4Q5GA

Crystal structure of mouse serum amyloid a3
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
99
Chain Sequence
RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural analysis reveals a retinol binding function for serum amyloid A proteins
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Serum amyloid A-3 protein
total genus 41
structure length 99
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00277 SAA Serum amyloid A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.110 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4q5gA00
4Q5GA 4IP9A 4IP8A
chains in the Genus database with same CATH superfamily
1Y698 4AHCA 3LHPS 3DU6A 2NVYA 4QCLA 4IP9A 1MIUA 1Y1WA 1R5ZA 4NOMA 2NVXA 3GTMA 3GTLA 3P9AA 1WQFA 3K57A 3M4AA 1SEUA 3HKZA 4GFQA 1RR8C 3K59A 1EK8A 4O26A 1K4TA 2E2IA 4L8IA 4KC6A 1K83A 2R93A 4KB2A 1LPQA 2PMZA 1SMYD 1Y1VA 2CW0D 4OYDB 3IAYA 2VUMA 1K4SA 1T8IA 2R7ZA 3K5MA 4FGUA 1IS1A 4D3YA 1YNND 2A6ED 2BE5D 1WQHA 4EJ3A 2F4QA 2A6HD 2Y0SA 4NOKA 4QIWA 3MAQA 1HQMD 2WB1A 1A35A 4H3TA 3DU5A 3WVOA 2O5JD 4F3EA 4KB4A 2JA6A 1I6VD 4D3ZA 1TWGA 3CQZA 5JSBB 2E2HA 1GE9A 5JSNB 1EH1A 1TGOA 1V9MA 5C9HA 1TWFA 1TWAA 1WQGA 2R92A 4AYBA 4KDDA 4AN8A 2JA5A 3FKIA 3GTQA 1SC7A 4C2MA 1WCMA 4Q5VA 2YU9A 1I3QA 3K5LA 1SFOA 3GTPA 3GTOA 3H0GA 2R4GA 1A31A 3GTJA 2B9SB 1NH3A 3K5NA 5CQGA 1Q8IA 1A36A 3K5OA 4NOLA 1R49A 2WAQA 4KAWX 4FXDA 3LF9A 3SJRA 4FYDA 1YNJD 3GTGA 1TWCA 1IW7D 1RRJA 1I50A 3KYLA 5MLC9 1R9TA 2B63A 4Q5GA 1TL8A 2A68D 1ISEA 1DD5A 4JLRC 3K58A 1EJ9A 3GTKA 2A69D 1ZYRD 1TWHA 2JA7A 4LMOA 4IP8A
chains in the Genus database with same CATH topology
1Y698 4AHCA 3LHPS 3DU6A 2NVYA 4QCLA 4IP9A 1MIUA 1Y1WA 1R5ZA 4NOMA 2NVXA 3GTMA 3GTLA 3P9AA 1WQFA 3K57A 3M4AA 1SEUA 3HKZA 4GFQA 1RR8C 3K59A 1EK8A 4O26A 1K4TA 2E2IA 4L8IA 4KC6A 1K83A 2R93A 4KB2A 1LPQA 2PMZA 1SMYD 1Y1VA 2CW0D 4OYDB 3IAYA 2VUMA 1K4SA 1T8IA 2R7ZA 3K5MA 4FGUA 1IS1A 4D3YA 1YNND 2A6ED 2BE5D 1WQHA 4EJ3A 2F4QA 2A6HD 2Y0SA 4NOKA 4QIWA 3MAQA 1HQMD 2WB1A 1A35A 4H3TA 3DU5A 3WVOA 2O5JD 4F3EA 4KB4A 2JA6A 1I6VD 4D3ZA 1TWGA 3CQZA 5JSBB 2E2HA 1GE9A 5JSNB 1EH1A 1TGOA 1V9MA 5C9HA 1TWFA 1TWAA 1WQGA 2R92A 4AYBA 4KDDA 4AN8A 2JA5A 3FKIA 3GTQA 1SC7A 4C2MA 1WCMA 4Q5VA 2YU9A 1I3QA 3K5LA 1SFOA 3GTPA 3GTOA 3H0GA 2R4GA 1A31A 3GTJA 2B9SB 1NH3A 3K5NA 5CQGA 1Q8IA 1A36A 3K5OA 4NOLA 1R49A 2WAQA 4KAWX 4FXDA 3LF9A 3SJRA 4FYDA 1YNJD 3GTGA 1TWCA 1IW7D 1RRJA 1I50A 3KYLA 5MLC9 1R9TA 2B63A 4Q5GA 1TL8A 2A68D 1ISEA 1DD5A 4JLRC 3K58A 1EJ9A 3GTKA 2A69D 1ZYRD 1TWHA 2JA7A 4LMOA 4IP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5G A;  4IP9 A;  4IP8 A; 
#chains in the Genus database with same CATH topology
 1Y69 8;  4AHC A;  3LHP S;  3DU6 A;  2NVY A;  4QCL A;  4IP9 A;  1MIU A;  1Y1W A;  1R5Z A;  4NOM A;  2NVX A;  3GTM A;  3GTL A;  3P9A A;  1WQF A;  3K57 A;  3M4A A;  1SEU A;  3HKZ A;  4GFQ A;  1RR8 C;  3K59 A;  1EK8 A;  4O26 A;  1K4T A;  2E2I A;  4L8I A;  4KC6 A;  1K83 A;  2R93 A;  4KB2 A;  1LPQ A;  2PMZ A;  1SMY D;  1Y1V A;  2CW0 D;  4OYD B;  3IAY A;  2VUM A;  1K4S A;  1T8I A;  2R7Z A;  3K5M A;  4FGU A;  1IS1 A;  4D3Y A;  1YNN D;  2A6E D;  2BE5 D;  1WQH A;  4EJ3 A;  2F4Q A;  2A6H D;  2Y0S A;  4NOK A;  4QIW A;  3MAQ A;  1HQM D;  2WB1 A;  1A35 A;  4H3T A;  3DU5 A;  3WVO A;  2O5J D;  4F3E A;  4KB4 A;  2JA6 A;  1I6V D;  4D3Z A;  1TWG A;  3CQZ A;  5JSB B;  2E2H A;  1GE9 A;  5JSN B;  1EH1 A;  1TGO A;  1V9M A;  5C9H A;  1TWF A;  1TWA A;  1WQG A;  2R92 A;  4AYB A;  4KDD A;  4AN8 A;  2JA5 A;  3FKI A;  3GTQ A;  1SC7 A;  4C2M A;  1WCM A;  4Q5V A;  2YU9 A;  1I3Q A;  3K5L A;  1SFO A;  3GTP A;  3GTO A;  3H0G A;  2R4G A;  1A31 A;  3GTJ A;  2B9S B;  1NH3 A;  3K5N A;  5CQG A;  1Q8I A;  1A36 A;  3K5O A;  4NOL A;  1R49 A;  2WAQ A;  4KAW X;  4FXD A;  3LF9 A;  3SJR A;  4FYD A;  1YNJ D;  3GTG A;  1TWC A;  1IW7 D;  1RRJ A;  1I50 A;  3KYL A;  5MLC 9;  1R9T A;  2B63 A;  4Q5G A;  1TL8 A;  2A68 D;  1ISE A;  1DD5 A;  4JLR C;  3K58 A;  1EJ9 A;  3GTK A;  2A69 D;  1ZYR D;  1TWH A;  2JA7 A;  4LMO A;  4IP8 A; 
#chains in the Genus database with same CATH homology
 1Y69 8;  4AHC A;  3LHP S;  3DU6 A;  2NVY A;  4QCL A;  4IP9 A;  1MIU A;  1Y1W A;  1R5Z A;  4NOM A;  2NVX A;  3GTM A;  3GTL A;  3P9A A;  1WQF A;  3K57 A;  3M4A A;  1SEU A;  3HKZ A;  4GFQ A;  1RR8 C;  3K59 A;  1EK8 A;  4O26 A;  1K4T A;  2E2I A;  4L8I A;  4KC6 A;  1K83 A;  2R93 A;  4KB2 A;  1LPQ A;  2PMZ A;  1SMY D;  1Y1V A;  2CW0 D;  4OYD B;  3IAY A;  2VUM A;  1K4S A;  1T8I A;  2R7Z A;  3K5M A;  4FGU A;  1IS1 A;  4D3Y A;  1YNN D;  2A6E D;  2BE5 D;  1WQH A;  4EJ3 A;  2F4Q A;  2A6H D;  2Y0S A;  4NOK A;  4QIW A;  3MAQ A;  1HQM D;  2WB1 A;  1A35 A;  4H3T A;  3DU5 A;  3WVO A;  2O5J D;  4F3E A;  4KB4 A;  2JA6 A;  1I6V D;  4D3Z A;  1TWG A;  3CQZ A;  5JSB B;  2E2H A;  1GE9 A;  5JSN B;  1EH1 A;  1TGO A;  1V9M A;  5C9H A;  1TWF A;  1TWA A;  1WQG A;  2R92 A;  4AYB A;  4KDD A;  4AN8 A;  2JA5 A;  3FKI A;  3GTQ A;  1SC7 A;  4C2M A;  1WCM A;  4Q5V A;  2YU9 A;  1I3Q A;  3K5L A;  1SFO A;  3GTP A;  3GTO A;  3H0G A;  2R4G A;  1A31 A;  3GTJ A;  2B9S B;  1NH3 A;  3K5N A;  5CQG A;  1Q8I A;  1A36 A;  3K5O A;  4NOL A;  1R49 A;  2WAQ A;  4KAW X;  4FXD A;  3LF9 A;  3SJR A;  4FYD A;  1YNJ D;  3GTG A;  1TWC A;  1IW7 D;  1RRJ A;  1I50 A;  3KYL A;  5MLC 9;  1R9T A;  2B63 A;  4Q5G A;  1TL8 A;  2A68 D;  1ISE A;  1DD5 A;  4JLR C;  3K58 A;  1EJ9 A;  3GTK A;  2A69 D;  1ZYR D;  1TWH A;  2JA7 A;  4LMO A;  4IP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...