4KB2A

Crystal structure of ribosome recycling factor mutant r109a from mycobacterium tuberculosis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
184
structure length
184
Chain Sequence
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEEARRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 64
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kb2A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kb2A02
1XXAA 3ERED 2PHCB 3BUEA 3OEPA 4KB2A 5JSBB 3V4GA 3L4KA 2ZFZA 1EK8A 1Y698 3QX3A 1EH1A 1B4AA 1WQFA 4JLRC 2P5MA 3NUHA 4G0UA 3FHZA 5CJ9A 1WQGA 3OREA 4G0WA 2RGRA 3LHPS 3FOFA 4G0VA 1ISEA 3LAJA 2Y3PA 1BGWA 3L4JA 3MMLB 3OPFA 1B4BA 3CAGA 4KB4A 2XCOA 1BJTA 2KWAA 1AB4A 1F9NA 4FM9A 4KDDA 3FOEA 4OYDB 1WIHA 3LPXA 1WQHA 3LF9A 4KC6A 5MLC9 2XCRB 2XCQA 1IS1A 4KAWX 4J3NA 4DDQA 1DD5A 5JSNB 1ZVUA 4L8IA 3LAPA 3VA7A 1XXCA 5JVOA 1GE9A 4GFQA 1XXBA
chains in the Genus database with same CATH superfamily
2P8TA 1IL2A 2W7VA 3V4GA 3L4KA 2EBBA 4A3KC 1WCMK 2NVYK 2E2JC 4P9SA 4GTAA 2R7ZK 1TWCK 3ADAC 2B63C 2V6TA 1A36A 1F7VA 3HOVC 1RRJA 2FQOA 1O2BA 4BY7K 4A93K 1WOOA 3LPXA 3LF9A 3AH5A 4C2MK 3H0GK 4YFXA 1ZQ1C 5L46A 4G7ZA 1I50K 1EFWA 3K7AK 4A3GC 3HOXC 1PJ6A 3BP8C 4A3MK 2D6FC 5IOQA 4BBRC 3AD7C 3HOUK 3HOWK 1O25A 3GTJC 3CQZC 4LLGA 4Y52C 3KYLA 4C3IC 3AD8C 5EGEA 1XZQA 3OREA 1O2AA 4A3IK 1YCLA 3S15K 1XZQB 1R9TK 3WVOA 4XCHA 1Y1WA 3GTPC 3GTJA 4FM9A 1RU0A 1X31C 2CFAA 4LJZA 2CFAB 4AYBD 4QCLA 3I4MK 2R92A 5E68A 3RZOK 4ILDA 3GTLK 2GSUA 4A3JK 1XXBA 4YG2A 3BUEA 4A3FC 3S1QK 4WJ4A 3GTGK 1WOSA 3GEEA 2GSNA 3FOFA 4G0VA 3K5LA 4WJ3M 4KARA 2NVTK 5TMFA 5M3FK 2GAGC 2ZUEA 4XSXA 1JOEA 4MEXA 4KM9A 3PO3K 2E2JK 1A35A 5M5XK 2B63K 2PHCB 3HKZL 3OEPA 3MAQA 3IAYA 1J6XA 1XZPA 1O26A 1TWGC 1XZPB 4JLRC 3AQPA 4G0UA 5CJ9A 2E2HA 4AYBL 4A3MC 4A3GK 3K59A 5IP9K 4D3ZA 2O5JD 2R93A 3HOXK 3L4JA 3HOUC 4LK1A 4P5AA 2WAQL 2KWAA 2O5JA 4BBRK 1ZYRD 2A68D 1DCOA 5IORA 4Y7NC 1ZYRA 2A68A 3GTJK 3GTMA 3S2DC 3PO2C 4Y52K 4C3IK 3S15C 4KATA 4H3TA 5JVOA 5C3EC 4Q5SA 4KB2A 5JSBB 1Y698 2A69D 4GT9A 1IBAA 1WQFA 1USMA 2A69A 3N0BA 3T01A 3I4MC 3GTLC 1SC7A 1WOPA 4A3JC 5IYBK 2JH3A 5C9HA 4KMUA 1I3QC 4NOLA 1BJTA 4A3FK 4KDDA 4XLPA 1UV7A 1IW7D 5C4XC 1R49A 3GTKA 1IW7A 5C4JC 4X6AK 4OIRA 3S1RC 2BE5D 4A3EC 2BE5A 4GTFA 4YFNA 2V6SA 4QIWL 4GTEA 3PO3C 4LMOA 1PJ5A 2E2IA 1JQWA 2JA6C 3S2HC 1IQ0A 4D3YA 2Y0SL 1NH3A 5FLMK 1DCPA 3TTGA 1B4BA 4LOWA 4KB4A 1O29A 2XCOA 2JA6A 3S0XA 3S16K 3A8JA 3N3YA 3IPJA 1WSVA 1TGOA 4A3CC 2PA8D 3M4OK 1TWGK 3SZZA 4NOMA 4NOKA 4JK1A 5IP9C 1V9MA 3DU5A 4O2DA 1R5ZA 4GTLA 1Y1WC 4KASA 4GTBA 4OIPA 2P5MA 3FKIA 4BKWA 4Y7NK 1K83A 2JA8C 3S2DK 3PO2K 1HQMD 4OIOA 5C3EK 4F3EA 1YNND 3HKZD 2R92C 4A3DK 1HQMA 2JA7A 3HKZA 1YNNA 4C3HC 1VLOA 1WORA 5EGHA 1EJ9A 3I4NC 1TWAA 2NVQC 4P5BA 5M5YK 1I6VD 2YU9A 1K4TA 4J3NA 4YFKA 4L8IA 1I6VA 3GTQA 5IYBC 4AYBA 3P9AA 3GTKK 2WAQD 1SFOA 1I3QK 2WAQA 1O24A 5M3MK 3NUHA 4KN7A 1XPPA 3AD9C 2PA8L 5C4XK 4X6AC 4NOIA 3LAJA 4BLBA 4BBSC 2Y3PA 5C4JK 3K57A 3S14C 3M4AA 3MMLB 1Y1VA 4O26A 1G51A 3OPFA 4LR2A 4A3EK 3S1RK 3S1NC 4OINA 4BY1C 4GTDA 2CW0D 5MLC9 5IOTA 2JA6K 3S2HK 2CW0A 4DDQA 1KQ4A 5FLMC 1WSRA 2E2HC 5HL8A 1Q8IA 3S16C 3SJRA 1INNA 3A8KA 1JVIA 3QX3A 1BS2A 3BP3A 2R93C 1J6WA 3M4OC 3FHZA 4G0WA 4A3CK 2VUMA 4C45A 4FGUA 3FKIK 3GTMC 3M3YC 1K83K 4G7OA 4QIWD 4WILA 4XLNA 2A6ED 4QIWA 1WQHA 1EI6A 2XCRB 1Y1WK 4FZBA 2Y0SD 2A6EA 4LK0A 4FXDA 2Y0SA 3LAPA 2JA8K 3N0CA 1WCMA 2NVYA 4GTCA 4A3DC 4IP8A 4LQYA 1TWFA 3GTQK 2FQTA 2R7ZA 4G7HA 1TWCA 2R92K 1EK8A 4KMHA 4C3HK 1SMYD 1TWHC 1SFOK 3I4NK 2NVQK 2RH6A 3G4AA 3LHPS 1SMYA 3K58A 3A8IA 1YNJD 3DU6A 3TFHA 3K5NA 3GTKC 4C2MA 3H0GA 1TL8A 5IYDC 2A6HD 3GSIA 1I50A 4KMDA 2A6HA 3SZYA 3H3VL 1TWHA 1DCHA 3TFJA 3TFIA 2E2IC 4BBSK 4PAAA 1O2FB 4PABA 3GTOA 3GEHA 3S14K 1YX2A 3S1NK 1R9TA 4BY1K 3K5OA 2WB1L 4MEYA 1WQGA 4QJVA 4KM8A 4QJVB 2NVXA 3HOYC 2E2HK 5C44C 4AHCA 4FYDA 1F9NA 5D4DA 2JA5C 4KC6A 2R93K 4AN8A 4A3BC 3VA7A 3FKIC 3GTGA 1K83C 4BXXK 1VJEA 1IE0A 3GIRA 3GTMK 3HOZC 3M3YK 2JA5A 5TMCA 1MIUA 2O5IA 1EH1A 1TWFK 2JA7C 5CQGA 2PPBA 5IP7C 3GEIA 1TWAC 4M1XA 2YU9C 4GZYA 1BGWA 3GTQC 5IOSA 1VRQC 3FOEA 1SFOC 2B63A 1DD5A 1TWHK 2B9SB 1J98A 1O28A 3T00A 4A3LK 5IYDK 1A31A 1Y1VC 4C3JC 3GTOK 2PMZL 3RZDC 4EJ3A 4OIQA 1ISEA 4BLAA 2E2IK 1BDFA 1T8IA 3CQZA 1VGXA 3HXAA 2NVXK 1I6HK 5IYCC 1XXCA 3S1MC 1C0AA 1GE9A 3GTPA 2VUMC 1F93A 2R4GA 3S17C 2V6UA 2ZFZA 3WODA 1VH2A 5C44K 3HOYK 3H3VD 2JA5K 1USOA 4Q5GA 1L0WA 4XSZA 4BXXC 4ZH4A 1J6VA 4A3BK 1WCMC 2NVYC 3HOZK 1AB4A 3G4CA 4KMAA 2WB1D 4A3KK 1TWFC 2F4QA 2R7ZC 1TWCC 2WB1A 3EQLA 2JA7K 3GDZA 4KN4A 5IP7K 1SEUA 1TWAK 1XXAA 5CHPA 1V5VA 2YU9K 4BY7C 4A93C 1O27A 3HOVK 4C2MC 3H0GC 1I50C 3K7AC 4IP9A 1F7UA 2RGRA 1K4SA 3HOWC 2GAHC 2ZUFA 3CAGA 4MQ9A 3T02A 4A3LC 1TWGA 1YNJA 1WIHA 3GTOC 4A3IC 3CQZK 1EQRA 1HI9A 1Y1VK 4C3JK 2XCQA 1IS1A 4Q5VA 1R9TC 3RZDK 4GFQA 5JSNB 3ERED 1ZXOA 3DXJA 1RR8C 3GTPK 4RMFA 2NVXC 1B4AA 1I6HC 3RZOC 1LPQA 4AH6A 1PJ7A 5IYCK 2GSOA 5M5WK 5FJ8K 3S1MK 3JSTA 5TJ3A 5JFEA 3S1QC 3GTGC 3K5MA 2VUMK 3S17K 4OYDB 2PMZD 3GTLA 4Q4ZA 4KAWX 2PMZA 3AQOA 1ZVUA 1ZBSA 3Q3QA 1I3QA 2NVTC
chains in the Genus database with same CATH topology
1Q8IA 3V4GA 4KB2A 5JSBB 3SJRA 3L4KA 1O28A 1Y698 3QX3A 2A69D 1A31A 4C3JC 4GT9A 1WQFA 5JVOA 3N0BA 4GTAA 3FHZA 4G0WA 4EJ3A 2VUMA 1ISEA 4BLAA 1SC7A 4FGUA 2JH3A 5C9HA 1T8IA 1A36A 3CQZA 4NOLA 1BJTA 1RRJA 1O2BA 4KDDA 3LPXA 2A6ED 4QIWA 1WQHA 3LF9A 3AH5A 2XCRB 4FZBA 1IW7D 1R49A 4FXDA 3GTKA 2Y0SA 3LAPA 1XXCA 3N0CA 1WCMA 1GE9A 2NVYA 3GTPA 4GTCA 2BE5D 5IOQA 4IP8A 4LQYA 1TWFA 2R4GA 4GTFA 2R7ZA 2ZFZA 1TWCA 1EK8A 1O25A 4GTEA 4KMHA 4LMOA 2E2IA 3KYLA 4C3IC 4D3YA 4Q5GA 1SMYD 5EGEA 3OREA 1O2AA 2RH6A 3G4AA 3LHPS 3K58A 3WVOA 1YNJD 3DU6A 3K5NA 1NH3A 1Y1WA 4C2MA 3H0GA 1TL8A 1B4BA 2A6HD 4KB4A 1I50A 1O29A 2XCOA 3GTJA 2JA6A 4KMDA 3S0XA 1AB4A 3G4CA 3N3YA 4KMAA 5TJ3A 4FM9A 1TGOA 1TWHA 2CFAA 2F4QA 2WB1A 2CFAB 4QCLA 2R92A 4NOMA 4ILDA 4NOKA 2GSUA 1SEUA 1V9MA 1XXBA 1XXAA 3DU5A 5CHPA 1R5ZA 3GTOA 3BUEA 1O27A 4GTLA 4KASA 4GTBA 4C2MC 1R9TA 5JFEA 3K5OA 2P5MA 3FKIA 4BKWA 4IP9A 1WQGA 1K83A 2GSNA 2RGRA 3FOFA 4G0VA 1K4SA 3K5LA 4KM8A 1HQMD 4KARA 4F3EA 1YNND 2NVXA 3CAGA 1TWGA 4AHCA 3HKZA 4FYDA 2JA7A 1F9NA 4C3HC 5EGHA 1EJ9A 1WIHA 4KM9A 4KC6A 1TWAA 4P5BA 2XCQA 1IS1A 1I6VD 2YU9A 1K4TA 4Q5VA 4J3NA 4L8IA 4AN8A 1A35A 3VA7A 3GTGA 3GTQA 4GFQA 4AYBA 5JSNB 3ERED 1ZXOA 3P9AA 2PHCB 3OEPA 3MAQA 2JA5A 1RR8C 1SFOA 1MIUA 3IAYA 2WAQA 1O24A 1EH1A 1B4AA 1O26A 3AQPA 4JLRC 3NUHA 5CQGA 4G0UA 5CJ9A 2E2HA 1LPQA 4M1XA 3LAJA 4BLBA 2Y3PA 3K59A 3K57A 2GSOA 4D3ZA 2B9SB 3M4AA 2R93A 1Y1VA 4O26A 2O5JD 1BGWA 3MMLB 3OPFA 3K5MA 4LR2A 4P5AA 2KWAA 5IOSA 4GTDA 3FOEA 1ZYRD 2A68D 5IORA 4OYDB 3L4JA 2CW0D 5MLC9 3GTLA 5IOTA 2B63A 3GTMA 4KAWX 2PMZA 4DDQA 1DD5A 1KQ4A 1ZVUA 3AQOA 1ZBSA 3Q3QA 4KATA 1I3QA 4H3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XXA A;  3ERE D;  2PHC B;  3BUE A;  3OEP A;  4KB2 A;  5JSB B;  3V4G A;  3L4K A;  2ZFZ A;  1EK8 A;  1Y69 8;  3QX3 A;  1EH1 A;  1B4A A;  1WQF A;  4JLR C;  2P5M A;  3NUH A;  4G0U A;  3FHZ A;  5CJ9 A;  1WQG A;  3ORE A;  4G0W A;  2RGR A;  3LHP S;  3FOF A;  4G0V A;  1ISE A;  3LAJ A;  2Y3P A;  1BGW A;  3L4J A;  3MML B;  3OPF A;  1B4B A;  3CAG A;  4KB4 A;  2XCO A;  1BJT A;  2KWA A;  1AB4 A;  1F9N A;  4FM9 A;  4KDD A;  3FOE A;  4OYD B;  1WIH A;  3LPX A;  1WQH A;  3LF9 A;  4KC6 A;  5MLC 9;  2XCR B;  2XCQ A;  1IS1 A;  4KAW X;  4J3N A;  4DDQ A;  1DD5 A;  5JSN B;  1ZVU A;  4L8I A;  3LAP A;  3VA7 A;  1XXC A;  5JVO A;  1GE9 A;  4GFQ A;  1XXB A; 
#chains in the Genus database with same CATH topology
 2P8T A;  1IL2 A;  2W7V A;  3V4G A;  3L4K A;  2EBB A;  4A3K C;  1WCM K;  2NVY K;  2E2J C;  4P9S A;  4GTA A;  2R7Z K;  1TWC K;  3ADA C;  2B63 C;  2V6T A;  1A36 A;  1F7V A;  3HOV C;  1RRJ A;  2FQO A;  1O2B A;  4BY7 K;  4A93 K;  1WOO A;  3LPX A;  3LF9 A;  3AH5 A;  4C2M K;  3H0G K;  4YFX A;  1ZQ1 C;  5L46 A;  4G7Z A;  1I50 K;  1EFW A;  3K7A K;  4A3G C;  3HOX C;  1PJ6 A;  3BP8 C;  4A3M K;  2D6F C;  5IOQ A;  4BBR C;  3AD7 C;  3HOU K;  3HOW K;  1O25 A;  3GTJ C;  3CQZ C;  4LLG A;  4Y52 C;  3KYL A;  4C3I C;  3AD8 C;  5EGE A;  1XZQ A;  3ORE A;  1O2A A;  4A3I K;  1YCL A;  3S15 K;  1XZQ B;  1R9T K;  3WVO A;  4XCH A;  1Y1W A;  3GTP C;  3GTJ A;  4FM9 A;  1RU0 A;  1X31 C;  2CFA A;  4LJZ A;  2CFA B;  4AYB D;  4QCL A;  3I4M K;  2R92 A;  5E68 A;  3RZO K;  4ILD A;  3GTL K;  2GSU A;  4A3J K;  1XXB A;  4YG2 A;  3BUE A;  4A3F C;  3S1Q K;  4WJ4 A;  3GTG K;  1WOS A;  3GEE A;  2GSN A;  3FOF A;  4G0V A;  3K5L A;  4WJ3 M;  4KAR A;  2NVT K;  5TMF A;  5M3F K;  2GAG C;  2ZUE A;  4XSX A;  1JOE A;  4MEX A;  4KM9 A;  3PO3 K;  2E2J K;  1A35 A;  5M5X K;  2B63 K;  2PHC B;  3HKZ L;  3OEP A;  3MAQ A;  3IAY A;  1J6X A;  1XZP A;  1O26 A;  1TWG C;  1XZP B;  4JLR C;  3AQP A;  4G0U A;  5CJ9 A;  2E2H A;  4AYB L;  4A3M C;  4A3G K;  3K59 A;  5IP9 K;  4D3Z A;  2O5J D;  2R93 A;  3HOX K;  3L4J A;  3HOU C;  4LK1 A;  4P5A A;  2WAQ L;  2KWA A;  2O5J A;  4BBR K;  1ZYR D;  2A68 D;  1DCO A;  5IOR A;  4Y7N C;  1ZYR A;  2A68 A;  3GTJ K;  3GTM A;  3S2D C;  3PO2 C;  4Y52 K;  4C3I K;  3S15 C;  4KAT A;  4H3T A;  5JVO A;  5C3E C;  4Q5S A;  4KB2 A;  5JSB B;  1Y69 8;  2A69 D;  4GT9 A;  1IBA A;  1WQF A;  1USM A;  2A69 A;  3N0B A;  3T01 A;  3I4M C;  3GTL C;  1SC7 A;  1WOP A;  4A3J C;  5IYB K;  2JH3 A;  5C9H A;  4KMU A;  1I3Q C;  4NOL A;  1BJT A;  4A3F K;  4KDD A;  4XLP A;  1UV7 A;  1IW7 D;  5C4X C;  1R49 A;  3GTK A;  1IW7 A;  5C4J C;  4X6A K;  4OIR A;  3S1R C;  2BE5 D;  4A3E C;  2BE5 A;  4GTF A;  4YFN A;  2V6S A;  4QIW L;  4GTE A;  3PO3 C;  4LMO A;  1PJ5 A;  2E2I A;  1JQW A;  2JA6 C;  3S2H C;  1IQ0 A;  4D3Y A;  2Y0S L;  1NH3 A;  5FLM K;  1DCP A;  3TTG A;  1B4B A;  4LOW A;  4KB4 A;  1O29 A;  2XCO A;  2JA6 A;  3S0X A;  3S16 K;  3A8J A;  3N3Y A;  3IPJ A;  1WSV A;  1TGO A;  4A3C C;  2PA8 D;  3M4O K;  1TWG K;  3SZZ A;  4NOM A;  4NOK A;  4JK1 A;  5IP9 C;  1V9M A;  3DU5 A;  4O2D A;  1R5Z A;  4GTL A;  1Y1W C;  4KAS A;  4GTB A;  4OIP A;  2P5M A;  3FKI A;  4BKW A;  4Y7N K;  1K83 A;  2JA8 C;  3S2D K;  3PO2 K;  1HQM D;  4OIO A;  5C3E K;  4F3E A;  1YNN D;  3HKZ D;  2R92 C;  4A3D K;  1HQM A;  2JA7 A;  3HKZ A;  1YNN A;  4C3H C;  1VLO A;  1WOR A;  5EGH A;  1EJ9 A;  3I4N C;  1TWA A;  2NVQ C;  4P5B A;  5M5Y K;  1I6V D;  2YU9 A;  1K4T A;  4J3N A;  4YFK A;  4L8I A;  1I6V A;  3GTQ A;  5IYB C;  4AYB A;  3P9A A;  3GTK K;  2WAQ D;  1SFO A;  1I3Q K;  2WAQ A;  1O24 A;  5M3M K;  3NUH A;  4KN7 A;  1XPP A;  3AD9 C;  2PA8 L;  5C4X K;  4X6A C;  4NOI A;  3LAJ A;  4BLB A;  4BBS C;  2Y3P A;  5C4J K;  3K57 A;  3S14 C;  3M4A A;  3MML B;  1Y1V A;  4O26 A;  1G51 A;  3OPF A;  4LR2 A;  4A3E K;  3S1R K;  3S1N C;  4OIN A;  4BY1 C;  4GTD A;  2CW0 D;  5MLC 9;  5IOT A;  2JA6 K;  3S2H K;  2CW0 A;  4DDQ A;  1KQ4 A;  5FLM C;  1WSR A;  2E2H C;  5HL8 A;  1Q8I A;  3S16 C;  3SJR A;  1INN A;  3A8K A;  1JVI A;  3QX3 A;  1BS2 A;  3BP3 A;  2R93 C;  1J6W A;  3M4O C;  3FHZ A;  4G0W A;  4A3C K;  2VUM A;  4C45 A;  4FGU A;  3FKI K;  3GTM C;  3M3Y C;  1K83 K;  4G7O A;  4QIW D;  4WIL A;  4XLN A;  2A6E D;  4QIW A;  1WQH A;  1EI6 A;  2XCR B;  1Y1W K;  4FZB A;  2Y0S D;  2A6E A;  4LK0 A;  4FXD A;  2Y0S A;  3LAP A;  2JA8 K;  3N0C A;  1WCM A;  2NVY A;  4GTC A;  4A3D C;  4IP8 A;  4LQY A;  1TWF A;  3GTQ K;  2FQT A;  2R7Z A;  4G7H A;  1TWC A;  2R92 K;  1EK8 A;  4KMH A;  4C3H K;  1SMY D;  1TWH C;  1SFO K;  3I4N K;  2NVQ K;  2RH6 A;  3G4A A;  3LHP S;  1SMY A;  3K58 A;  3A8I A;  1YNJ D;  3DU6 A;  3TFH A;  3K5N A;  3GTK C;  4C2M A;  3H0G A;  1TL8 A;  5IYD C;  2A6H D;  3GSI A;  1I50 A;  4KMD A;  2A6H A;  3SZY A;  3H3V L;  1TWH A;  1DCH A;  3TFJ A;  3TFI A;  2E2I C;  4BBS K;  4PAA A;  1O2F B;  4PAB A;  3GTO A;  3GEH A;  3S14 K;  1YX2 A;  3S1N K;  1R9T A;  4BY1 K;  3K5O A;  2WB1 L;  4MEY A;  1WQG A;  4QJV A;  4KM8 A;  4QJV B;  2NVX A;  3HOY C;  2E2H K;  5C44 C;  4AHC A;  4FYD A;  1F9N A;  5D4D A;  2JA5 C;  4KC6 A;  2R93 K;  4AN8 A;  4A3B C;  3VA7 A;  3FKI C;  3GTG A;  1K83 C;  4BXX K;  1VJE A;  1IE0 A;  3GIR A;  3GTM K;  3HOZ C;  3M3Y K;  2JA5 A;  5TMC A;  1MIU A;  2O5I A;  1EH1 A;  1TWF K;  2JA7 C;  5CQG A;  2PPB A;  5IP7 C;  3GEI A;  1TWA C;  4M1X A;  2YU9 C;  4GZY A;  1BGW A;  3GTQ C;  5IOS A;  1VRQ C;  3FOE A;  1SFO C;  2B63 A;  1DD5 A;  1TWH K;  2B9S B;  1J98 A;  1O28 A;  3T00 A;  4A3L K;  5IYD K;  1A31 A;  1Y1V C;  4C3J C;  3GTO K;  2PMZ L;  3RZD C;  4EJ3 A;  4OIQ A;  1ISE A;  4BLA A;  2E2I K;  1BDF A;  1T8I A;  3CQZ A;  1VGX A;  3HXA A;  2NVX K;  1I6H K;  5IYC C;  1XXC A;  3S1M C;  1C0A A;  1GE9 A;  3GTP A;  2VUM C;  1F93 A;  2R4G A;  3S17 C;  2V6U A;  2ZFZ A;  3WOD A;  1VH2 A;  5C44 K;  3HOY K;  3H3V D;  2JA5 K;  1USO A;  4Q5G A;  1L0W A;  4XSZ A;  4BXX C;  4ZH4 A;  1J6V A;  4A3B K;  1WCM C;  2NVY C;  3HOZ K;  1AB4 A;  3G4C A;  4KMA A;  2WB1 D;  4A3K K;  1TWF C;  2F4Q A;  2R7Z C;  1TWC C;  2WB1 A;  3EQL A;  2JA7 K;  3GDZ A;  4KN4 A;  5IP7 K;  1SEU A;  1TWA K;  1XXA A;  5CHP A;  1V5V A;  2YU9 K;  4BY7 C;  4A93 C;  1O27 A;  3HOV K;  4C2M C;  3H0G C;  1I50 C;  3K7A C;  4IP9 A;  1F7U A;  2RGR A;  1K4S A;  3HOW C;  2GAH C;  2ZUF A;  3CAG A;  4MQ9 A;  3T02 A;  4A3L C;  1TWG A;  1YNJ A;  1WIH A;  3GTO C;  4A3I C;  3CQZ K;  1EQR A;  1HI9 A;  1Y1V K;  4C3J K;  2XCQ A;  1IS1 A;  4Q5V A;  1R9T C;  3RZD K;  4GFQ A;  5JSN B;  3ERE D;  1ZXO A;  3DXJ A;  1RR8 C;  3GTP K;  4RMF A;  2NVX C;  1B4A A;  1I6H C;  3RZO C;  1LPQ A;  4AH6 A;  1PJ7 A;  5IYC K;  2GSO A;  5M5W K;  5FJ8 K;  3S1M K;  3JST A;  5TJ3 A;  5JFE A;  3S1Q C;  3GTG C;  3K5M A;  2VUM K;  3S17 K;  4OYD B;  2PMZ D;  3GTL A;  4Q4Z A;  4KAW X;  2PMZ A;  3AQO A;  1ZVU A;  1ZBS A;  3Q3Q A;  1I3Q A;  2NVT C; 
#chains in the Genus database with same CATH homology
 1Q8I A;  3V4G A;  4KB2 A;  5JSB B;  3SJR A;  3L4K A;  1O28 A;  1Y69 8;  3QX3 A;  2A69 D;  1A31 A;  4C3J C;  4GT9 A;  1WQF A;  5JVO A;  3N0B A;  4GTA A;  3FHZ A;  4G0W A;  4EJ3 A;  2VUM A;  1ISE A;  4BLA A;  1SC7 A;  4FGU A;  2JH3 A;  5C9H A;  1T8I A;  1A36 A;  3CQZ A;  4NOL A;  1BJT A;  1RRJ A;  1O2B A;  4KDD A;  3LPX A;  2A6E D;  4QIW A;  1WQH A;  3LF9 A;  3AH5 A;  2XCR B;  4FZB A;  1IW7 D;  1R49 A;  4FXD A;  3GTK A;  2Y0S A;  3LAP A;  1XXC A;  3N0C A;  1WCM A;  1GE9 A;  2NVY A;  3GTP A;  4GTC A;  2BE5 D;  5IOQ A;  4IP8 A;  4LQY A;  1TWF A;  2R4G A;  4GTF A;  2R7Z A;  2ZFZ A;  1TWC A;  1EK8 A;  1O25 A;  4GTE A;  4KMH A;  4LMO A;  2E2I A;  3KYL A;  4C3I C;  4D3Y A;  4Q5G A;  1SMY D;  5EGE A;  3ORE A;  1O2A A;  2RH6 A;  3G4A A;  3LHP S;  3K58 A;  3WVO A;  1YNJ D;  3DU6 A;  3K5N A;  1NH3 A;  1Y1W A;  4C2M A;  3H0G A;  1TL8 A;  1B4B A;  2A6H D;  4KB4 A;  1I50 A;  1O29 A;  2XCO A;  3GTJ A;  2JA6 A;  4KMD A;  3S0X A;  1AB4 A;  3G4C A;  3N3Y A;  4KMA A;  5TJ3 A;  4FM9 A;  1TGO A;  1TWH A;  2CFA A;  2F4Q A;  2WB1 A;  2CFA B;  4QCL A;  2R92 A;  4NOM A;  4ILD A;  4NOK A;  2GSU A;  1SEU A;  1V9M A;  1XXB A;  1XXA A;  3DU5 A;  5CHP A;  1R5Z A;  3GTO A;  3BUE A;  1O27 A;  4GTL A;  4KAS A;  4GTB A;  4C2M C;  1R9T A;  5JFE A;  3K5O A;  2P5M A;  3FKI A;  4BKW A;  4IP9 A;  1WQG A;  1K83 A;  2GSN A;  2RGR A;  3FOF A;  4G0V A;  1K4S A;  3K5L A;  4KM8 A;  1HQM D;  4KAR A;  4F3E A;  1YNN D;  2NVX A;  3CAG A;  1TWG A;  4AHC A;  3HKZ A;  4FYD A;  2JA7 A;  1F9N A;  4C3H C;  5EGH A;  1EJ9 A;  1WIH A;  4KM9 A;  4KC6 A;  1TWA A;  4P5B A;  2XCQ A;  1IS1 A;  1I6V D;  2YU9 A;  1K4T A;  4Q5V A;  4J3N A;  4L8I A;  4AN8 A;  1A35 A;  3VA7 A;  3GTG A;  3GTQ A;  4GFQ A;  4AYB A;  5JSN B;  3ERE D;  1ZXO A;  3P9A A;  2PHC B;  3OEP A;  3MAQ A;  2JA5 A;  1RR8 C;  1SFO A;  1MIU A;  3IAY A;  2WAQ A;  1O24 A;  1EH1 A;  1B4A A;  1O26 A;  3AQP A;  4JLR C;  3NUH A;  5CQG A;  4G0U A;  5CJ9 A;  2E2H A;  1LPQ A;  4M1X A;  3LAJ A;  4BLB A;  2Y3P A;  3K59 A;  3K57 A;  2GSO A;  4D3Z A;  2B9S B;  3M4A A;  2R93 A;  1Y1V A;  4O26 A;  2O5J D;  1BGW A;  3MML B;  3OPF A;  3K5M A;  4LR2 A;  4P5A A;  2KWA A;  5IOS A;  4GTD A;  3FOE A;  1ZYR D;  2A68 D;  5IOR A;  4OYD B;  3L4J A;  2CW0 D;  5MLC 9;  3GTL A;  5IOT A;  2B63 A;  3GTM A;  4KAW X;  2PMZ A;  4DDQ A;  1DD5 A;  1KQ4 A;  1ZVU A;  3AQO A;  1ZBS A;  3Q3Q A;  4KAT A;  1I3Q A;  4H3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...