4Q5GA

Crystal structure of mouse serum amyloid a3
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
99
Chain Sequence
RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serum amyloid A-3 protein
publication title Biochemical and structural analysis reveals a retinol binding function for serum amyloid A proteins
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 41
structure length 99
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00277 SAA Serum amyloid A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.110 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4q5gA00
4Q5GA 4IP9A 4IP8A
chains in the Genus database with same CATH superfamily
4D3ZA 4F3EA 5CQGA 1Y1VA 2A69D 3GTGA 2A68D 3DU6A 1HQMD 1TWAA 3CQZA 3K5LA 3WVOA 4D3YA 1DD5A 4KC6A 3H0GA 3IAYA 5JSBB 1ISEA 1K4TA 1ZYRD 2JA7A 1A36A 2WAQA 2B63A 2JA6A 1TWFA 2R92A 1NH3A 1T8IA 1K4SA 4EJ3A 1SMYD 3SJRA 3GTOA 5JSNB 3K5MA 4KB2A 3K57A 4OYDB 3GTJA 5MLC9 4AYBA 3LF9A 3FKIA 2PMZA 1SEUA 1LPQA 4AN8A 4O26A 4Q5VA 3K5OA 1IS1A 2NVYA 3K58A 1WQFA 3DU5A 1TWGA 2R4GA 3GTLA 3GTKA 2F4QA 3LHPS 1Q8IA 4H3TA 4NOMA 1R5ZA 1A35A 2R93A 4AHCA 3M4AA 1WCMA 1R9TA 4C2MA 1TWCA 1V9MA 2A6ED 2WB1A 1I50A 2B9SB 3K59A 1RR8C 4JLRC 1WQHA 4GFQA 2BE5D 4FYDA 2NVXA 4QCLA 2E2IA 1SFOA 4QIWA 2VUMA 2A6HD 4KB4A 4IP8A 4KDDA 1R49A 1I6VD 1SC7A 2JA5A 1I3QA 1TL8A 2CW0D 1TWHA 1RRJA 3K5NA 3GTQA 1Y698 4LMOA 2YU9A 2E2HA 3P9AA 4NOKA 4KAWX 2R7ZA 4FXDA 1EJ9A 1K83A 3HKZA 4NOLA 1IW7D 4Q5GA 1YNND 3GTMA 4FGUA 1Y1WA 1GE9A 1WQGA 3MAQA 2Y0SA 4IP9A 1YNJD 1MIUA 1TGOA 1EH1A 2O5JD 4L8IA 3GTPA 3KYLA 5C9HA 1A31A 1EK8A
chains in the Genus database with same CATH topology
4D3ZA 4F3EA 5CQGA 1Y1VA 2A69D 3GTGA 2A68D 3DU6A 1HQMD 1TWAA 3CQZA 3K5LA 3WVOA 4D3YA 1DD5A 4KC6A 3H0GA 3IAYA 5JSBB 1ISEA 1K4TA 1ZYRD 2JA7A 1A36A 2WAQA 2B63A 2JA6A 1TWFA 2R92A 1NH3A 1T8IA 1K4SA 4EJ3A 1SMYD 3SJRA 3GTOA 5JSNB 3K5MA 4KB2A 3K57A 4OYDB 3GTJA 5MLC9 4AYBA 3LF9A 3FKIA 2PMZA 1SEUA 1LPQA 4AN8A 4O26A 4Q5VA 3K5OA 1IS1A 2NVYA 3K58A 1WQFA 3DU5A 1TWGA 2R4GA 3GTLA 3GTKA 2F4QA 3LHPS 1Q8IA 4H3TA 4NOMA 1R5ZA 1A35A 2R93A 4AHCA 3M4AA 1WCMA 1R9TA 4C2MA 1TWCA 1V9MA 2A6ED 2WB1A 1I50A 2B9SB 3K59A 1RR8C 4JLRC 1WQHA 4GFQA 2BE5D 4FYDA 2NVXA 4QCLA 2E2IA 1SFOA 4QIWA 2VUMA 2A6HD 4KB4A 4IP8A 4KDDA 1R49A 1I6VD 1SC7A 2JA5A 1I3QA 1TL8A 2CW0D 1TWHA 1RRJA 3K5NA 3GTQA 1Y698 4LMOA 2YU9A 2E2HA 3P9AA 4NOKA 4KAWX 2R7ZA 4FXDA 1EJ9A 1K83A 3HKZA 4NOLA 1IW7D 4Q5GA 1YNND 3GTMA 4FGUA 1Y1WA 1GE9A 1WQGA 3MAQA 2Y0SA 4IP9A 1YNJD 1MIUA 1TGOA 1EH1A 2O5JD 4L8IA 3GTPA 3KYLA 5C9HA 1A31A 1EK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5G A;  4IP9 A;  4IP8 A; 
#chains in the Genus database with same CATH topology
 4D3Z A;  4F3E A;  5CQG A;  1Y1V A;  2A69 D;  3GTG A;  2A68 D;  3DU6 A;  1HQM D;  1TWA A;  3CQZ A;  3K5L A;  3WVO A;  4D3Y A;  1DD5 A;  4KC6 A;  3H0G A;  3IAY A;  5JSB B;  1ISE A;  1K4T A;  1ZYR D;  2JA7 A;  1A36 A;  2WAQ A;  2B63 A;  2JA6 A;  1TWF A;  2R92 A;  1NH3 A;  1T8I A;  1K4S A;  4EJ3 A;  1SMY D;  3SJR A;  3GTO A;  5JSN B;  3K5M A;  4KB2 A;  3K57 A;  4OYD B;  3GTJ A;  5MLC 9;  4AYB A;  3LF9 A;  3FKI A;  2PMZ A;  1SEU A;  1LPQ A;  4AN8 A;  4O26 A;  4Q5V A;  3K5O A;  1IS1 A;  2NVY A;  3K58 A;  1WQF A;  3DU5 A;  1TWG A;  2R4G A;  3GTL A;  3GTK A;  2F4Q A;  3LHP S;  1Q8I A;  4H3T A;  4NOM A;  1R5Z A;  1A35 A;  2R93 A;  4AHC A;  3M4A A;  1WCM A;  1R9T A;  4C2M A;  1TWC A;  1V9M A;  2A6E D;  2WB1 A;  1I50 A;  2B9S B;  3K59 A;  1RR8 C;  4JLR C;  1WQH A;  4GFQ A;  2BE5 D;  4FYD A;  2NVX A;  4QCL A;  2E2I A;  1SFO A;  4QIW A;  2VUM A;  2A6H D;  4KB4 A;  4IP8 A;  4KDD A;  1R49 A;  1I6V D;  1SC7 A;  2JA5 A;  1I3Q A;  1TL8 A;  2CW0 D;  1TWH A;  1RRJ A;  3K5N A;  3GTQ A;  1Y69 8;  4LMO A;  2YU9 A;  2E2H A;  3P9A A;  4NOK A;  4KAW X;  2R7Z A;  4FXD A;  1EJ9 A;  1K83 A;  3HKZ A;  4NOL A;  1IW7 D;  4Q5G A;  1YNN D;  3GTM A;  4FGU A;  1Y1W A;  1GE9 A;  1WQG A;  3MAQ A;  2Y0S A;  4IP9 A;  1YNJ D;  1MIU A;  1TGO A;  1EH1 A;  2O5J D;  4L8I A;  3GTP A;  3KYL A;  5C9H A;  1A31 A;  1EK8 A; 
#chains in the Genus database with same CATH homology
 4D3Z A;  4F3E A;  5CQG A;  1Y1V A;  2A69 D;  3GTG A;  2A68 D;  3DU6 A;  1HQM D;  1TWA A;  3CQZ A;  3K5L A;  3WVO A;  4D3Y A;  1DD5 A;  4KC6 A;  3H0G A;  3IAY A;  5JSB B;  1ISE A;  1K4T A;  1ZYR D;  2JA7 A;  1A36 A;  2WAQ A;  2B63 A;  2JA6 A;  1TWF A;  2R92 A;  1NH3 A;  1T8I A;  1K4S A;  4EJ3 A;  1SMY D;  3SJR A;  3GTO A;  5JSN B;  3K5M A;  4KB2 A;  3K57 A;  4OYD B;  3GTJ A;  5MLC 9;  4AYB A;  3LF9 A;  3FKI A;  2PMZ A;  1SEU A;  1LPQ A;  4AN8 A;  4O26 A;  4Q5V A;  3K5O A;  1IS1 A;  2NVY A;  3K58 A;  1WQF A;  3DU5 A;  1TWG A;  2R4G A;  3GTL A;  3GTK A;  2F4Q A;  3LHP S;  1Q8I A;  4H3T A;  4NOM A;  1R5Z A;  1A35 A;  2R93 A;  4AHC A;  3M4A A;  1WCM A;  1R9T A;  4C2M A;  1TWC A;  1V9M A;  2A6E D;  2WB1 A;  1I50 A;  2B9S B;  3K59 A;  1RR8 C;  4JLR C;  1WQH A;  4GFQ A;  2BE5 D;  4FYD A;  2NVX A;  4QCL A;  2E2I A;  1SFO A;  4QIW A;  2VUM A;  2A6H D;  4KB4 A;  4IP8 A;  4KDD A;  1R49 A;  1I6V D;  1SC7 A;  2JA5 A;  1I3Q A;  1TL8 A;  2CW0 D;  1TWH A;  1RRJ A;  3K5N A;  3GTQ A;  1Y69 8;  4LMO A;  2YU9 A;  2E2H A;  3P9A A;  4NOK A;  4KAW X;  2R7Z A;  4FXD A;  1EJ9 A;  1K83 A;  3HKZ A;  4NOL A;  1IW7 D;  4Q5G A;  1YNN D;  3GTM A;  4FGU A;  1Y1W A;  1GE9 A;  1WQG A;  3MAQ A;  2Y0S A;  4IP9 A;  1YNJ D;  1MIU A;  1TGO A;  1EH1 A;  2O5J D;  4L8I A;  3GTP A;  3KYL A;  5C9H A;  1A31 A;  1EK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...