4Q5GA

Crystal structure of mouse serum amyloid a3
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
99
Chain Sequence
RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Serum amyloid A-3 protein
publication title Biochemical and structural analysis reveals a retinol binding function for serum amyloid A proteins
rcsb
source organism Mus musculus
total genus 41
structure length 99
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00277 SAA Serum amyloid A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.110 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4q5gA00
4Q5GA 4IP9A 4IP8A
chains in the Genus database with same CATH superfamily
1SMYD 3LHPS 4EJ3A 3M4AA 3K5OA 3GTOA 3DU5A 3GTKA 1TWFA 3HKZA 1RR8C 2A6HD 1T8IA 2Y0SA 1A31A 2R7ZA 3GTQA 2JA7A 1V9MA 1WQFA 4AHCA 1IS1A 3K5NA 2JA5A 4F3EA 1TGOA 1Y1WA 1IW7D 3K59A 1TWAA 4FYDA 1Q8IA 4IP8A 1WQHA 4AN8A 3GTLA 2WB1A 3K58A 1R5ZA 4LMOA 4Q5GA 2JA6A 5C9HA 1LPQA 2BE5D 3GTGA 4KB4A 1NH3A 2WAQA 4IP9A 4KC6A 1TL8A 3DU6A 5JSNB 4L8IA 4H3TA 3P9AA 3MAQA 2R4GA 2YU9A 2R93A 3K5LA 1WQGA 4NOMA 1GE9A 1TWGA 1R9TA 1I3QA 2CW0D 4NOKA 1ZYRD 4C2MA 3H0GA 4KAWX 1DD5A 3SJRA 4KB2A 1ISEA 3GTPA 2R92A 4O26A 5CQGA 1WCMA 2A68D 2B9SB 4JLRC 4D3ZA 1TWCA 3K5MA 2E2IA 4NOLA 1SC7A 4FXDA 1SEUA 1YNJD 1RRJA 5JSBB 3GTJA 4D3YA 4Q5VA 1MIUA 4KDDA 1HQMD 4AYBA 1K4SA 3KYLA 4QIWA 2NVXA 2A6ED 1R49A 1K83A 2VUMA 5MLC9 2A69D 4OYDB 1A36A 4FGUA 3LF9A 1EJ9A 2O5JD 3K57A 1EH1A 2E2HA 1Y698 1TWHA 1I50A 3IAYA 1I6VD 3FKIA 1Y1VA 4QCLA 1K4TA 1YNND 3GTMA 1EK8A 3CQZA 4GFQA 2NVYA 3WVOA 2PMZA 2F4QA 1A35A 2B63A 1SFOA
chains in the Genus database with same CATH topology
1SMYD 3LHPS 4EJ3A 3M4AA 3K5OA 3GTOA 3DU5A 3GTKA 1TWFA 3HKZA 1RR8C 2A6HD 1T8IA 2Y0SA 1A31A 2R7ZA 3GTQA 2JA7A 1V9MA 1WQFA 4AHCA 1IS1A 3K5NA 2JA5A 4F3EA 1TGOA 1Y1WA 1IW7D 3K59A 1TWAA 4FYDA 1Q8IA 4IP8A 1WQHA 4AN8A 3GTLA 2WB1A 3K58A 1R5ZA 4LMOA 4Q5GA 2JA6A 5C9HA 1LPQA 2BE5D 3GTGA 4KB4A 1NH3A 2WAQA 4IP9A 4KC6A 1TL8A 3DU6A 5JSNB 4L8IA 4H3TA 3P9AA 3MAQA 2R4GA 2YU9A 2R93A 3K5LA 1WQGA 4NOMA 1GE9A 1TWGA 1R9TA 1I3QA 2CW0D 4NOKA 1ZYRD 4C2MA 3H0GA 4KAWX 1DD5A 3SJRA 4KB2A 1ISEA 3GTPA 2R92A 4O26A 5CQGA 1WCMA 2A68D 2B9SB 4JLRC 4D3ZA 1TWCA 3K5MA 2E2IA 4NOLA 1SC7A 4FXDA 1SEUA 1YNJD 1RRJA 5JSBB 3GTJA 4D3YA 4Q5VA 1MIUA 4KDDA 1HQMD 4AYBA 1K4SA 3KYLA 4QIWA 2NVXA 2A6ED 1R49A 1K83A 2VUMA 5MLC9 2A69D 4OYDB 1A36A 4FGUA 3LF9A 1EJ9A 2O5JD 3K57A 1EH1A 2E2HA 1Y698 1TWHA 1I50A 3IAYA 1I6VD 3FKIA 1Y1VA 4QCLA 1K4TA 1YNND 3GTMA 1EK8A 3CQZA 4GFQA 2NVYA 3WVOA 2PMZA 2F4QA 1A35A 2B63A 1SFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5G A;  4IP9 A;  4IP8 A; 
#chains in the Genus database with same CATH topology
 1SMY D;  3LHP S;  4EJ3 A;  3M4A A;  3K5O A;  3GTO A;  3DU5 A;  3GTK A;  1TWF A;  3HKZ A;  1RR8 C;  2A6H D;  1T8I A;  2Y0S A;  1A31 A;  2R7Z A;  3GTQ A;  2JA7 A;  1V9M A;  1WQF A;  4AHC A;  1IS1 A;  3K5N A;  2JA5 A;  4F3E A;  1TGO A;  1Y1W A;  1IW7 D;  3K59 A;  1TWA A;  4FYD A;  1Q8I A;  4IP8 A;  1WQH A;  4AN8 A;  3GTL A;  2WB1 A;  3K58 A;  1R5Z A;  4LMO A;  4Q5G A;  2JA6 A;  5C9H A;  1LPQ A;  2BE5 D;  3GTG A;  4KB4 A;  1NH3 A;  2WAQ A;  4IP9 A;  4KC6 A;  1TL8 A;  3DU6 A;  5JSN B;  4L8I A;  4H3T A;  3P9A A;  3MAQ A;  2R4G A;  2YU9 A;  2R93 A;  3K5L A;  1WQG A;  4NOM A;  1GE9 A;  1TWG A;  1R9T A;  1I3Q A;  2CW0 D;  4NOK A;  1ZYR D;  4C2M A;  3H0G A;  4KAW X;  1DD5 A;  3SJR A;  4KB2 A;  1ISE A;  3GTP A;  2R92 A;  4O26 A;  5CQG A;  1WCM A;  2A68 D;  2B9S B;  4JLR C;  4D3Z A;  1TWC A;  3K5M A;  2E2I A;  4NOL A;  1SC7 A;  4FXD A;  1SEU A;  1YNJ D;  1RRJ A;  5JSB B;  3GTJ A;  4D3Y A;  4Q5V A;  1MIU A;  4KDD A;  1HQM D;  4AYB A;  1K4S A;  3KYL A;  4QIW A;  2NVX A;  2A6E D;  1R49 A;  1K83 A;  2VUM A;  5MLC 9;  2A69 D;  4OYD B;  1A36 A;  4FGU A;  3LF9 A;  1EJ9 A;  2O5J D;  3K57 A;  1EH1 A;  2E2H A;  1Y69 8;  1TWH A;  1I50 A;  3IAY A;  1I6V D;  3FKI A;  1Y1V A;  4QCL A;  1K4T A;  1YNN D;  3GTM A;  1EK8 A;  3CQZ A;  4GFQ A;  2NVY A;  3WVO A;  2PMZ A;  2F4Q A;  1A35 A;  2B63 A;  1SFO A; 
#chains in the Genus database with same CATH homology
 1SMY D;  3LHP S;  4EJ3 A;  3M4A A;  3K5O A;  3GTO A;  3DU5 A;  3GTK A;  1TWF A;  3HKZ A;  1RR8 C;  2A6H D;  1T8I A;  2Y0S A;  1A31 A;  2R7Z A;  3GTQ A;  2JA7 A;  1V9M A;  1WQF A;  4AHC A;  1IS1 A;  3K5N A;  2JA5 A;  4F3E A;  1TGO A;  1Y1W A;  1IW7 D;  3K59 A;  1TWA A;  4FYD A;  1Q8I A;  4IP8 A;  1WQH A;  4AN8 A;  3GTL A;  2WB1 A;  3K58 A;  1R5Z A;  4LMO A;  4Q5G A;  2JA6 A;  5C9H A;  1LPQ A;  2BE5 D;  3GTG A;  4KB4 A;  1NH3 A;  2WAQ A;  4IP9 A;  4KC6 A;  1TL8 A;  3DU6 A;  5JSN B;  4L8I A;  4H3T A;  3P9A A;  3MAQ A;  2R4G A;  2YU9 A;  2R93 A;  3K5L A;  1WQG A;  4NOM A;  1GE9 A;  1TWG A;  1R9T A;  1I3Q A;  2CW0 D;  4NOK A;  1ZYR D;  4C2M A;  3H0G A;  4KAW X;  1DD5 A;  3SJR A;  4KB2 A;  1ISE A;  3GTP A;  2R92 A;  4O26 A;  5CQG A;  1WCM A;  2A68 D;  2B9S B;  4JLR C;  4D3Z A;  1TWC A;  3K5M A;  2E2I A;  4NOL A;  1SC7 A;  4FXD A;  1SEU A;  1YNJ D;  1RRJ A;  5JSB B;  3GTJ A;  4D3Y A;  4Q5V A;  1MIU A;  4KDD A;  1HQM D;  4AYB A;  1K4S A;  3KYL A;  4QIW A;  2NVX A;  2A6E D;  1R49 A;  1K83 A;  2VUM A;  5MLC 9;  2A69 D;  4OYD B;  1A36 A;  4FGU A;  3LF9 A;  1EJ9 A;  2O5J D;  3K57 A;  1EH1 A;  2E2H A;  1Y69 8;  1TWH A;  1I50 A;  3IAY A;  1I6V D;  3FKI A;  1Y1V A;  4QCL A;  1K4T A;  1YNN D;  3GTM A;  1EK8 A;  3CQZ A;  4GFQ A;  2NVY A;  3WVO A;  2PMZ A;  2F4Q A;  1A35 A;  2B63 A;  1SFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...