2B9SB

Crystal structure of heterodimeric l. donovani topoisomerase i-vanadate-dna complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
KAVSLGTSKINYIDPRIICSWAKAQDVPINKIFSATIQKKFPWAMNAENFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*TP*T)-3'
publication title The Structure of the Transition State of the Heterodimeric Topoisomerase I of Leishmania donovani as a Vanadate Complex with Nicked DNA.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Isomerase/dna
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 2005-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.10 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 2b9sB00
1RRJA 1T8IA 1NH3A 1K4TA 2B9SB 1A35A 1A36A 1SC7A 1SEUA 1RR8C 1TL8A 1K4SA 1EJ9A 1R49A 1LPQA 1A31A
chains in the Genus database with same CATH superfamily
2PMZA 4KC6A 3DU6A 1RR8C 2JA6A 5C9HA 1WQHA 1Y698 3K5MA 3K57A 3GTQA 1Y1VA 4D3ZA 1TWFA 1YNND 4QCLA 1DD5A 2E2IA 1IS1A 2VUMA 4NOLA 4C2MA 1Q8IA 5JSNB 3GTLA 1K4TA 2JA5A 3P9AA 1A31A 1TWAA 1Y1WA 4Q5VA 4AYBA 2NVYA 1EJ9A 1GE9A 3H0GA 1I3QA 2O5JD 1I6VD 2R4GA 4Q5GA 3GTKA 4KB2A 1I50A 3K58A 1T8IA 3MAQA 2CW0D 4JLRC 1IW7D 4OYDB 2A69D 1ZYRD 5JSBB 3K59A 2R93A 4LMOA 4QIWA 4AN8A 1WQFA 3GTJA 1TWCA 5CQGA 2E2HA 1EK8A 3WVOA 3K5LA 2B63A 1R9TA 2A6ED 1WQGA 3LHPS 1SMYD 3M4AA 4IP9A 4EJ3A 3HKZA 1A36A 3K5NA 3CQZA 4IP8A 1YNJD 1R49A 3GTPA 4AHCA 1TWHA 1TWGA 3GTOA 4KDDA 3K5OA 4L8IA 2NVXA 2B9SB 2YU9A 1SC7A 1SFOA 1K4SA 1LPQA 4D3YA 2R92A 4O26A 3DU5A 2R7ZA 1RRJA 1HQMD 4NOMA 2Y0SA 1ISEA 5MLC9 3LF9A 4FXDA 1TGOA 2JA7A 4FGUA 2WB1A 1SEUA 3FKIA 1EH1A 1TL8A 3GTGA 2F4QA 1WCMA 1R5ZA 2A68D 4FYDA 2WAQA 3IAYA 3GTMA 4H3TA 3KYLA 4KAWX 2BE5D 2A6HD 1NH3A 4NOKA 4F3EA 1A35A 3SJRA 1K83A 4KB4A 1V9MA 4GFQA 1MIUA
chains in the Genus database with same CATH topology
2PMZA 4KC6A 3DU6A 1RR8C 2JA6A 5C9HA 1WQHA 1Y698 3K5MA 3K57A 3GTQA 1Y1VA 4D3ZA 1TWFA 1YNND 4QCLA 1DD5A 2E2IA 1IS1A 2VUMA 4NOLA 4C2MA 1Q8IA 5JSNB 3GTLA 1K4TA 2JA5A 3P9AA 1A31A 1TWAA 1Y1WA 4Q5VA 4AYBA 2NVYA 1EJ9A 1GE9A 3H0GA 1I3QA 2O5JD 1I6VD 2R4GA 4Q5GA 3GTKA 4KB2A 1I50A 3K58A 1T8IA 3MAQA 2CW0D 4JLRC 1IW7D 4OYDB 2A69D 1ZYRD 5JSBB 3K59A 2R93A 4LMOA 4QIWA 4AN8A 1WQFA 3GTJA 1TWCA 5CQGA 2E2HA 1EK8A 3WVOA 3K5LA 2B63A 1R9TA 2A6ED 1WQGA 3LHPS 1SMYD 3M4AA 4IP9A 4EJ3A 3HKZA 1A36A 3K5NA 3CQZA 4IP8A 1YNJD 1R49A 3GTPA 4AHCA 1TWHA 1TWGA 3GTOA 4KDDA 3K5OA 4L8IA 2NVXA 2B9SB 2YU9A 1SC7A 1SFOA 1K4SA 1LPQA 4D3YA 2R92A 4O26A 3DU5A 2R7ZA 1RRJA 1HQMD 4NOMA 2Y0SA 1ISEA 5MLC9 3LF9A 4FXDA 1TGOA 2JA7A 4FGUA 2WB1A 1SEUA 3FKIA 1EH1A 1TL8A 3GTGA 2F4QA 1WCMA 1R5ZA 2A68D 4FYDA 2WAQA 3IAYA 3GTMA 4H3TA 3KYLA 4KAWX 2BE5D 2A6HD 1NH3A 4NOKA 4F3EA 1A35A 3SJRA 1K83A 4KB4A 1V9MA 4GFQA 1MIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRJ A;  1T8I A;  1NH3 A;  1K4T A;  2B9S B;  1A35 A;  1A36 A;  1SC7 A;  1SEU A;  1RR8 C;  1TL8 A;  1K4S A;  1EJ9 A;  1R49 A;  1LPQ A;  1A31 A; 
#chains in the Genus database with same CATH topology
 2PMZ A;  4KC6 A;  3DU6 A;  1RR8 C;  2JA6 A;  5C9H A;  1WQH A;  1Y69 8;  3K5M A;  3K57 A;  3GTQ A;  1Y1V A;  4D3Z A;  1TWF A;  1YNN D;  4QCL A;  1DD5 A;  2E2I A;  1IS1 A;  2VUM A;  4NOL A;  4C2M A;  1Q8I A;  5JSN B;  3GTL A;  1K4T A;  2JA5 A;  3P9A A;  1A31 A;  1TWA A;  1Y1W A;  4Q5V A;  4AYB A;  2NVY A;  1EJ9 A;  1GE9 A;  3H0G A;  1I3Q A;  2O5J D;  1I6V D;  2R4G A;  4Q5G A;  3GTK A;  4KB2 A;  1I50 A;  3K58 A;  1T8I A;  3MAQ A;  2CW0 D;  4JLR C;  1IW7 D;  4OYD B;  2A69 D;  1ZYR D;  5JSB B;  3K59 A;  2R93 A;  4LMO A;  4QIW A;  4AN8 A;  1WQF A;  3GTJ A;  1TWC A;  5CQG A;  2E2H A;  1EK8 A;  3WVO A;  3K5L A;  2B63 A;  1R9T A;  2A6E D;  1WQG A;  3LHP S;  1SMY D;  3M4A A;  4IP9 A;  4EJ3 A;  3HKZ A;  1A36 A;  3K5N A;  3CQZ A;  4IP8 A;  1YNJ D;  1R49 A;  3GTP A;  4AHC A;  1TWH A;  1TWG A;  3GTO A;  4KDD A;  3K5O A;  4L8I A;  2NVX A;  2B9S B;  2YU9 A;  1SC7 A;  1SFO A;  1K4S A;  1LPQ A;  4D3Y A;  2R92 A;  4O26 A;  3DU5 A;  2R7Z A;  1RRJ A;  1HQM D;  4NOM A;  2Y0S A;  1ISE A;  5MLC 9;  3LF9 A;  4FXD A;  1TGO A;  2JA7 A;  4FGU A;  2WB1 A;  1SEU A;  3FKI A;  1EH1 A;  1TL8 A;  3GTG A;  2F4Q A;  1WCM A;  1R5Z A;  2A68 D;  4FYD A;  2WAQ A;  3IAY A;  3GTM A;  4H3T A;  3KYL A;  4KAW X;  2BE5 D;  2A6H D;  1NH3 A;  4NOK A;  4F3E A;  1A35 A;  3SJR A;  1K83 A;  4KB4 A;  1V9M A;  4GFQ A;  1MIU A; 
#chains in the Genus database with same CATH homology
 2PMZ A;  4KC6 A;  3DU6 A;  1RR8 C;  2JA6 A;  5C9H A;  1WQH A;  1Y69 8;  3K5M A;  3K57 A;  3GTQ A;  1Y1V A;  4D3Z A;  1TWF A;  1YNN D;  4QCL A;  1DD5 A;  2E2I A;  1IS1 A;  2VUM A;  4NOL A;  4C2M A;  1Q8I A;  5JSN B;  3GTL A;  1K4T A;  2JA5 A;  3P9A A;  1A31 A;  1TWA A;  1Y1W A;  4Q5V A;  4AYB A;  2NVY A;  1EJ9 A;  1GE9 A;  3H0G A;  1I3Q A;  2O5J D;  1I6V D;  2R4G A;  4Q5G A;  3GTK A;  4KB2 A;  1I50 A;  3K58 A;  1T8I A;  3MAQ A;  2CW0 D;  4JLR C;  1IW7 D;  4OYD B;  2A69 D;  1ZYR D;  5JSB B;  3K59 A;  2R93 A;  4LMO A;  4QIW A;  4AN8 A;  1WQF A;  3GTJ A;  1TWC A;  5CQG A;  2E2H A;  1EK8 A;  3WVO A;  3K5L A;  2B63 A;  1R9T A;  2A6E D;  1WQG A;  3LHP S;  1SMY D;  3M4A A;  4IP9 A;  4EJ3 A;  3HKZ A;  1A36 A;  3K5N A;  3CQZ A;  4IP8 A;  1YNJ D;  1R49 A;  3GTP A;  4AHC A;  1TWH A;  1TWG A;  3GTO A;  4KDD A;  3K5O A;  4L8I A;  2NVX A;  2B9S B;  2YU9 A;  1SC7 A;  1SFO A;  1K4S A;  1LPQ A;  4D3Y A;  2R92 A;  4O26 A;  3DU5 A;  2R7Z A;  1RRJ A;  1HQM D;  4NOM A;  2Y0S A;  1ISE A;  5MLC 9;  3LF9 A;  4FXD A;  1TGO A;  2JA7 A;  4FGU A;  2WB1 A;  1SEU A;  3FKI A;  1EH1 A;  1TL8 A;  3GTG A;  2F4Q A;  1WCM A;  1R5Z A;  2A68 D;  4FYD A;  2WAQ A;  3IAY A;  3GTM A;  4H3T A;  3KYL A;  4KAW X;  2BE5 D;  2A6H D;  1NH3 A;  4NOK A;  4F3E A;  1A35 A;  3SJR A;  1K83 A;  4KB4 A;  1V9M A;  4GFQ A;  1MIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...