4KB2A

Crystal structure of ribosome recycling factor mutant r109a from mycobacterium tuberculosis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
184
structure length
184
Chain Sequence
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEEARRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 64
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kb2A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kb2A02
1Y698 3L4KA 3LHPS 1EK8A 4DDQA 3ERED 3OREA 4G0UA 4GFQA 4KB2A 2XCRB 3NUHA 4G0VA 3VA7A 4KDDA 2XCOA 1XXCA 1ZVUA 2XCQA 2KWAA 1WQFA 5JVOA 1XXBA 1GE9A 3LPXA 5CJ9A 5JSBB 4J3NA 2PHCB 3OPFA 3QX3A 1AB4A 2Y3PA 1IS1A 4KAWX 2ZFZA 3BUEA 3FOFA 4OYDB 1BJTA 1B4AA 3MMLB 3LAPA 3V4GA 1F9NA 3FHZA 2RGRA 1ISEA 2P5MA 1WIHA 1DD5A 3OEPA 4G0WA 4L8IA 3FOEA 3L4JA 3LF9A 4FM9A 4KC6A 1B4BA 1EH1A 1WQGA 1XXAA 1WQHA 4KB4A 5JSNB 3CAGA 5MLC9 1BGWA 3LAJA 4JLRC
chains in the Genus database with same CATH superfamily
4OINA 2JA5C 1TWCK 2R92K 4A3FK 1YNJA 4AHCA 1K4TA 4BKWA 2R7ZC 1T8IA 1INNA 3GTGA 1VJEA 2JA8C 5C4JK 5JSBB 4A3JK 3FKIK 1K4SA 2NVXK 3S14C 1X31C 3GTPK 1K83K 2P5MA 2Y0SD 1BDFA 1Y1WC 1IBAA 2R7ZA 4A3GK 3GEEA 4A3CC 2Y0SL 1ZBSA 3GIRA 4JLRC 3S16C 4A3IC 1XZQA 2R92C 4QJVA 1YCLA 4G0VA 4RMFA 5FLMC 2GAHC 4BBSK 1Y1WA 4QIWL 4A3GC 2O5JA 1DCHA 4LK1A 1XPPA 2GSUA 1I6HK 3S1MK 4PAAA 2R92A 2E2IK 1K83C 4A3LK 3S1QC 2CFAA 3K7AK 2O5IA 4QJVB 4G7HA 1O27A 4AYBA 1J6WA 4F3EA 3P9AA 2A68D 1L0WA 3GTJK 4GTAA 3PO2K 3GEHA 1F93A 4KM8A 1DCPA 3AD7C 2NVTC 4QCLA 3AQPA 4BBSC 2FQTA 3DU6A 3GTKK 1TL8A 2JA6A 1IW7A 4A3MK 4OIOA 2B63C 4KASA 4C3IK 2R93C 4C2MA 1TWFK 5IYBK 5C44C 2NVXC 2RGRA 1BJTA 3S1QK 4A3LC 4LOWA 4NOKA 1WOSA 1TWGC 2WB1A 1Y1WK 1O2BA 1WOOA 3CAGA 3G4AA 1WQHA 1WCMC 5JSNB 3JSTA 1I50A 1SMYD 4YFXA 4YFKA 3RZDK 1O24A 2KWAA 4C3JK 4XSZA 1IQ0A 3S15C 4MEXA 5IP7K 3S0XA 3AQOA 5CHPA 2PMZD 5IYDC 3M4AA 1I50C 1RU0A 3T00A 1EQRA 3H3VD 1ISEA 3M3YC 4GTBA 2NVYA 1WOPA 4LK0A 4Y52K 3SJRA 4KB4A 3HOZC 1BGWA 3S2HC 1MIUA 4BBRK 4A3EK 4C3HK 3GTQA 3IAYA 1USOA 4FGUA 2V6SA 5IP9C 4AYBD 3HOXK 4A3KC 2NVYC 3GTOK 4G7ZA 1TWHK 4BY7C 3GEIA 4LJZA 4A93C 1XZPB 3MAQA 3TFIA 1O26A 3ADAC 4BBRC 3GTMC 3LAPA 1WIHA 1DD5A 4O26A 1VGXA 4A3DC 2D6FC 3K59A 4BY7K 1HQMA 1SFOA 2F4QA 2PA8D 4A3EC 3GTOA 3GTPA 1G51A 4C3HC 3S1NK 4YG2A 3SZYA 2WB1D 3GTMA 2E2IC 3S2DK 1IE0A 3BP8C 4C3JC 4FZBA 4AYBL 1V9MA 3EQLA 1SMYA 2JA5A 1IL2A 2YU9C 4KAWX 1SEUA 4OYDB 3FHZA 2A69D 1LPQA 2VUMK 3GTGC 1O28A 2JA7K 3M4OK 1YNND 2YU9A 2E2HK 1HI9A 3RZOK 2P8TA 5M3MK 4A93K 5JVOA 1TGOA 4KMHA 5CJ9A 2WAQL 4MEYA 2GAGC 3WVOA 3Q3QA 4GTCA 5HL8A 1O25A 3KYLA 2E2HC 1Y1VK 5C4JC 4A3JC 3S1MC 2NVQK 3HOUK 5CQGA 4KN7A 1PJ7A 1K83A 4KMUA 3S1NC 2E2HA 4H3TA 4AN8A 5FJ8K 3S16K 4NOIA 1R9TA 4Q5SA 2B9SB 1C0AA 4KMDA 5E68A 1GE9A 4BLAA 1EFWA 1I3QC 4P5AA 1YX2A 2RH6A 1VLOA 2ZFZA 3H0GK 2YU9K 5C4XK 4WJ4A 4GTLA 1TWCA 3PO3C 1A35A 4A3IK 2WAQA 2A6ED 4IP9A 4FM9A 2JA5K 3GTGK 1R9TC 3A8IA 3AD8C 3I4NK 2B63A 3I4MC 3GTQK 2R93A 4C2MC 4BLBA 1EK8A 4GFQA 3N0CA 3GTMK 1VRQC 3H3VL 1JVIA 3VA7A 1TWCC 4OIPA 4XCHA 2CFAB 2E2JC 2PMZL 3I4NC 4LQYA 4J3NA 1A36A 3OPFA 3HKZA 2R7ZK 5D4DA 3FOFA 1ZYRD 4LMOA 1B4AA 1F9NA 2FQOA 1WORA 4GTEA 4AH6A 4A3MC 4L8IA 2V6UA 1R9TK 3S1RK 4QIWA 3AH5A 2W7VA 4XLNA 5FLMK 3WODA 3GDZA 1I6VD 4Q5VA 4KATA 5TJ3A 4KB2A 1R49A 4KDDA 1Q8IA 4ZH4A 5IYBC 1V5VA 4BXXK 4M1XA 1Y1VA 1BS2A 1WSRA 2Y3PA 3ERED 1TWFA 4OIRA 3HOVC 1RR8C 1YNJD 4FXDA 1F7UA 1JOEA 4MQ9A 2PMZA 4D3ZA 4XSXA 5EGEA 3LHPS 2NVTK 1O29A 3HOVK 2JA7A 3FKIC 3NUHA 3GTJC 4O2DA 4C3IC 4BXXC 5IORA 5IYCK 2E2JK 1SFOC 5IOQA 4A3KK 1TWGK 1J6XA 3GTOC 4G0UA 3K5NA 4Q5GA 3T02A 1WCMK 3S2HK 4IP8A 3FOEA 5TMCA 2BE5A 3HKZD 5IYCC 1SC7A 2JA6K 3BP3A 1ZYRA 4GT9A 3K7AC 1O2AA 4DDQA 2CW0D 1RRJA 4A3BC 5C4XC 3M4OC 1I6HC 2GSOA 1HQMD 4QIWD 1ZVUA 4X6AC 3AD9C 3LPXA 4LLGA 3QX3A 2VUMA 4EJ3A 1USMA 4JK1A 4ILDA 5IOSA 5IP7C 3K5MA 5L46A 1JQWA 3LF9A 3G4CA 4X6AK 3M3YK 1WSVA 3T01A 1IW7D 4XLPA 2VUMC 4A3BK 3CQZA 4GTDA 1A31A 1J6VA 2B63K 3H0GA 2V6TA 2XCOA 3IPJA 4PABA 4KARA 1WQFA 2PPBA 1PJ6A 4KMAA 3S1RC 1SFOK 1XZQB 4BY1C 3RZDC 2WB1L 1EI6A 4Q4ZA 2A6HA 2PHCB 3N0BA 5TMFA 3MMLB 3CQZC 5EGHA 1ZXOA 1NH3A 3H0GC 3HOWK 5C3EK 3HOYC 1I3QA 3GSIA 2JA6C 3LAJA 1XZPA 1TWHA 2NVQC 3OREA 2NVXA 1PJ5A 5M5WK 1UV7A 2XCRB 4C2MK 2BE5D 5IYDK 1TWGA 5M5XK 2R93K 5IOTA 3S17C 4A3CK 3HOWC 5C9HA 4YFNA 2CW0A 3SZZA 1F7VA 1WCMA 4Y52C 4WJ3M 3DU5A 3N3YA 4KM9A 1TWHC 3GTLC 3CQZK 1KQ4A 3OEPA 5JFEA 1EJ9A 5C3EC 4KC6A 3HOYK 4Y7NC 3V4GA 3K57A 3TFJA 2NVYK 4G0WA 3RZOC 3K5OA 3GTLA 2JH3A 2WAQD 2A6EA 5M3FK 3S15K 2EBBA 3TFHA 3A8KA 3I4MK 1XXCA 2Y0SA 3K5LA 2XCQA 1I50K 4WILA 2ZUFA 3S2DC 1TWAK 4A3DK 4KN4A 4OIQA 1ZQ1C 1AB4A 3S14K 4GTFA 3PO2C 4NOLA 1VH2A 3GTQC 3A8JA 3HKZL 3HOZK 3GTKC 2R4GA 3L4JA 2PA8L 2A6HD 1TWAA 4G7OA 1EH1A 1WQGA 1XXAA 1Y1VC 5MLC9 2ZUEA 5IP9K 2O5JD 1Y698 3HOXC 1TWFC 5C44K 3L4KA 3HOUC 4D3YA 4A3FC 5M5YK 3HXAA 1I3QK 3K58A 2A69A 1DCOA 3GTKA 3S17K 1XXBA 1TWAC 1I6VA 4C45A 1O2FB 3PO3K 4P9SA 1IS1A 3BUEA 2A68A 3GTLK 1J98A 1YNNA 3GTPC 3FKIA 2JA7C 3GTJA 2E2IA 4FYDA 2GSNA 4LR2A 1R5ZA 4NOMA 1B4BA 2JA8K 4P5BA 4GZYA 3DXJA 4BY1K 4Y7NK 3TTGA
chains in the Genus database with same CATH topology
1MIUA 4BLBA 1EK8A 1IW7D 3CQZA 4GTDA 4GFQA 3N0CA 1A31A 3GTQA 4AHCA 3IAYA 4FGUA 3H0GA 1K4TA 2XCOA 4BKWA 3VA7A 1T8IA 3GTGA 2CFAB 4KARA 1WQFA 4KMAA 4LQYA 3MAQA 5JSBB 1A36A 4J3NA 2PHCB 3HKZA 3OPFA 1K4SA 3N0BA 1O26A 3FOFA 1ZYRD 4LMOA 1B4AA 3MMLB 3LAPA 1F9NA 5EGHA 1ZXOA 2P5MA 1WIHA 1DD5A 4O26A 4GTEA 4L8IA 1NH3A 3K59A 2R7ZA 4QIWA 3AH5A 1I3QA 1SFOA 1ZBSA 2F4QA 3LAJA 4JLRC 1TWHA 1I6VD 3GTOA 4Q5VA 3GTPA 3OREA 4C3HC 4KATA 2NVXA 5TJ3A 4KB2A 3GTMA 2XCRB 4G0VA 2BE5D 1R49A 4KDDA 1Q8IA 1TWGA 1Y1WA 4M1XA 5IOTA 4C3JC 5C9HA 4FZBA 1V9MA 1WCMA 1Y1VA 2JA5A 2GSUA 3DU5A 2Y3PA 4KAWX 3N3YA 1TWFA 4KM9A 1SEUA 4OYDB 2R92A 3ERED 1KQ4A 3FHZA 2A69D 2CFAA 3OEPA 1RR8C 1YNJD 5JFEA 1LPQA 1O27A 1EJ9A 4FXDA 4AYBA 4KC6A 4F3EA 2PMZA 4D3ZA 1O28A 3P9AA 5EGEA 2A68D 3K57A 3V4GA 4G0WA 1YNND 3LHPS 1O29A 3K5OA 2YU9A 3GTLA 4GTAA 2JH3A 2JA7A 4KM8A 3NUHA 1XXCA 4QCLA 3AQPA 2Y0SA 3K5LA 2XCQA 4C3IC 5IORA 3DU6A 1TL8A 5IOQA 1TGOA 2JA6A 4KMHA 5CJ9A 5JVOA 4KASA 4C2MA 1AB4A 3WVOA 4G0UA 3Q3QA 4GTCA 2RGRA 1BJTA 4GTFA 3K5NA 1O25A 3KYLA 4NOLA 4NOKA 4Q5GA 2WB1A 4IP8A 3FOEA 2R4GA 3L4JA 1O2BA 2A6HD 1TWAA 1EH1A 1WQGA 5CQGA 1WQHA 1SC7A 5JSNB 1XXAA 3CAGA 5MLC9 3G4AA 4GT9A 1I50A 2O5JD 1Y698 1O2AA 3L4KA 4DDQA 2CW0D 1RRJA 1K83A 1SMYD 4D3YA 2E2HA 5IOSA 2GSOA 1HQMD 4H3TA 3K58A 4AN8A 1O24A 1R9TA 1ZVUA 2KWAA 2B9SB 3GTKA 4KMDA 1XXBA 1GE9A 3LPXA 4BLAA 3S0XA 4P5AA 3AQOA 5CHPA 2RH6A 3QX3A 2VUMA 4EJ3A 3M4AA 2ZFZA 1IS1A 3BUEA 3FKIA 1ISEA 3GTJA 4ILDA 2E2IA 3K5MA 2NVYA 1TWCA 4FYDA 4GTBA 1A35A 2GSNA 4GTLA 2WAQA 2A6ED 4LR2A 4IP9A 1R5ZA 4NOMA 3LF9A 4FM9A 1B4BA 3SJRA 3G4CA 4P5BA 4KB4A 2B63A 1BGWA 2R93A 4C2MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y69 8;  3L4K A;  3LHP S;  1EK8 A;  4DDQ A;  3ERE D;  3ORE A;  4G0U A;  4GFQ A;  4KB2 A;  2XCR B;  3NUH A;  4G0V A;  3VA7 A;  4KDD A;  2XCO A;  1XXC A;  1ZVU A;  2XCQ A;  2KWA A;  1WQF A;  5JVO A;  1XXB A;  1GE9 A;  3LPX A;  5CJ9 A;  5JSB B;  4J3N A;  2PHC B;  3OPF A;  3QX3 A;  1AB4 A;  2Y3P A;  1IS1 A;  4KAW X;  2ZFZ A;  3BUE A;  3FOF A;  4OYD B;  1BJT A;  1B4A A;  3MML B;  3LAP A;  3V4G A;  1F9N A;  3FHZ A;  2RGR A;  1ISE A;  2P5M A;  1WIH A;  1DD5 A;  3OEP A;  4G0W A;  4L8I A;  3FOE A;  3L4J A;  3LF9 A;  4FM9 A;  4KC6 A;  1B4B A;  1EH1 A;  1WQG A;  1XXA A;  1WQH A;  4KB4 A;  5JSN B;  3CAG A;  5MLC 9;  1BGW A;  3LAJ A;  4JLR C; 
#chains in the Genus database with same CATH topology
 4OIN A;  2JA5 C;  1TWC K;  2R92 K;  4A3F K;  1YNJ A;  4AHC A;  1K4T A;  4BKW A;  2R7Z C;  1T8I A;  1INN A;  3GTG A;  1VJE A;  2JA8 C;  5C4J K;  5JSB B;  4A3J K;  3FKI K;  1K4S A;  2NVX K;  3S14 C;  1X31 C;  3GTP K;  1K83 K;  2P5M A;  2Y0S D;  1BDF A;  1Y1W C;  1IBA A;  2R7Z A;  4A3G K;  3GEE A;  4A3C C;  2Y0S L;  1ZBS A;  3GIR A;  4JLR C;  3S16 C;  4A3I C;  1XZQ A;  2R92 C;  4QJV A;  1YCL A;  4G0V A;  4RMF A;  5FLM C;  2GAH C;  4BBS K;  1Y1W A;  4QIW L;  4A3G C;  2O5J A;  1DCH A;  4LK1 A;  1XPP A;  2GSU A;  1I6H K;  3S1M K;  4PAA A;  2R92 A;  2E2I K;  1K83 C;  4A3L K;  3S1Q C;  2CFA A;  3K7A K;  2O5I A;  4QJV B;  4G7H A;  1O27 A;  4AYB A;  1J6W A;  4F3E A;  3P9A A;  2A68 D;  1L0W A;  3GTJ K;  4GTA A;  3PO2 K;  3GEH A;  1F93 A;  4KM8 A;  1DCP A;  3AD7 C;  2NVT C;  4QCL A;  3AQP A;  4BBS C;  2FQT A;  3DU6 A;  3GTK K;  1TL8 A;  2JA6 A;  1IW7 A;  4A3M K;  4OIO A;  2B63 C;  4KAS A;  4C3I K;  2R93 C;  4C2M A;  1TWF K;  5IYB K;  5C44 C;  2NVX C;  2RGR A;  1BJT A;  3S1Q K;  4A3L C;  4LOW A;  4NOK A;  1WOS A;  1TWG C;  2WB1 A;  1Y1W K;  1O2B A;  1WOO A;  3CAG A;  3G4A A;  1WQH A;  1WCM C;  5JSN B;  3JST A;  1I50 A;  1SMY D;  4YFX A;  4YFK A;  3RZD K;  1O24 A;  2KWA A;  4C3J K;  4XSZ A;  1IQ0 A;  3S15 C;  4MEX A;  5IP7 K;  3S0X A;  3AQO A;  5CHP A;  2PMZ D;  5IYD C;  3M4A A;  1I50 C;  1RU0 A;  3T00 A;  1EQR A;  3H3V D;  1ISE A;  3M3Y C;  4GTB A;  2NVY A;  1WOP A;  4LK0 A;  4Y52 K;  3SJR A;  4KB4 A;  3HOZ C;  1BGW A;  3S2H C;  1MIU A;  4BBR K;  4A3E K;  4C3H K;  3GTQ A;  3IAY A;  1USO A;  4FGU A;  2V6S A;  5IP9 C;  4AYB D;  3HOX K;  4A3K C;  2NVY C;  3GTO K;  4G7Z A;  1TWH K;  4BY7 C;  3GEI A;  4LJZ A;  4A93 C;  1XZP B;  3MAQ A;  3TFI A;  1O26 A;  3ADA C;  4BBR C;  3GTM C;  3LAP A;  1WIH A;  1DD5 A;  4O26 A;  1VGX A;  4A3D C;  2D6F C;  3K59 A;  4BY7 K;  1HQM A;  1SFO A;  2F4Q A;  2PA8 D;  4A3E C;  3GTO A;  3GTP A;  1G51 A;  4C3H C;  3S1N K;  4YG2 A;  3SZY A;  2WB1 D;  3GTM A;  2E2I C;  3S2D K;  1IE0 A;  3BP8 C;  4C3J C;  4FZB A;  4AYB L;  1V9M A;  3EQL A;  1SMY A;  2JA5 A;  1IL2 A;  2YU9 C;  4KAW X;  1SEU A;  4OYD B;  3FHZ A;  2A69 D;  1LPQ A;  2VUM K;  3GTG C;  1O28 A;  2JA7 K;  3M4O K;  1YNN D;  2YU9 A;  2E2H K;  1HI9 A;  3RZO K;  2P8T A;  5M3M K;  4A93 K;  5JVO A;  1TGO A;  4KMH A;  5CJ9 A;  2WAQ L;  4MEY A;  2GAG C;  3WVO A;  3Q3Q A;  4GTC A;  5HL8 A;  1O25 A;  3KYL A;  2E2H C;  1Y1V K;  5C4J C;  4A3J C;  3S1M C;  2NVQ K;  3HOU K;  5CQG A;  4KN7 A;  1PJ7 A;  1K83 A;  4KMU A;  3S1N C;  2E2H A;  4H3T A;  4AN8 A;  5FJ8 K;  3S16 K;  4NOI A;  1R9T A;  4Q5S A;  2B9S B;  1C0A A;  4KMD A;  5E68 A;  1GE9 A;  4BLA A;  1EFW A;  1I3Q C;  4P5A A;  1YX2 A;  2RH6 A;  1VLO A;  2ZFZ A;  3H0G K;  2YU9 K;  5C4X K;  4WJ4 A;  4GTL A;  1TWC A;  3PO3 C;  1A35 A;  4A3I K;  2WAQ A;  2A6E D;  4IP9 A;  4FM9 A;  2JA5 K;  3GTG K;  1R9T C;  3A8I A;  3AD8 C;  3I4N K;  2B63 A;  3I4M C;  3GTQ K;  2R93 A;  4C2M C;  4BLB A;  1EK8 A;  4GFQ A;  3N0C A;  3GTM K;  1VRQ C;  3H3V L;  1JVI A;  3VA7 A;  1TWC C;  4OIP A;  4XCH A;  2CFA B;  2E2J C;  2PMZ L;  3I4N C;  4LQY A;  4J3N A;  1A36 A;  3OPF A;  3HKZ A;  2R7Z K;  5D4D A;  3FOF A;  1ZYR D;  4LMO A;  1B4A A;  1F9N A;  2FQO A;  1WOR A;  4GTE A;  4AH6 A;  4A3M C;  4L8I A;  2V6U A;  1R9T K;  3S1R K;  4QIW A;  3AH5 A;  2W7V A;  4XLN A;  5FLM K;  3WOD A;  3GDZ A;  1I6V D;  4Q5V A;  4KAT A;  5TJ3 A;  4KB2 A;  1R49 A;  4KDD A;  1Q8I A;  4ZH4 A;  5IYB C;  1V5V A;  4BXX K;  4M1X A;  1Y1V A;  1BS2 A;  1WSR A;  2Y3P A;  3ERE D;  1TWF A;  4OIR A;  3HOV C;  1RR8 C;  1YNJ D;  4FXD A;  1F7U A;  1JOE A;  4MQ9 A;  2PMZ A;  4D3Z A;  4XSX A;  5EGE A;  3LHP S;  2NVT K;  1O29 A;  3HOV K;  2JA7 A;  3FKI C;  3NUH A;  3GTJ C;  4O2D A;  4C3I C;  4BXX C;  5IOR A;  5IYC K;  2E2J K;  1SFO C;  5IOQ A;  4A3K K;  1TWG K;  1J6X A;  3GTO C;  4G0U A;  3K5N A;  4Q5G A;  3T02 A;  1WCM K;  3S2H K;  4IP8 A;  3FOE A;  5TMC A;  2BE5 A;  3HKZ D;  5IYC C;  1SC7 A;  2JA6 K;  3BP3 A;  1ZYR A;  4GT9 A;  3K7A C;  1O2A A;  4DDQ A;  2CW0 D;  1RRJ A;  4A3B C;  5C4X C;  3M4O C;  1I6H C;  2GSO A;  1HQM D;  4QIW D;  1ZVU A;  4X6A C;  3AD9 C;  3LPX A;  4LLG A;  3QX3 A;  2VUM A;  4EJ3 A;  1USM A;  4JK1 A;  4ILD A;  5IOS A;  5IP7 C;  3K5M A;  5L46 A;  1JQW A;  3LF9 A;  3G4C A;  4X6A K;  3M3Y K;  1WSV A;  3T01 A;  1IW7 D;  4XLP A;  2VUM C;  4A3B K;  3CQZ A;  4GTD A;  1A31 A;  1J6V A;  2B63 K;  3H0G A;  2V6T A;  2XCO A;  3IPJ A;  4PAB A;  4KAR A;  1WQF A;  2PPB A;  1PJ6 A;  4KMA A;  3S1R C;  1SFO K;  1XZQ B;  4BY1 C;  3RZD C;  2WB1 L;  1EI6 A;  4Q4Z A;  2A6H A;  2PHC B;  3N0B A;  5TMF A;  3MML B;  3CQZ C;  5EGH A;  1ZXO A;  1NH3 A;  3H0G C;  3HOW K;  5C3E K;  3HOY C;  1I3Q A;  3GSI A;  2JA6 C;  3LAJ A;  1XZP A;  1TWH A;  2NVQ C;  3ORE A;  2NVX A;  1PJ5 A;  5M5W K;  1UV7 A;  2XCR B;  4C2M K;  2BE5 D;  5IYD K;  1TWG A;  5M5X K;  2R93 K;  5IOT A;  3S17 C;  4A3C K;  3HOW C;  5C9H A;  4YFN A;  2CW0 A;  3SZZ A;  1F7V A;  1WCM A;  4Y52 C;  4WJ3 M;  3DU5 A;  3N3Y A;  4KM9 A;  1TWH C;  3GTL C;  3CQZ K;  1KQ4 A;  3OEP A;  5JFE A;  1EJ9 A;  5C3E C;  4KC6 A;  3HOY K;  4Y7N C;  3V4G A;  3K57 A;  3TFJ A;  2NVY K;  4G0W A;  3RZO C;  3K5O A;  3GTL A;  2JH3 A;  2WAQ D;  2A6E A;  5M3F K;  3S15 K;  2EBB A;  3TFH A;  3A8K A;  3I4M K;  1XXC A;  2Y0S A;  3K5L A;  2XCQ A;  1I50 K;  4WIL A;  2ZUF A;  3S2D C;  1TWA K;  4A3D K;  4KN4 A;  4OIQ A;  1ZQ1 C;  1AB4 A;  3S14 K;  4GTF A;  3PO2 C;  4NOL A;  1VH2 A;  3GTQ C;  3A8J A;  3HKZ L;  3HOZ K;  3GTK C;  2R4G A;  3L4J A;  2PA8 L;  2A6H D;  1TWA A;  4G7O A;  1EH1 A;  1WQG A;  1XXA A;  1Y1V C;  5MLC 9;  2ZUE A;  5IP9 K;  2O5J D;  1Y69 8;  3HOX C;  1TWF C;  5C44 K;  3L4K A;  3HOU C;  4D3Y A;  4A3F C;  5M5Y K;  3HXA A;  1I3Q K;  3K58 A;  2A69 A;  1DCO A;  3GTK A;  3S17 K;  1XXB A;  1TWA C;  1I6V A;  4C45 A;  1O2F B;  3PO3 K;  4P9S A;  1IS1 A;  3BUE A;  2A68 A;  3GTL K;  1J98 A;  1YNN A;  3GTP C;  3FKI A;  2JA7 C;  3GTJ A;  2E2I A;  4FYD A;  2GSN A;  4LR2 A;  1R5Z A;  4NOM A;  1B4B A;  2JA8 K;  4P5B A;  4GZY A;  3DXJ A;  4BY1 K;  4Y7N K;  3TTG A; 
#chains in the Genus database with same CATH homology
 1MIU A;  4BLB A;  1EK8 A;  1IW7 D;  3CQZ A;  4GTD A;  4GFQ A;  3N0C A;  1A31 A;  3GTQ A;  4AHC A;  3IAY A;  4FGU A;  3H0G A;  1K4T A;  2XCO A;  4BKW A;  3VA7 A;  1T8I A;  3GTG A;  2CFA B;  4KAR A;  1WQF A;  4KMA A;  4LQY A;  3MAQ A;  5JSB B;  1A36 A;  4J3N A;  2PHC B;  3HKZ A;  3OPF A;  1K4S A;  3N0B A;  1O26 A;  3FOF A;  1ZYR D;  4LMO A;  1B4A A;  3MML B;  3LAP A;  1F9N A;  5EGH A;  1ZXO A;  2P5M A;  1WIH A;  1DD5 A;  4O26 A;  4GTE A;  4L8I A;  1NH3 A;  3K59 A;  2R7Z A;  4QIW A;  3AH5 A;  1I3Q A;  1SFO A;  1ZBS A;  2F4Q A;  3LAJ A;  4JLR C;  1TWH A;  1I6V D;  3GTO A;  4Q5V A;  3GTP A;  3ORE A;  4C3H C;  4KAT A;  2NVX A;  5TJ3 A;  4KB2 A;  3GTM A;  2XCR B;  4G0V A;  2BE5 D;  1R49 A;  4KDD A;  1Q8I A;  1TWG A;  1Y1W A;  4M1X A;  5IOT A;  4C3J C;  5C9H A;  4FZB A;  1V9M A;  1WCM A;  1Y1V A;  2JA5 A;  2GSU A;  3DU5 A;  2Y3P A;  4KAW X;  3N3Y A;  1TWF A;  4KM9 A;  1SEU A;  4OYD B;  2R92 A;  3ERE D;  1KQ4 A;  3FHZ A;  2A69 D;  2CFA A;  3OEP A;  1RR8 C;  1YNJ D;  5JFE A;  1LPQ A;  1O27 A;  1EJ9 A;  4FXD A;  4AYB A;  4KC6 A;  4F3E A;  2PMZ A;  4D3Z A;  1O28 A;  3P9A A;  5EGE A;  2A68 D;  3K57 A;  3V4G A;  4G0W A;  1YNN D;  3LHP S;  1O29 A;  3K5O A;  2YU9 A;  3GTL A;  4GTA A;  2JH3 A;  2JA7 A;  4KM8 A;  3NUH A;  1XXC A;  4QCL A;  3AQP A;  2Y0S A;  3K5L A;  2XCQ A;  4C3I C;  5IOR A;  3DU6 A;  1TL8 A;  5IOQ A;  1TGO A;  2JA6 A;  4KMH A;  5CJ9 A;  5JVO A;  4KAS A;  4C2M A;  1AB4 A;  3WVO A;  4G0U A;  3Q3Q A;  4GTC A;  2RGR A;  1BJT A;  4GTF A;  3K5N A;  1O25 A;  3KYL A;  4NOL A;  4NOK A;  4Q5G A;  2WB1 A;  4IP8 A;  3FOE A;  2R4G A;  3L4J A;  1O2B A;  2A6H D;  1TWA A;  1EH1 A;  1WQG A;  5CQG A;  1WQH A;  1SC7 A;  5JSN B;  1XXA A;  3CAG A;  5MLC 9;  3G4A A;  4GT9 A;  1I50 A;  2O5J D;  1Y69 8;  1O2A A;  3L4K A;  4DDQ A;  2CW0 D;  1RRJ A;  1K83 A;  1SMY D;  4D3Y A;  2E2H A;  5IOS A;  2GSO A;  1HQM D;  4H3T A;  3K58 A;  4AN8 A;  1O24 A;  1R9T A;  1ZVU A;  2KWA A;  2B9S B;  3GTK A;  4KMD A;  1XXB A;  1GE9 A;  3LPX A;  4BLA A;  3S0X A;  4P5A A;  3AQO A;  5CHP A;  2RH6 A;  3QX3 A;  2VUM A;  4EJ3 A;  3M4A A;  2ZFZ A;  1IS1 A;  3BUE A;  3FKI A;  1ISE A;  3GTJ A;  4ILD A;  2E2I A;  3K5M A;  2NVY A;  1TWC A;  4FYD A;  4GTB A;  1A35 A;  2GSN A;  4GTL A;  2WAQ A;  2A6E D;  4LR2 A;  4IP9 A;  1R5Z A;  4NOM A;  3LF9 A;  4FM9 A;  1B4B A;  3SJR A;  3G4C A;  4P5B A;  4KB4 A;  2B63 A;  1BGW A;  2R93 A;  4C2M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...