4KB2A

Crystal structure of ribosome recycling factor mutant r109a from mycobacterium tuberculosis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
184
structure length
184
Chain Sequence
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEEARRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
total genus 64
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kb2A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kb2A02
2P5MA 5JSBB 3OEPA 4JLRC 5JSNB 3NUHA 2RGRA 4G0UA 4DDQA 1WQGA 4KC6A 4L8IA 3VA7A 4KB2A 5JVOA 1BGWA 4J3NA 1BJTA 3LPXA 1XXAA 3LAJA 3QX3A 1ISEA 3FOEA 2KWAA 1B4BA 3LF9A 3LAPA 2XCRB 1F9NA 1WQHA 2Y3PA 5MLC9 3OREA 3V4GA 3FHZA 5CJ9A 3BUEA 2XCOA 3OPFA 3L4JA 1B4AA 3MMLB 4KDDA 2XCQA 3CAGA 3FOFA 1ZVUA 2ZFZA 3L4KA 3ERED 4G0WA 1WQFA 3LHPS 1GE9A 1EH1A 1Y698 2PHCB 1DD5A 4G0VA 4GFQA 1AB4A 4KB4A 1EK8A 1XXBA 4OYDB 1IS1A 1XXCA 4FM9A 1WIHA 4KAWX
chains in the Genus database with same CATH superfamily
4C2MA 1HI9A 2PMZL 2A68D 1I50A 1VJEA 1WORA 4KN4A 1EQRA 5M5XK 2ZUEA 1IL2A 5IOSA 3GTPC 3H0GC 1BJTA 3S17C 1BDFA 1SFOC 4P5AA 2VUMK 3A8IA 3H0GK 2JA5C 3S17K 1SFOK 3GEIA 4KMDA 2XCOA 4GTCA 1IW7A 1ZBSA 1XZQB 5IP7K 4PABA 3GTJC 5C4XC 2PMZA 1Y1WC 5C4XK 1AB4A 1R9TA 3PO2K 4GTEA 2Y0SL 1Y1WK 2BE5A 3EQLA 3S16C 3S0XA 4XSXA 3GTPA 3S16K 4ILDA 2JA5A 1IW7D 1XZQA 3K57A 1A35A 4QJVB 5M5YK 4A3BC 4BBRC 4KMHA 1EI6A 1IBAA 4KDDA 2Y0SA 3T02A 4A3BK 4C3JC 3AD9C 4BBRK 1IE0A 1L0WA 5E68A 2BE5D 4KB4A 4C3JK 4Q5GA 3GTOA 1TWGC 5M5WK 1O28A 1TWGK 2W7VA 4NOKA 4XSZA 1XXAA 5FJ8K 2JA8C 1NH3A 2Y3PA 5C3EC 4QJVA 1Q8IA 4GTDA 2V6TA 1K4SA 4QCLA 5C3EK 5D4DA 2CFAB 3S1MK 3GTKA 3CAGA 2CW0A 4YFNA 4BLAA 4YFXA 4LK0A 3PO3C 3HOXC 3GTLK 1K83C 2NVYA 3SJRA 5M3MK 4A3DK 5JSBB 2WAQL 3TFIA 3NUHA 2R7ZC 4KC6A 1JQWA 4AYBL 2R4GA 4LJZA 3LPXA 4OIPA 1TGOA 3H3VL 4A3MK 3M3YC 2JH3A 2CFAA 3HOVC 3M3YK 3RZDK 2V6SA 4G7OA 3OPFA 5IORA 2NVTC 1Y1VC 4MEYA 2JA7A 5IP9K 5CHPA 1SC7A 2NVTK 3M4OC 1Y1VK 1DCHA 4G7ZA 4A3EC 3M4OK 2NVXA 3S14C 4C2MC 4P5BA 1K83A 1I50C 3S14K 1HQMA 4C2MK 3RZOC 2RGRA 4NOMA 1XPPA 4KB2A 2FQOA 4G7HA 2R7ZA 3KYLA 5L46A 3CQZA 3HOWK 1DCOA 2FQTA 3K5NA 4LK1A 3K5MA 3S2HC 3BUEA 2E2IK 3HOYC 3L4JA 1KQ4A 1XZPB 1PJ5A 3S2HK 2XCQA 4O26A 3S1QK 1DD5A 1R9TC 2E2JC 1O2AA 3AQPA 4KMUA 1RRJA 1WIHA 1PJ6A 4YG2A 1R9TK 2E2JK 2R93A 3AH5A 4GZYA 5C44C 4EJ3A 5C44K 3GTPK 2P8TA 3AD8C 4Y52C 2R92A 1XZPA 4OIQA 4FZBA 2JA5K 4OIRA 5IYDC 5C4JC 2YU9A 1YX2A 3Q3QA 3LHPS 4MEXA 1GE9A 3GTJK 3GTOC 4AN8A 4IP9A 5C9HA 4BKWA 4OIOA 4WILA 1J98A 3GTOK 5IYBC 1TWHA 5JSNB 5M3FK 1I6HC 4M1XA 4Y7NC 3HKZA 4KM8A 1TWAA 3FKIA 2V6UA 1F7UA 1WOOA 4LR2A 1WSVA 3GTKC 5CQGA 3N3YA 4GTBA 4KATA 3I4MC 3GTKK 3P9AA 2NVYC 3I4MK 3GTQC 4OYDB 2NVYK 2P5MA 3IPJA 3OEPA 1USMA 3HKZD 4G0UA 2VUMA 3K58A 4A3IC 1T8IA 1WOSA 2ZUFA 3QX3A 3FOEA 2KWAA 3HOUC 4D3ZA 1B4BA 1BS2A 4A3CC 3HOUK 1WSRA 4BY7C 3S1NC 2JA8K 1R49A 2F4QA 4BY7K 1I3QA 1JVIA 3S1NK 2JA7C 3FOFA 4KASA 4Q5SA 2JA7K 1Y698 2PHCB 4G0VA 1DCPA 2NVXC 1XXCA 2O5IA 1ZXOA 3GTQA 2NVXK 5TMCA 3PO3K 5FLMC 3HOXK 1C0AA 1K83K 4F3EA 4DDQA 3TTGA 5FLMK 3CQZC 2WB1D 1X31C 2R7ZK 2E2HA 3T01A 3CQZK 3GSIA 1O27A 3IAYA 5IOQA 3S1RC 1I6VA 1VGXA 4KN7A 3S1RK 3K5LA 3HOVK 1ZVUA 1J6VA 5IYCC 1O2FB 4C3HC 4A3JC 2R93C 3WVOA 4NOIA 4A3EK 1LPQA 1WCMA 1F93A 2R93K 1I50K 4WJ3M 2GAGC 1VLOA 4NOLA 3LAJA 3RZOK 1I6VD 3LF9A 2XCRB 2O5JA 1WQHA 2R92C 4QIWA 1EJ9A 4XLNA 5CJ9A 3TFJA 4AH6A 2R92K 4PAAA 1B4AA 1SMYA 2YU9C 3GTLA 4C45A 3ERED 3S2DC 1ZYRA 3HOYK 1EH1A 1V9MA 3S2DK 2B63A 4KM9A 4C3IC 4LLGA 2JA6A 1PJ7A 5IOTA 1TWHC 4C3IK 3K7AC 3GEHA 3VA7A 4A3GC 3DU6A 1INNA 1TWHK 4J3NA 2O5JD 1TWAC 3HXAA 3FKIC 3K7AK 1EFWA 3JSTA 4BBSC 4QIWD 3GEEA 4Q5VA 3LAPA 3GTGC 2A6ED 1O25A 3FKIK 4LQYA 4BBSK 1SMYD 1IQ0A 2PPBA 3HKZL 1ZYRD 4GTLA 1RU0A 1SEUA 4Y52K 3I4NC 3L4KA 5TMFA 1WQFA 4FYDA 2A6HA 1V5VA 5IYDK 5C4JK 1G51A 4FXDA 4A3LC 2PA8D 1UV7A 1VH2A 4A3LK 3AD7C 1A31A 2VUMC 1WQGA 4GTFA 1JOEA 4P9SA 4GT9A 5IYBK 3WODA 1I6HK 2E2IA 4Y7NK 4BLBA 3OREA 3BP8C 3GTGA 3V4GA 3GTMA 5IP7C 1TWFA 3K5OA 3GIRA 1ZQ1C 1I3QC 1TWCA 1RR8C 4WJ4A 5HL8A 2A6HD 1I3QK 3PO2C 2WB1L 4BY1C 3G4AA 2GAHC 4GFQA 3A8JA 1XXBA 4BY1K 4YFKA 1WOPA 3DU5A 2GSUA 2GSOA 3GTQK 4IP8A 1MIUA 3A8KA 1O2BA 4L8IA 3H0GA 4X6AC 2E2HC 1SFOA 3G4CA 4X6AK 4A3IK 2E2HK 2WB1A 2PMZD 4A93C 3MMLB 4A3CK 1USOA 4A93K 1YNJA 3GTJA 4BXXC 5EGHA 1Y1WA 2NVQC 4FM9A 2EBBA 4BXXK 4D3YA 2NVQK 1WCMC 4FGUA 4JLRC 3N0BA 1WCMK 4O2DA 3T00A 3AQOA 1TL8A 1F9NA 5MLC9 4OINA 3S1MC 4LMOA 2Y0SD 2D6FC 3GDZA 3N0CA 5JFEA 1YNJD 3K59A 2B9SB 4XCHA 3GTLC 4MQ9A 3BP3A 2A69A 1VRQC 4QIWL 4A3DC 1O24A 1YNNA 1F7VA 2B63C 2JA6C 2B63K 1O29A 1TWGA 2JA6K 3ADAC 3HOZC 5IYCK 4C3HK 4A3JK 4A3MC 1BGWA 4JK1A 3HOZK 1ISEA 1J6WA 1K4TA 3RZDC 4A3KC 3S15C 2PA8L 3FHZA 4ZH4A 4A3KK 5IP9C 2CW0D 3S15K 4H3TA 2A69D 2A6EA 4LOWA 4Q4ZA 4XLPA 1YNND 2WAQA 2ZFZA 4G0WA 2GSNA 3MAQA 4AYBA 2YU9K 1EK8A 1IS1A 4GTAA 3TFHA 4RMFA 2A68A 1R5ZA 5JVOA 3HOWC 3SZYA 2E2IC 4A3GK 4AHCA 4KARA 5TJ3A 1TWAK 3GTMC 1TWFC 5EGEA 3SZZA 1TWCC 3GTGK 3S1QC 2WAQD 3GTMK 1TWFK 1O26A 4AYBD 1TWCK 1Y1VA 1YCLA 3M4AA 4A3FC 4KMAA 3I4NK 3H3VD 1HQMD 2RH6A 3DXJA 1J6XA 1A36A 4KAWX 4A3FK
chains in the Genus database with same CATH topology
4C2MA 1K83A 3GTQA 2A68D 3DU5A 1I50A 2GSUA 2GSOA 4IP8A 1MIUA 4F3EA 1O2BA 1ZXOA 4DDQA 2RGRA 4L8IA 4NOMA 4KB2A 5IOSA 2R7ZA 3KYLA 1BJTA 3H0GA 3CQZA 4P5AA 2E2HA 1SFOA 3G4CA 1O27A 3IAYA 5IOQA 3K5NA 2WB1A 3K5MA 4KMDA 3BUEA 2XCOA 3L4JA 3MMLB 1KQ4A 4GTCA 3K5LA 1ZBSA 2XCQA 1ZVUA 2PMZA 4O26A 3GTJA 5EGHA 1DD5A 1Y1WA 1AB4A 1R9TA 1O2AA 3AQPA 4FM9A 1RRJA 1WIHA 4GTEA 4C3HC 3WVOA 4D3YA 2R93A 4FGUA 1LPQA 1WCMA 4JLRC 3AH5A 3S0XA 3N0BA 4EJ3A 3LAJA 4NOLA 3GTPA 4ILDA 1I6VD 3LF9A 3AQOA 1TL8A 2XCRB 1F9NA 1WQHA 5MLC9 4QIWA 1EJ9A 2R92A 4LMOA 2JA5A 1IW7D 4FZBA 3K57A 5CJ9A 1A35A 3N0CA 1B4AA 1YNJD 5JFEA 4KMHA 3K59A 2B9SB 4KDDA 2Y0SA 2YU9A 3GTLA 3Q3QA 3ERED 4C3JC 3LHPS 1GE9A 1EH1A 1O24A 1V9MA 2BE5D 4KB4A 2B63A 4KM9A 4Q5GA 4AN8A 4IP9A 5C9HA 4BKWA 3GTOA 2JA6A 4C3IC 1O29A 1TWGA 1O28A 5IOTA 1TWHA 5JSNB 3VA7A 4NOKA 3DU6A 1BGWA 4M1XA 4J3NA 2O5JD 3HKZA 1XXAA 1TWAA 4KM8A 1ISEA 3FKIA 1K4TA 4Q5VA 3LAPA 2A6ED 1NH3A 1O25A 2Y3PA 4LQYA 1SMYD 1Q8IA 4GTDA 1K4SA 3FHZA 4QCLA 2CW0D 4LR2A 4H3TA 2A69D 2CFAB 1ZYRD 4GTLA 1SEUA 5CQGA 3N3YA 4GTBA 3GTKA 3L4KA 3CAGA 1YNND 2WAQA 2ZFZA 4KATA 2GSNA 4G0WA 1WQFA 4FYDA 3MAQA 4BLAA 4AYBA 3P9AA 4C2MC 2NVYA 1EK8A 4FXDA 4OYDB 1IS1A 4GTAA 3SJRA 2P5MA 5JSBB 3OEPA 3NUHA 1A31A 4G0UA 1WQGA 4KC6A 4GTFA 2VUMA 5JVOA 1R5ZA 2R4GA 3K58A 1T8IA 3LPXA 4GT9A 3QX3A 3FOEA 2KWAA 4D3ZA 1TGOA 1B4BA 4AHCA 4KARA 2E2IA 5TJ3A 4BLBA 3OREA 2JH3A 2CFAA 3GTGA 5EGEA 3V4GA 3GTMA 1TWFA 3K5OA 1R49A 2F4QA 3OPFA 1TWCA 5IORA 1I3QA 1RR8C 1O26A 2A6HD 3FOFA 1Y1VA 2JA7A 4KASA 5CHPA 1SC7A 1Y698 3M4AA 2PHCB 3G4AA 4G0VA 4KMAA 4GFQA 1HQMD 2RH6A 2NVXA 1XXBA 1XXCA 1A36A 4P5BA 4KAWX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5M A;  5JSB B;  3OEP A;  4JLR C;  5JSN B;  3NUH A;  2RGR A;  4G0U A;  4DDQ A;  1WQG A;  4KC6 A;  4L8I A;  3VA7 A;  4KB2 A;  5JVO A;  1BGW A;  4J3N A;  1BJT A;  3LPX A;  1XXA A;  3LAJ A;  3QX3 A;  1ISE A;  3FOE A;  2KWA A;  1B4B A;  3LF9 A;  3LAP A;  2XCR B;  1F9N A;  1WQH A;  2Y3P A;  5MLC 9;  3ORE A;  3V4G A;  3FHZ A;  5CJ9 A;  3BUE A;  2XCO A;  3OPF A;  3L4J A;  1B4A A;  3MML B;  4KDD A;  2XCQ A;  3CAG A;  3FOF A;  1ZVU A;  2ZFZ A;  3L4K A;  3ERE D;  4G0W A;  1WQF A;  3LHP S;  1GE9 A;  1EH1 A;  1Y69 8;  2PHC B;  1DD5 A;  4G0V A;  4GFQ A;  1AB4 A;  4KB4 A;  1EK8 A;  1XXB A;  4OYD B;  1IS1 A;  1XXC A;  4FM9 A;  1WIH A;  4KAW X; 
#chains in the Genus database with same CATH topology
 4C2M A;  1HI9 A;  2PMZ L;  2A68 D;  1I50 A;  1VJE A;  1WOR A;  4KN4 A;  1EQR A;  5M5X K;  2ZUE A;  1IL2 A;  5IOS A;  3GTP C;  3H0G C;  1BJT A;  3S17 C;  1BDF A;  1SFO C;  4P5A A;  2VUM K;  3A8I A;  3H0G K;  2JA5 C;  3S17 K;  1SFO K;  3GEI A;  4KMD A;  2XCO A;  4GTC A;  1IW7 A;  1ZBS A;  1XZQ B;  5IP7 K;  4PAB A;  3GTJ C;  5C4X C;  2PMZ A;  1Y1W C;  5C4X K;  1AB4 A;  1R9T A;  3PO2 K;  4GTE A;  2Y0S L;  1Y1W K;  2BE5 A;  3EQL A;  3S16 C;  3S0X A;  4XSX A;  3GTP A;  3S16 K;  4ILD A;  2JA5 A;  1IW7 D;  1XZQ A;  3K57 A;  1A35 A;  4QJV B;  5M5Y K;  4A3B C;  4BBR C;  4KMH A;  1EI6 A;  1IBA A;  4KDD A;  2Y0S A;  3T02 A;  4A3B K;  4C3J C;  3AD9 C;  4BBR K;  1IE0 A;  1L0W A;  5E68 A;  2BE5 D;  4KB4 A;  4C3J K;  4Q5G A;  3GTO A;  1TWG C;  5M5W K;  1O28 A;  1TWG K;  2W7V A;  4NOK A;  4XSZ A;  1XXA A;  5FJ8 K;  2JA8 C;  1NH3 A;  2Y3P A;  5C3E C;  4QJV A;  1Q8I A;  4GTD A;  2V6T A;  1K4S A;  4QCL A;  5C3E K;  5D4D A;  2CFA B;  3S1M K;  3GTK A;  3CAG A;  2CW0 A;  4YFN A;  4BLA A;  4YFX A;  4LK0 A;  3PO3 C;  3HOX C;  3GTL K;  1K83 C;  2NVY A;  3SJR A;  5M3M K;  4A3D K;  5JSB B;  2WAQ L;  3TFI A;  3NUH A;  2R7Z C;  4KC6 A;  1JQW A;  4AYB L;  2R4G A;  4LJZ A;  3LPX A;  4OIP A;  1TGO A;  3H3V L;  4A3M K;  3M3Y C;  2JH3 A;  2CFA A;  3HOV C;  3M3Y K;  3RZD K;  2V6S A;  4G7O A;  3OPF A;  5IOR A;  2NVT C;  1Y1V C;  4MEY A;  2JA7 A;  5IP9 K;  5CHP A;  1SC7 A;  2NVT K;  3M4O C;  1Y1V K;  1DCH A;  4G7Z A;  4A3E C;  3M4O K;  2NVX A;  3S14 C;  4C2M C;  4P5B A;  1K83 A;  1I50 C;  3S14 K;  1HQM A;  4C2M K;  3RZO C;  2RGR A;  4NOM A;  1XPP A;  4KB2 A;  2FQO A;  4G7H A;  2R7Z A;  3KYL A;  5L46 A;  3CQZ A;  3HOW K;  1DCO A;  2FQT A;  3K5N A;  4LK1 A;  3K5M A;  3S2H C;  3BUE A;  2E2I K;  3HOY C;  3L4J A;  1KQ4 A;  1XZP B;  1PJ5 A;  3S2H K;  2XCQ A;  4O26 A;  3S1Q K;  1DD5 A;  1R9T C;  2E2J C;  1O2A A;  3AQP A;  4KMU A;  1RRJ A;  1WIH A;  1PJ6 A;  4YG2 A;  1R9T K;  2E2J K;  2R93 A;  3AH5 A;  4GZY A;  5C44 C;  4EJ3 A;  5C44 K;  3GTP K;  2P8T A;  3AD8 C;  4Y52 C;  2R92 A;  1XZP A;  4OIQ A;  4FZB A;  2JA5 K;  4OIR A;  5IYD C;  5C4J C;  2YU9 A;  1YX2 A;  3Q3Q A;  3LHP S;  4MEX A;  1GE9 A;  3GTJ K;  3GTO C;  4AN8 A;  4IP9 A;  5C9H A;  4BKW A;  4OIO A;  4WIL A;  1J98 A;  3GTO K;  5IYB C;  1TWH A;  5JSN B;  5M3F K;  1I6H C;  4M1X A;  4Y7N C;  3HKZ A;  4KM8 A;  1TWA A;  3FKI A;  2V6U A;  1F7U A;  1WOO A;  4LR2 A;  1WSV A;  3GTK C;  5CQG A;  3N3Y A;  4GTB A;  4KAT A;  3I4M C;  3GTK K;  3P9A A;  2NVY C;  3I4M K;  3GTQ C;  4OYD B;  2NVY K;  2P5M A;  3IPJ A;  3OEP A;  1USM A;  3HKZ D;  4G0U A;  2VUM A;  3K58 A;  4A3I C;  1T8I A;  1WOS A;  2ZUF A;  3QX3 A;  3FOE A;  2KWA A;  3HOU C;  4D3Z A;  1B4B A;  1BS2 A;  4A3C C;  3HOU K;  1WSR A;  4BY7 C;  3S1N C;  2JA8 K;  1R49 A;  2F4Q A;  4BY7 K;  1I3Q A;  1JVI A;  3S1N K;  2JA7 C;  3FOF A;  4KAS A;  4Q5S A;  2JA7 K;  1Y69 8;  2PHC B;  4G0V A;  1DCP A;  2NVX C;  1XXC A;  2O5I A;  1ZXO A;  3GTQ A;  2NVX K;  5TMC A;  3PO3 K;  5FLM C;  3HOX K;  1C0A A;  1K83 K;  4F3E A;  4DDQ A;  3TTG A;  5FLM K;  3CQZ C;  2WB1 D;  1X31 C;  2R7Z K;  2E2H A;  3T01 A;  3CQZ K;  3GSI A;  1O27 A;  3IAY A;  5IOQ A;  3S1R C;  1I6V A;  1VGX A;  4KN7 A;  3S1R K;  3K5L A;  3HOV K;  1ZVU A;  1J6V A;  5IYC C;  1O2F B;  4C3H C;  4A3J C;  2R93 C;  3WVO A;  4NOI A;  4A3E K;  1LPQ A;  1WCM A;  1F93 A;  2R93 K;  1I50 K;  4WJ3 M;  2GAG C;  1VLO A;  4NOL A;  3LAJ A;  3RZO K;  1I6V D;  3LF9 A;  2XCR B;  2O5J A;  1WQH A;  2R92 C;  4QIW A;  1EJ9 A;  4XLN A;  5CJ9 A;  3TFJ A;  4AH6 A;  2R92 K;  4PAA A;  1B4A A;  1SMY A;  2YU9 C;  3GTL A;  4C45 A;  3ERE D;  3S2D C;  1ZYR A;  3HOY K;  1EH1 A;  1V9M A;  3S2D K;  2B63 A;  4KM9 A;  4C3I C;  4LLG A;  2JA6 A;  1PJ7 A;  5IOT A;  1TWH C;  4C3I K;  3K7A C;  3GEH A;  3VA7 A;  4A3G C;  3DU6 A;  1INN A;  1TWH K;  4J3N A;  2O5J D;  1TWA C;  3HXA A;  3FKI C;  3K7A K;  1EFW A;  3JST A;  4BBS C;  4QIW D;  3GEE A;  4Q5V A;  3LAP A;  3GTG C;  2A6E D;  1O25 A;  3FKI K;  4LQY A;  4BBS K;  1SMY D;  1IQ0 A;  2PPB A;  3HKZ L;  1ZYR D;  4GTL A;  1RU0 A;  1SEU A;  4Y52 K;  3I4N C;  3L4K A;  5TMF A;  1WQF A;  4FYD A;  2A6H A;  1V5V A;  5IYD K;  5C4J K;  1G51 A;  4FXD A;  4A3L C;  2PA8 D;  1UV7 A;  1VH2 A;  4A3L K;  3AD7 C;  1A31 A;  2VUM C;  1WQG A;  4GTF A;  1JOE A;  4P9S A;  4GT9 A;  5IYB K;  3WOD A;  1I6H K;  2E2I A;  4Y7N K;  4BLB A;  3ORE A;  3BP8 C;  3GTG A;  3V4G A;  3GTM A;  5IP7 C;  1TWF A;  3K5O A;  3GIR A;  1ZQ1 C;  1I3Q C;  1TWC A;  1RR8 C;  4WJ4 A;  5HL8 A;  2A6H D;  1I3Q K;  3PO2 C;  2WB1 L;  4BY1 C;  3G4A A;  2GAH C;  4GFQ A;  3A8J A;  1XXB A;  4BY1 K;  4YFK A;  1WOP A;  3DU5 A;  2GSU A;  2GSO A;  3GTQ K;  4IP8 A;  1MIU A;  3A8K A;  1O2B A;  4L8I A;  3H0G A;  4X6A C;  2E2H C;  1SFO A;  3G4C A;  4X6A K;  4A3I K;  2E2H K;  2WB1 A;  2PMZ D;  4A93 C;  3MML B;  4A3C K;  1USO A;  4A93 K;  1YNJ A;  3GTJ A;  4BXX C;  5EGH A;  1Y1W A;  2NVQ C;  4FM9 A;  2EBB A;  4BXX K;  4D3Y A;  2NVQ K;  1WCM C;  4FGU A;  4JLR C;  3N0B A;  1WCM K;  4O2D A;  3T00 A;  3AQO A;  1TL8 A;  1F9N A;  5MLC 9;  4OIN A;  3S1M C;  4LMO A;  2Y0S D;  2D6F C;  3GDZ A;  3N0C A;  5JFE A;  1YNJ D;  3K59 A;  2B9S B;  4XCH A;  3GTL C;  4MQ9 A;  3BP3 A;  2A69 A;  1VRQ C;  4QIW L;  4A3D C;  1O24 A;  1YNN A;  1F7V A;  2B63 C;  2JA6 C;  2B63 K;  1O29 A;  1TWG A;  2JA6 K;  3ADA C;  3HOZ C;  5IYC K;  4C3H K;  4A3J K;  4A3M C;  1BGW A;  4JK1 A;  3HOZ K;  1ISE A;  1J6W A;  1K4T A;  3RZD C;  4A3K C;  3S15 C;  2PA8 L;  3FHZ A;  4ZH4 A;  4A3K K;  5IP9 C;  2CW0 D;  3S15 K;  4H3T A;  2A69 D;  2A6E A;  4LOW A;  4Q4Z A;  4XLP A;  1YNN D;  2WAQ A;  2ZFZ A;  4G0W A;  2GSN A;  3MAQ A;  4AYB A;  2YU9 K;  1EK8 A;  1IS1 A;  4GTA A;  3TFH A;  4RMF A;  2A68 A;  1R5Z A;  5JVO A;  3HOW C;  3SZY A;  2E2I C;  4A3G K;  4AHC A;  4KAR A;  5TJ3 A;  1TWA K;  3GTM C;  1TWF C;  5EGE A;  3SZZ A;  1TWC C;  3GTG K;  3S1Q C;  2WAQ D;  3GTM K;  1TWF K;  1O26 A;  4AYB D;  1TWC K;  1Y1V A;  1YCL A;  3M4A A;  4A3F C;  4KMA A;  3I4N K;  3H3V D;  1HQM D;  2RH6 A;  3DXJ A;  1J6X A;  1A36 A;  4KAW X;  4A3F K; 
#chains in the Genus database with same CATH homology
 4C2M A;  1K83 A;  3GTQ A;  2A68 D;  3DU5 A;  1I50 A;  2GSU A;  2GSO A;  4IP8 A;  1MIU A;  4F3E A;  1O2B A;  1ZXO A;  4DDQ A;  2RGR A;  4L8I A;  4NOM A;  4KB2 A;  5IOS A;  2R7Z A;  3KYL A;  1BJT A;  3H0G A;  3CQZ A;  4P5A A;  2E2H A;  1SFO A;  3G4C A;  1O27 A;  3IAY A;  5IOQ A;  3K5N A;  2WB1 A;  3K5M A;  4KMD A;  3BUE A;  2XCO A;  3L4J A;  3MML B;  1KQ4 A;  4GTC A;  3K5L A;  1ZBS A;  2XCQ A;  1ZVU A;  2PMZ A;  4O26 A;  3GTJ A;  5EGH A;  1DD5 A;  1Y1W A;  1AB4 A;  1R9T A;  1O2A A;  3AQP A;  4FM9 A;  1RRJ A;  1WIH A;  4GTE A;  4C3H C;  3WVO A;  4D3Y A;  2R93 A;  4FGU A;  1LPQ A;  1WCM A;  4JLR C;  3AH5 A;  3S0X A;  3N0B A;  4EJ3 A;  3LAJ A;  4NOL A;  3GTP A;  4ILD A;  1I6V D;  3LF9 A;  3AQO A;  1TL8 A;  2XCR B;  1F9N A;  1WQH A;  5MLC 9;  4QIW A;  1EJ9 A;  2R92 A;  4LMO A;  2JA5 A;  1IW7 D;  4FZB A;  3K57 A;  5CJ9 A;  1A35 A;  3N0C A;  1B4A A;  1YNJ D;  5JFE A;  4KMH A;  3K59 A;  2B9S B;  4KDD A;  2Y0S A;  2YU9 A;  3GTL A;  3Q3Q A;  3ERE D;  4C3J C;  3LHP S;  1GE9 A;  1EH1 A;  1O24 A;  1V9M A;  2BE5 D;  4KB4 A;  2B63 A;  4KM9 A;  4Q5G A;  4AN8 A;  4IP9 A;  5C9H A;  4BKW A;  3GTO A;  2JA6 A;  4C3I C;  1O29 A;  1TWG A;  1O28 A;  5IOT A;  1TWH A;  5JSN B;  3VA7 A;  4NOK A;  3DU6 A;  1BGW A;  4M1X A;  4J3N A;  2O5J D;  3HKZ A;  1XXA A;  1TWA A;  4KM8 A;  1ISE A;  3FKI A;  1K4T A;  4Q5V A;  3LAP A;  2A6E D;  1NH3 A;  1O25 A;  2Y3P A;  4LQY A;  1SMY D;  1Q8I A;  4GTD A;  1K4S A;  3FHZ A;  4QCL A;  2CW0 D;  4LR2 A;  4H3T A;  2A69 D;  2CFA B;  1ZYR D;  4GTL A;  1SEU A;  5CQG A;  3N3Y A;  4GTB A;  3GTK A;  3L4K A;  3CAG A;  1YNN D;  2WAQ A;  2ZFZ A;  4KAT A;  2GSN A;  4G0W A;  1WQF A;  4FYD A;  3MAQ A;  4BLA A;  4AYB A;  3P9A A;  4C2M C;  2NVY A;  1EK8 A;  4FXD A;  4OYD B;  1IS1 A;  4GTA A;  3SJR A;  2P5M A;  5JSB B;  3OEP A;  3NUH A;  1A31 A;  4G0U A;  1WQG A;  4KC6 A;  4GTF A;  2VUM A;  5JVO A;  1R5Z A;  2R4G A;  3K58 A;  1T8I A;  3LPX A;  4GT9 A;  3QX3 A;  3FOE A;  2KWA A;  4D3Z A;  1TGO A;  1B4B A;  4AHC A;  4KAR A;  2E2I A;  5TJ3 A;  4BLB A;  3ORE A;  2JH3 A;  2CFA A;  3GTG A;  5EGE A;  3V4G A;  3GTM A;  1TWF A;  3K5O A;  1R49 A;  2F4Q A;  3OPF A;  1TWC A;  5IOR A;  1I3Q A;  1RR8 C;  1O26 A;  2A6H D;  3FOF A;  1Y1V A;  2JA7 A;  4KAS A;  5CHP A;  1SC7 A;  1Y69 8;  3M4A A;  2PHC B;  3G4A A;  4G0V A;  4KMA A;  4GFQ A;  1HQM D;  2RH6 A;  2NVX A;  1XXB A;  1XXC A;  1A36 A;  4P5B A;  4KAW X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...