K4SA 2R92A 3GTPA 2R93A 1TWAA 1A35A 2JA7A 4F3EA 3MAQA 2WB1A 1Q8IA 1K4TA 1GE9A 3LHPS 1R5ZA 3P9AA 3K5NA 2Y0SA 4NOMA 1A36A 2A6HD 1TWCA 2B63A 4AHCA 4FXDA 1RR8C 1ZYRD 4D3YA 2BE5D 3FKIA 1WQGA 5JSNB 4L8IA 2O5JD 1TGOA 1T8IA 1DD5A 1EK8A 3M4AA 2JA5A 4AN8A 1YNJD 1SC7A 3H0GA 5JSBB 3WVOA 3IAYA 3GTKA 4QIWA 3SJRA 1A31A 3K5OA 5C9HA 4GFQA 3K59A 2WAQA 4QCLA 1R49A 4KAWX 3GTOA 2PMZA 1Y1VA 3GTJA 1K83A 2R7ZA 4KB2A 4Q5GA 1HQMD 1WQHA 4AYBA 4EJ3A 5CQGA 3HKZA
chains in the Genus database with same CATH topology
4NOLA 2YU9A 1TL8A 3K5MA 4O26A 3GTGA 4IP9A 4KC6A 1MIUA 1SFOA 3DU6A 4H3TA 1I50A 1RRJA 1TWGA 1WCMA 3K5LA 3KYLA 2VUMA 4C2MA 2CW0D 3GTLA 1TWHA 2R4GA 2E2IA 1I6VD 2B9SB 2JA6A 4IP8A 1TWFA 3CQZA 1NH3A 1IW7D 4OYDB 1IS1A 5MLC9 2A6ED 4JLRC 2E2HA 2NVYA 1SEUA 1SMYD 4KB4A 2F4QA 1ISEA 4KDDA 3K57A 2A69D 1YNND 1EH1A 2A68D 4LMOA 1Y1WA 3GTQA 1V9MA 3LF9A 1R9TA 1I3QA 3GTMA 4FYDA 4NOKA 1Y698 1WQFA 4D3ZA 4FGUA 3DU5A 3K58A 2NVXA 1LPQA 1EJ9A 4Q5VA 1K4SA 2R92A 3GTPA 2R93A 1TWAA 1A35A 2JA7A 4F3EA 3MAQA 2WB1A 1Q8IA 1K4TA 1GE9A 3LHPS 1R5ZA 3P9AA 3K5NA 2Y0SA 4NOMA 1A36A 2A6HD 1TWCA 2B63A 4AHCA 4FXDA 1RR8C 1ZYRD 4D3YA 2BE5D 3FKIA 1WQGA 5JSNB 4L8IA 2O5JD 1TGOA 1T8IA 1DD5A 1EK8A 3M4AA 2JA5A 4AN8A 1YNJD 1SC7A 3H0GA 5JSBB 3WVOA 3IAYA 3GTKA 4QIWA 3SJRA 1A31A 3K5OA 5C9HA 4GFQA 3K59A 2WAQA 4QCLA 1R49A 4KAWX 3GTOA 2PMZA 1Y1VA 3GTJA 1K83A 2R7ZA 4KB2A 4Q5GA 1HQMD 1WQHA 4AYBA 4EJ3A 5CQGA 3HKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A36 A;  1RRJ A;  1NH3 A;  1SEU A;  1TL8 A;  1SC7 A;  1R49 A;  2B9S B;  1A35 A;  1T8I A;  1A31 A;  1K4T A;  1RR8 C;  1LPQ A;  1EJ9 A;  1K4S A; 
#chains in the Genus database with same CATH topology
 4NOL A;  2YU9 A;  1TL8 A;  3K5M A;  4O26 A;  3GTG A;  4IP9 A;  4KC6 A;  1MIU A;  1SFO A;  3DU6 A;  4H3T A;  1I50 A;  1RRJ A;  1TWG A;  1WCM A;  3K5L A;  3KYL A;  2VUM A;  4C2M A;  2CW0 D;  3GTL A;  1TWH A;  2R4G A;  2E2I A;  1I6V D;  2B9S B;  2JA6 A;  4IP8 A;  1TWF A;  3CQZ A;  1NH3 A;  1IW7 D;  4OYD B;  1IS1 A;  5MLC 9;  2A6E D;  4JLR C;  2E2H A;  2NVY A;  1SEU A;  1SMY D;  4KB4 A;  2F4Q A;  1ISE A;  4KDD A;  3K57 A;  2A69 D;  1YNN D;  1EH1 A;  2A68 D;  4LMO A;  1Y1W A;  3GTQ A;  1V9M A;  3LF9 A;  1R9T A;  1I3Q A;  3GTM A;  4FYD A;  4NOK A;  1Y69 8;  1WQF A;  4D3Z A;  4FGU A;  3DU5 A;  3K58 A;  2NVX A;  1LPQ A;  1EJ9 A;  4Q5V A;  1K4S A;  2R92 A;  3GTP A;  2R93 A;  1TWA A;  1A35 A;  2JA7 A;  4F3E A;  3MAQ A;  2WB1 A;  1Q8I A;  1K4T A;  1GE9 A;  3LHP S;  1R5Z A;  3P9A A;  3K5N A;  2Y0S A;  4NOM A;  1A36 A;  2A6H D;  1TWC A;  2B63 A;  4AHC A;  4FXD A;  1RR8 C;  1ZYR D;  4D3Y A;  2BE5 D;  3FKI A;  1WQG A;  5JSN B;  4L8I A;  2O5J D;  1TGO A;  1T8I A;  1DD5 A;  1EK8 A;  3M4A A;  2JA5 A;  4AN8 A;  1YNJ D;  1SC7 A;  3H0G A;  5JSB B;  3WVO A;  3IAY A;  3GTK A;  4QIW A;  3SJR A;  1A31 A;  3K5O A;  5C9H A;  4GFQ A;  3K59 A;  2WAQ A;  4QCL A;  1R49 A;  4KAW X;  3GTO A;  2PMZ A;  1Y1V A;  3GTJ A;  1K83 A;  2R7Z A;  4KB2 A;  4Q5G A;  1HQM D;  1WQH A;  4AYB A;  4EJ3 A;  5CQG A;  3HKZ A; 
#chains in the Genus database with same CATH homology
 4NOL A;  2YU9 A;  1TL8 A;  3K5M A;  4O26 A;  3GTG A;  4IP9 A;  4KC6 A;  1MIU A;  1SFO A;  3DU6 A;  4H3T A;  1I50 A;  1RRJ A;  1TWG A;  1WCM A;  3K5L A;  3KYL A;  2VUM A;  4C2M A;  2CW0 D;  3GTL A;  1TWH A;  2R4G A;  2E2I A;  1I6V D;  2B9S B;  2JA6 A;  4IP8 A;  1TWF A;  3CQZ A;  1NH3 A;  1IW7 D;  4OYD B;  1IS1 A;  5MLC 9;  2A6E D;  4JLR C;  2E2H A;  2NVY A;  1SEU A;  1SMY D;  4KB4 A;  2F4Q A;  1ISE A;  4KDD A;  3K57 A;  2A69 D;  1YNN D;  1EH1 A;  2A68 D;  4LMO A;  1Y1W A;  3GTQ A;  1V9M A;  3LF9 A;  1R9T A;  1I3Q A;  3GTM A;  4FYD A;  4NOK A;  1Y69 8;  1WQF A;  4D3Z A;  4FGU A;  3DU5 A;  3K58 A;  2NVX A;  1LPQ A;  1EJ9 A;  4Q5V A;  1K4S A;  2R92 A;  3GTP A;  2R93 A;  1TWA A;  1A35 A;  2JA7 A;  4F3E A;  3MAQ A;  2WB1 A;  1Q8I A;  1K4T A;  1GE9 A;  3LHP S;  1R5Z A;  3P9A A;  3K5N A;  2Y0S A;  4NOM A;  1A36 A;  2A6H D;  1TWC A;  2B63 A;  4AHC A;  4FXD A;  1RR8 C;  1ZYR D;  4D3Y A;  2BE5 D;  3FKI A;  1WQG A;  5JSN B;  4L8I A;  2O5J D;  1TGO A;  1T8I A;  1DD5 A;  1EK8 A;  3M4A A;  2JA5 A;  4AN8 A;  1YNJ D;  1SC7 A;  3H0G A;  5JSB B;  3WVO A;  3IAY A;  3GTK A;  4QIW A;  3SJR A;  1A31 A;  3K5O A;  5C9H A;  4GFQ A;  3K59 A;  2WAQ A;  4QCL A;  1R49 A;  4KAW X;  3GTO A;  2PMZ A;  1Y1V A;  3GTJ A;  1K83 A;  2R7Z A;  4KB2 A;  4Q5G A;  1HQM D;  1WQH A;  4AYB A;  4EJ3 A;  5CQG A;  3HKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...