2B9SB

Crystal structure of heterodimeric l. donovani topoisomerase i-vanadate-dna complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
KAVSLGTSKINYIDPRIICSWAKAQDVPINKIFSATIQKKFPWAMNAENFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*TP*T)-3'
publication title The Structure of the Transition State of the Heterodimeric Topoisomerase I of Leishmania donovani as a Vanadate Complex with Nicked DNA.
pubmed doi rcsb
source organism Leishmania donovani
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 2005-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.10 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 2b9sB00
1T8IA 1A31A 1A35A 1LPQA 1NH3A 1EJ9A 1RRJA 1TL8A 2B9SB 1K4SA 1R49A 1K4TA 1A36A 1RR8C 1SEUA 1SC7A
chains in the Genus database with same CATH superfamily
4KDDA 4D3ZA 1TWHA 2YU9A 4NOLA 4FGUA 4KC6A 5CQGA 4GFQA 3K59A 2E2IA 4D3YA 2E2HA 2JA5A 1K4SA 1R49A 4JLRC 1TWGA 1I6VD 2A6HD 1EH1A 1TWCA 3WVOA 1K4TA 4IP8A 1WCMA 1K83A 3H0GA 3GTPA 2B63A 2R92A 2CW0D 4H3TA 1Y1VA 4Q5VA 1HQMD 1Q8IA 3GTKA 4KAWX 2NVXA 3SJRA 1YNND 4KB2A 1IW7D 1EK8A 4O26A 2F4QA 4QIWA 2JA7A 3GTJA 1NH3A 2B9SB 1TWFA 2PMZA 4NOMA 2NVYA 4KB4A 3KYLA 1A31A 2R4GA 3CQZA 3K58A 1RRJA 2R93A 1Y698 1GE9A 2WB1A 2A68D 3LF9A 4FYDA 1R5ZA 4IP9A 1TL8A 3GTOA 2Y0SA 4QCLA 2JA6A 2O5JD 1ISEA 1LPQA 1SMYD 3GTQA 4Q5GA 3GTLA 2A69D 1DD5A 1I50A 4FXDA 1MIUA 3HKZA 2VUMA 1WQFA 4AYBA 4C2MA 3K5OA 3DU5A 3GTGA 5MLC9 3GTMA 1WQGA 1EJ9A 3LHPS 3FKIA 2A6ED 1RR8C 1SEUA 1T8IA 3DU6A 1I3QA 1IS1A 5JSNB 5JSBB 4AN8A 3K5NA 3K5LA 3MAQA 3M4AA 1R9TA 1SFOA 2R7ZA 1SC7A 1A35A 3IAYA 1TGOA 4EJ3A 1YNJD 3K57A 1ZYRD 5C9HA 2WAQA 1V9MA 4F3EA 1A36A 1Y1WA 2BE5D 4L8IA 1TWAA 4LMOA 4OYDB 3P9AA 3K5MA 1WQHA 4AHCA 4NOKA
chains in the Genus database with same CATH topology
4KDDA 4D3ZA 1TWHA 2YU9A 4NOLA 4FGUA 4KC6A 5CQGA 4GFQA 3K59A 2E2IA 4D3YA 2E2HA 2JA5A 1K4SA 1R49A 4JLRC 1TWGA 1I6VD 2A6HD 1EH1A 1TWCA 3WVOA 1K4TA 4IP8A 1WCMA 1K83A 3H0GA 3GTPA 2B63A 2R92A 2CW0D 4H3TA 1Y1VA 4Q5VA 1HQMD 1Q8IA 3GTKA 4KAWX 2NVXA 3SJRA 1YNND 4KB2A 1IW7D 1EK8A 4O26A 2F4QA 4QIWA 2JA7A 3GTJA 1NH3A 2B9SB 1TWFA 2PMZA 4NOMA 2NVYA 4KB4A 3KYLA 1A31A 2R4GA 3CQZA 3K58A 1RRJA 2R93A 1Y698 1GE9A 2WB1A 2A68D 3LF9A 4FYDA 1R5ZA 4IP9A 1TL8A 3GTOA 2Y0SA 4QCLA 2JA6A 2O5JD 1ISEA 1LPQA 1SMYD 3GTQA 4Q5GA 3GTLA 2A69D 1DD5A 1I50A 4FXDA 1MIUA 3HKZA 2VUMA 1WQFA 4AYBA 4C2MA 3K5OA 3DU5A 3GTGA 5MLC9 3GTMA 1WQGA 1EJ9A 3LHPS 3FKIA 2A6ED 1RR8C 1SEUA 1T8IA 3DU6A 1I3QA 1IS1A 5JSNB 5JSBB 4AN8A 3K5NA 3K5LA 3MAQA 3M4AA 1R9TA 1SFOA 2R7ZA 1SC7A 1A35A 3IAYA 1TGOA 4EJ3A 1YNJD 3K57A 1ZYRD 5C9HA 2WAQA 1V9MA 4F3EA 1A36A 1Y1WA 2BE5D 4L8IA 1TWAA 4LMOA 4OYDB 3P9AA 3K5MA 1WQHA 4AHCA 4NOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T8I A;  1A31 A;  1A35 A;  1LPQ A;  1NH3 A;  1EJ9 A;  1RRJ A;  1TL8 A;  2B9S B;  1K4S A;  1R49 A;  1K4T A;  1A36 A;  1RR8 C;  1SEU A;  1SC7 A; 
#chains in the Genus database with same CATH topology
 4KDD A;  4D3Z A;  1TWH A;  2YU9 A;  4NOL A;  4FGU A;  4KC6 A;  5CQG A;  4GFQ A;  3K59 A;  2E2I A;  4D3Y A;  2E2H A;  2JA5 A;  1K4S A;  1R49 A;  4JLR C;  1TWG A;  1I6V D;  2A6H D;  1EH1 A;  1TWC A;  3WVO A;  1K4T A;  4IP8 A;  1WCM A;  1K83 A;  3H0G A;  3GTP A;  2B63 A;  2R92 A;  2CW0 D;  4H3T A;  1Y1V A;  4Q5V A;  1HQM D;  1Q8I A;  3GTK A;  4KAW X;  2NVX A;  3SJR A;  1YNN D;  4KB2 A;  1IW7 D;  1EK8 A;  4O26 A;  2F4Q A;  4QIW A;  2JA7 A;  3GTJ A;  1NH3 A;  2B9S B;  1TWF A;  2PMZ A;  4NOM A;  2NVY A;  4KB4 A;  3KYL A;  1A31 A;  2R4G A;  3CQZ A;  3K58 A;  1RRJ A;  2R93 A;  1Y69 8;  1GE9 A;  2WB1 A;  2A68 D;  3LF9 A;  4FYD A;  1R5Z A;  4IP9 A;  1TL8 A;  3GTO A;  2Y0S A;  4QCL A;  2JA6 A;  2O5J D;  1ISE A;  1LPQ A;  1SMY D;  3GTQ A;  4Q5G A;  3GTL A;  2A69 D;  1DD5 A;  1I50 A;  4FXD A;  1MIU A;  3HKZ A;  2VUM A;  1WQF A;  4AYB A;  4C2M A;  3K5O A;  3DU5 A;  3GTG A;  5MLC 9;  3GTM A;  1WQG A;  1EJ9 A;  3LHP S;  3FKI A;  2A6E D;  1RR8 C;  1SEU A;  1T8I A;  3DU6 A;  1I3Q A;  1IS1 A;  5JSN B;  5JSB B;  4AN8 A;  3K5N A;  3K5L A;  3MAQ A;  3M4A A;  1R9T A;  1SFO A;  2R7Z A;  1SC7 A;  1A35 A;  3IAY A;  1TGO A;  4EJ3 A;  1YNJ D;  3K57 A;  1ZYR D;  5C9H A;  2WAQ A;  1V9M A;  4F3E A;  1A36 A;  1Y1W A;  2BE5 D;  4L8I A;  1TWA A;  4LMO A;  4OYD B;  3P9A A;  3K5M A;  1WQH A;  4AHC A;  4NOK A; 
#chains in the Genus database with same CATH homology
 4KDD A;  4D3Z A;  1TWH A;  2YU9 A;  4NOL A;  4FGU A;  4KC6 A;  5CQG A;  4GFQ A;  3K59 A;  2E2I A;  4D3Y A;  2E2H A;  2JA5 A;  1K4S A;  1R49 A;  4JLR C;  1TWG A;  1I6V D;  2A6H D;  1EH1 A;  1TWC A;  3WVO A;  1K4T A;  4IP8 A;  1WCM A;  1K83 A;  3H0G A;  3GTP A;  2B63 A;  2R92 A;  2CW0 D;  4H3T A;  1Y1V A;  4Q5V A;  1HQM D;  1Q8I A;  3GTK A;  4KAW X;  2NVX A;  3SJR A;  1YNN D;  4KB2 A;  1IW7 D;  1EK8 A;  4O26 A;  2F4Q A;  4QIW A;  2JA7 A;  3GTJ A;  1NH3 A;  2B9S B;  1TWF A;  2PMZ A;  4NOM A;  2NVY A;  4KB4 A;  3KYL A;  1A31 A;  2R4G A;  3CQZ A;  3K58 A;  1RRJ A;  2R93 A;  1Y69 8;  1GE9 A;  2WB1 A;  2A68 D;  3LF9 A;  4FYD A;  1R5Z A;  4IP9 A;  1TL8 A;  3GTO A;  2Y0S A;  4QCL A;  2JA6 A;  2O5J D;  1ISE A;  1LPQ A;  1SMY D;  3GTQ A;  4Q5G A;  3GTL A;  2A69 D;  1DD5 A;  1I50 A;  4FXD A;  1MIU A;  3HKZ A;  2VUM A;  1WQF A;  4AYB A;  4C2M A;  3K5O A;  3DU5 A;  3GTG A;  5MLC 9;  3GTM A;  1WQG A;  1EJ9 A;  3LHP S;  3FKI A;  2A6E D;  1RR8 C;  1SEU A;  1T8I A;  3DU6 A;  1I3Q A;  1IS1 A;  5JSN B;  5JSB B;  4AN8 A;  3K5N A;  3K5L A;  3MAQ A;  3M4A A;  1R9T A;  1SFO A;  2R7Z A;  1SC7 A;  1A35 A;  3IAY A;  1TGO A;  4EJ3 A;  1YNJ D;  3K57 A;  1ZYR D;  5C9H A;  2WAQ A;  1V9M A;  4F3E A;  1A36 A;  1Y1W A;  2BE5 D;  4L8I A;  1TWA A;  4LMO A;  4OYD B;  3P9A A;  3K5M A;  1WQH A;  4AHC A;  4NOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...