4KB2A

Crystal structure of ribosome recycling factor mutant r109a from mycobacterium tuberculosis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
184
structure length
184
Chain Sequence
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEEARRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 64
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kb2A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kb2A02
3OEPA 4DDQA 4KB4A 4OYDB 2XCOA 5JVOA 2RGRA 4KC6A 1WIHA 2Y3PA 4J3NA 3OPFA 3L4KA 3FOFA 1GE9A 3CAGA 1B4AA 1EK8A 5MLC9 1BGWA 5JSBB 4KAWX 1WQGA 1IS1A 4KDDA 1AB4A 1F9NA 2PHCB 1EH1A 3BUEA 3FHZA 4G0UA 1BJTA 3MMLB 2P5MA 3LHPS 3VA7A 3LF9A 5CJ9A 1ZVUA 2XCRB 3QX3A 1WQHA 4L8IA 1XXBA 5JSNB 1Y698 4G0VA 1XXAA 3NUHA 3ERED 3OREA 1ISEA 4JLRC 3LAJA 2XCQA 4KB2A 3L4JA 1WQFA 3V4GA 4FM9A 3LAPA 1XXCA 3LPXA 4G0WA 1DD5A 3FOEA 1B4BA 2KWAA 2ZFZA 4GFQA
chains in the Genus database with same CATH superfamily
3ADAC 3AQPA 3K5NA 1Q8IA 1Y1VA 2NVQC 4A93C 1R49A 3FOFA 3A8KA 1WCMK 4BKWA 3CQZA 4A3DC 1SMYA 3M4OK 3S1QC 1I50A 3I4MK 1HQMD 4MEXA 1INNA 4LK1A 1YX2A 4LLGA 5M5WK 1TWAA 4AYBA 3K57A 2PMZL 1EI6A 1J6VA 3LAJA 3L4JA 3GTMA 1XZQB 3AD8C 3T01A 3FKIC 1TWFK 1F93A 2PA8L 4BY1K 1ZQ1C 4C2MA 2R92C 4C3HC 2W7VA 2E2HA 1SMYD 3SJRA 1PJ5A 3OPFA 3TFHA 1A35A 3HOVC 4KMAA 1UV7A 2NVYK 3LHPS 4AYBD 3VA7A 4KMDA 1L0WA 5C4JC 1TWHA 1R9TK 1XZPA 4Y7NK 2R7ZC 3LAPA 1O26A 2A68A 4O2DA 5M3FK 1TWCA 4LQYA 3H0GK 3Q3QA 5IP9K 2XCOA 4NOLA 1WSVA 4PABA 2JA6K 4BBRC 4G7OA 4X6AK 4Y52C 4A3IK 2NVTK 3N0BA 1JQWA 3MMLB 4QIWL 3HOUK 5C9HA 4C3JK 1WQHA 1PJ6A 5CHPA 2A68D 1IW7A 4KM9A 4WILA 3RZOC 1A31A 3OREA 3S17K 5TMFA 4G0WA 3S2DC 5EGHA 4BXXC 4GTEA 3GSIA 4KASA 4A3KK 1PJ7A 4KC6A 5IP7K 1MIUA 1WCMC 2VUMK 4C45A 4LOWA 5C3EK 3M4OC 1C0AA 2B9SB 3I4MC 5TJ3A 3DXJA 3TFJA 1IW7D 4LK0A 2GAHC 3LF9A 1F7VA 1Y698 1WORA 2GSNA 1ISEA 1SFOA 2Y0SA 1TWFC 3GTPK 4BY1C 3V4GA 4A3CK 2R93K 2JH3A 4BY7K 1JOEA 2NVXA 4KN7A 4WJ4A 4G7ZA 2O5IA 1I3QK 1I6HK 1WIHA 3HOWK 1IL2A 1GE9A 4ILDA 4A3LK 5E68A 1BGWA 5JSBB 4KAWX 1WQGA 2E2IA 3BP3A 2NVYC 4Q4ZA 4KN4A 4F3EA 1TWFA 1J98A 3A8JA 5C4XK 1Y1WK 2Y0SD 4L8IA 1R9TC 3IAYA 4Y7NC 1O2AA 1WOPA 2YU9K 3PO3K 1WQFA 1XXCA 3H0GC 3LPXA 4A3EK 5IP9C 3HXAA 1VGXA 4DDQA 2JA6C 4KB4A 4OYDB 1VJEA 4GTCA 3G4AA 4X6AC 4QCLA 4A3IC 3GTOA 2JA7K 2JA8C 4KARA 2BE5A 3L4KA 3S15K 2V6UA 4QIWA 5IOQA 1XZPB 3S1RK 1BS2A 3A8IA 2NVTC 3HOUC 3FHZA 4C3JC 5TMCA 4YFKA 3GTLK 4Q5GA 4YFXA 4AN8A 2WAQL 3HOYK 5CQGA 3QX3A 3S17C 4Q5VA 4G0VA 2XCQA 4AH6A 4PAAA 5JFEA 4JK1A 1RR8C 2KWAA 4A3KC 4GT9A 1WOOA 2BE5D 5IP7C 3GTQK 4QIWD 2VUMC 2A6EA 4P9SA 5C3EC 4Q5SA 4KATA 1YNNA 1KQ4A 3GTJK 1B4AA 3S1NK 3N0CA 5EGEA 3WODA 1K83K 4LJZA 1V9MA 3AD7C 4P5BA 1USOA 2A6HA 3M3YK 2CW0A 1VH2A 1XXBA 3K5OA 3FKIA 1TWGK 3GTPC 1IQ0A 4A3CC 2R93C 1EJ9A 1SEUA 4NOIA 4H3TA 2R92A 4BY7C 1SC7A 2A6ED 4GTAA 3FOEA 4GFQA 1I3QC 1I6HC 1O25A 1YNND 3T00A 3HOWC 4KMUA 3S14K 2B63K 1EQRA 3M4AA 4A3LC 3KYLA 3WVOA 4XSZA 2JA8K 1IBAA 1O2BA 4KDDA 4G0UA 1JVIA 2A6HD 4FXDA 2CW0D 1Y1WC 5C4XC 1Y1VK 2A69A 4GTBA 4FZBA 5M5XK 5FJ8K 2R7ZA 2YU9C 3PO3C 3RZDK 1I3QA 4A3EC 2V6TA 1ZXOA 3GIRA 1VLOA 1TWAK 4A3FK 3OEPA 4NOKA 4FGUA 2JA7C 3S15C 4J3NA 4O26A 1YNJA 3S1RC 3GTMK 1O29A 4OIQA 2WB1L 2A69D 2WAQA 4C2MK 3GTLC 1F9NA 3GEHA 2E2HK 3HOYC 2P5MA 3K5LA 4XLPA 2PMZA 2GSUA 4XSXA 3S0XA 3NUHA 4A3BK 4QJVA 4KMHA 1HI9A 4AYBL 3GTQC 3IPJA 4BBSK 2O5JA 1YNJD 1WCMA 1TWHK 1ZYRA 4MQ9A 2WAQD 4EJ3A 3GTJC 1G51A 3S1NC 1TWCK 5IOTA 2PMZD 1K83C 3GTGK 1YCLA 3TTGA 3M3YC 2PA8D 1TWGC 5M3MK 3GTQA 3N3YA 1WSRA 3SZYA 4C3IK 1WOSA 1K4TA 3GTKK 3S1MK 2JA5K 3DU5A 3H3VL 2ZFZA 5D4DA 3S14C 2B63C 4BLBA 5IOSA 2NVYA 1O24A 3S16K 4GZYA 3MAQA 3AH5A 2PPBA 1Y1VC 3JSTA 1J6XA 3HKZL 1R9TA 3PO2K 4IP9A 1O2FB 3RZDC 1ZVUA 2XCRB 4G7HA 3H0GA 4OIRA 1XPPA 1TWAC 2JA6A 1LPQA 4A3FC 3S2HK 3AD9C 3GEIA 1B4BA 1RRJA 5IYDK 5L46A 2WB1A 3GTMC 5JVOA 4WJ3M 4LR2A 1SFOK 5C44K 2Y3PA 4XLNA 3G4CA 4C2MC 4D3ZA 2NVXK 2E2HC 3S2DK 1IS1A 2F4QA 3K5MA 4A3JK 4XCHA 1RU0A 5IYBK 4A3BC 2E2IK 3ERED 4MEYA 4JLRC 5IYCK 4BBSC 4FM9A 3GEEA 2WB1D 2VUMA 1TWHC 4M1XA 2Y0SL 5FLMK 1O27A 2E2JK 1TWCC 4IP8A 1X31C 2CFAA 4QJVB 3GTGC 3HOZK 1AB4A 4A3GK 2GAGC 1EH1A 1TL8A 2EBBA 3GTPA 3GTOK 1NH3A 2R93A 3HOXK 3K7AK 5HL8A 4C3IC 3GTKC 3S1MC 3BP8C 2JA5C 4A3MK 1XXAA 1K4SA 3CQZK 3I4NK 1I50K 3P9AA 4RMFA 1DD5A 4LMOA 3T02A 3S16C 3GTGA 4D3YA 1T8IA 3HKZA 1Y1WA 1VRQC 1EK8A 2NVQK 4A93K 3PO2C 3GTKA 1XZQA 2PHCB 2FQOA 4YFNA 4KM8A 2JA5A 2YU9A 4A3DK 1BJTA 3S1QK 3H3VD 1BDFA 4P5AA 1J6WA 2V6SA 5JSNB 3S2HC 2ZUFA 2JA7A 1F7UA 2R4GA 1O28A 5IYDC 2ZUEA 1DCPA 1SFOC 3HKZD 5C44C 3FKIK 2D6FC 3GTLA 3SZZA 4C3HK 1V5VA 2R92K 4NOMA 2NVXC 1DCHA 3CAGA 2FQTA 4A3JC 3BUEA 4ZH4A 3HOVK 5IYBC 5CJ9A 2E2IC 4AHCA 1DCOA 5IYCC 5C4JK 4BLAA 3GDZA 2O5JD 4KB2A 4GTDA 1ZYRD 4OINA 5M5YK 3GTJA 2R7ZK 5FLMC 1I6VA 2E2JC 1ZBSA 4OIPA 3K59A 2RGRA 3K58A 1K83A 3TFIA 3HOZC 4YG2A 4A3GC 4FYDA 5MLC9 4BBRK 2RH6A 1TWGA 1USMA 3GTOC 4GTLA 4GTFA 1A36A 5IORA 4Y52K 3AQOA 1R5ZA 3HOXC 1IE0A 3K7AC 3DU6A 1TGOA 4A3MC 3EQLA 3CQZC 3I4NC 1HQMA 2CFAB 1I50C 1I6VD 3RZOK 4OIOA 2B63A 2P8TA 1EFWA 2GSOA 4BXXK
chains in the Genus database with same CATH topology
3OEPA 4NOKA 2NVXA 3AQPA 3K5NA 4FGUA 5IORA 1Q8IA 4J3NA 1O27A 1WIHA 4O26A 1Y1VA 4IP8A 1R49A 1O29A 2CFAA 3FOFA 1GE9A 4ILDA 4BKWA 2A69D 2WAQA 3CQZA 1BGWA 5JSBB 4KAWX 1WQGA 2E2IA 1AB4A 1F9NA 1I50A 1EH1A 1TL8A 1HQMD 3GTPA 2P5MA 3K5LA 4F3EA 1NH3A 1TWFA 2PMZA 2R93A 1TWAA 2GSUA 4C3IC 4L8IA 3S0XA 3IAYA 4AYBA 1XXAA 1K4SA 3NUHA 3K57A 1O2AA 3LAJA 3L4JA 1WQFA 3P9AA 3GTMA 4KMHA 1XXCA 3LPXA 1DD5A 4LMOA 1YNJD 1WCMA 4C2MA 4DDQA 4C3HC 4KB4A 4OYDB 4D3YA 3GTGA 4GTCA 3G4AA 2E2HA 1T8IA 4EJ3A 3GTOA 1SMYD 3SJRA 4QCLA 4KARA 3HKZA 3OPFA 3L4KA 4QIWA 4M1XA 5IOQA 1Y1WA 1A35A 1EK8A 5IOTA 3GTKA 2PHCB 3FHZA 4C3JC 4KM8A 2JA5A 2YU9A 4KMAA 1BJTA 4Q5GA 3LHPS 3VA7A 4P5AA 4AN8A 5CQGA 4KMDA 3QX3A 3GTQA 3N3YA 1TWHA 5JSNB 4Q5VA 4G0VA 1K4TA 2XCQA 3DU5A 2JA7A 2R4GA 1O26A 3LAPA 1O28A 5JFEA 1RR8C 2KWAA 1TWCA 2ZFZA 4LQYA 4GT9A 2BE5D 3Q3QA 2XCOA 4NOLA 4BLBA 3GTLA 5IOSA 2NVYA 1O24A 3MAQA 3AH5A 4NOMA 4KATA 1KQ4A 3CAGA 1B4AA 3N0CA 3BUEA 5EGEA 1R9TA 3N0BA 3MMLB 5C9HA 4IP9A 5CJ9A 1V9MA 1ZVUA 4P5BA 2XCRB 1WQHA 4AHCA 3H0GA 5CHPA 1XXBA 2A68D 3K5OA 3FKIA 4KM9A 1A31A 4BLAA 3OREA 1EJ9A 1SEUA 4KB2A 4H3TA 2R92A 2O5JD 2JA6A 1LPQA 4G0WA 4GTDA 1ZYRD 5EGHA 4GTEA 1SC7A 2A6ED 1B4BA 4GTAA 3FOEA 3GTJA 4GFQA 1RRJA 1O25A 4KASA 2WB1A 1YNND 1ZBSA 5JVOA 4LR2A 2RGRA 3K59A 4KC6A 2Y3PA 1MIUA 3K58A 1K83A 3G4CA 3M4AA 4C2MC 3KYLA 3WVOA 4D3ZA 2B9SB 4FYDA 5MLC9 2RH6A 1TWGA 5TJ3A 1O2BA 1IS1A 4KDDA 1A36A 4GTLA 3AQOA 4GTFA 1R5ZA 2F4QA 2A6HD 3K5MA 2CW0D 4FXDA 4G0UA 1IW7D 3DU6A 4GTBA 3LF9A 1TGOA 4FZBA 2R7ZA 2CFAB 1Y698 1I3QA 2GSNA 3ERED 1ISEA 4JLRC 2Y0SA 1SFOA 1ZXOA 1I6VD 4FM9A 3V4GA 2B63A 2VUMA 2GSOA 2JH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OEP A;  4DDQ A;  4KB4 A;  4OYD B;  2XCO A;  5JVO A;  2RGR A;  4KC6 A;  1WIH A;  2Y3P A;  4J3N A;  3OPF A;  3L4K A;  3FOF A;  1GE9 A;  3CAG A;  1B4A A;  1EK8 A;  5MLC 9;  1BGW A;  5JSB B;  4KAW X;  1WQG A;  1IS1 A;  4KDD A;  1AB4 A;  1F9N A;  2PHC B;  1EH1 A;  3BUE A;  3FHZ A;  4G0U A;  1BJT A;  3MML B;  2P5M A;  3LHP S;  3VA7 A;  3LF9 A;  5CJ9 A;  1ZVU A;  2XCR B;  3QX3 A;  1WQH A;  4L8I A;  1XXB A;  5JSN B;  1Y69 8;  4G0V A;  1XXA A;  3NUH A;  3ERE D;  3ORE A;  1ISE A;  4JLR C;  3LAJ A;  2XCQ A;  4KB2 A;  3L4J A;  1WQF A;  3V4G A;  4FM9 A;  3LAP A;  1XXC A;  3LPX A;  4G0W A;  1DD5 A;  3FOE A;  1B4B A;  2KWA A;  2ZFZ A;  4GFQ A; 
#chains in the Genus database with same CATH topology
 3ADA C;  3AQP A;  3K5N A;  1Q8I A;  1Y1V A;  2NVQ C;  4A93 C;  1R49 A;  3FOF A;  3A8K A;  1WCM K;  4BKW A;  3CQZ A;  4A3D C;  1SMY A;  3M4O K;  3S1Q C;  1I50 A;  3I4M K;  1HQM D;  4MEX A;  1INN A;  4LK1 A;  1YX2 A;  4LLG A;  5M5W K;  1TWA A;  4AYB A;  3K57 A;  2PMZ L;  1EI6 A;  1J6V A;  3LAJ A;  3L4J A;  3GTM A;  1XZQ B;  3AD8 C;  3T01 A;  3FKI C;  1TWF K;  1F93 A;  2PA8 L;  4BY1 K;  1ZQ1 C;  4C2M A;  2R92 C;  4C3H C;  2W7V A;  2E2H A;  1SMY D;  3SJR A;  1PJ5 A;  3OPF A;  3TFH A;  1A35 A;  3HOV C;  4KMA A;  1UV7 A;  2NVY K;  3LHP S;  4AYB D;  3VA7 A;  4KMD A;  1L0W A;  5C4J C;  1TWH A;  1R9T K;  1XZP A;  4Y7N K;  2R7Z C;  3LAP A;  1O26 A;  2A68 A;  4O2D A;  5M3F K;  1TWC A;  4LQY A;  3H0G K;  3Q3Q A;  5IP9 K;  2XCO A;  4NOL A;  1WSV A;  4PAB A;  2JA6 K;  4BBR C;  4G7O A;  4X6A K;  4Y52 C;  4A3I K;  2NVT K;  3N0B A;  1JQW A;  3MML B;  4QIW L;  3HOU K;  5C9H A;  4C3J K;  1WQH A;  1PJ6 A;  5CHP A;  2A68 D;  1IW7 A;  4KM9 A;  4WIL A;  3RZO C;  1A31 A;  3ORE A;  3S17 K;  5TMF A;  4G0W A;  3S2D C;  5EGH A;  4BXX C;  4GTE A;  3GSI A;  4KAS A;  4A3K K;  1PJ7 A;  4KC6 A;  5IP7 K;  1MIU A;  1WCM C;  2VUM K;  4C45 A;  4LOW A;  5C3E K;  3M4O C;  1C0A A;  2B9S B;  3I4M C;  5TJ3 A;  3DXJ A;  3TFJ A;  1IW7 D;  4LK0 A;  2GAH C;  3LF9 A;  1F7V A;  1Y69 8;  1WOR A;  2GSN A;  1ISE A;  1SFO A;  2Y0S A;  1TWF C;  3GTP K;  4BY1 C;  3V4G A;  4A3C K;  2R93 K;  2JH3 A;  4BY7 K;  1JOE A;  2NVX A;  4KN7 A;  4WJ4 A;  4G7Z A;  2O5I A;  1I3Q K;  1I6H K;  1WIH A;  3HOW K;  1IL2 A;  1GE9 A;  4ILD A;  4A3L K;  5E68 A;  1BGW A;  5JSB B;  4KAW X;  1WQG A;  2E2I A;  3BP3 A;  2NVY C;  4Q4Z A;  4KN4 A;  4F3E A;  1TWF A;  1J98 A;  3A8J A;  5C4X K;  1Y1W K;  2Y0S D;  4L8I A;  1R9T C;  3IAY A;  4Y7N C;  1O2A A;  1WOP A;  2YU9 K;  3PO3 K;  1WQF A;  1XXC A;  3H0G C;  3LPX A;  4A3E K;  5IP9 C;  3HXA A;  1VGX A;  4DDQ A;  2JA6 C;  4KB4 A;  4OYD B;  1VJE A;  4GTC A;  3G4A A;  4X6A C;  4QCL A;  4A3I C;  3GTO A;  2JA7 K;  2JA8 C;  4KAR A;  2BE5 A;  3L4K A;  3S15 K;  2V6U A;  4QIW A;  5IOQ A;  1XZP B;  3S1R K;  1BS2 A;  3A8I A;  2NVT C;  3HOU C;  3FHZ A;  4C3J C;  5TMC A;  4YFK A;  3GTL K;  4Q5G A;  4YFX A;  4AN8 A;  2WAQ L;  3HOY K;  5CQG A;  3QX3 A;  3S17 C;  4Q5V A;  4G0V A;  2XCQ A;  4AH6 A;  4PAA A;  5JFE A;  4JK1 A;  1RR8 C;  2KWA A;  4A3K C;  4GT9 A;  1WOO A;  2BE5 D;  5IP7 C;  3GTQ K;  4QIW D;  2VUM C;  2A6E A;  4P9S A;  5C3E C;  4Q5S A;  4KAT A;  1YNN A;  1KQ4 A;  3GTJ K;  1B4A A;  3S1N K;  3N0C A;  5EGE A;  3WOD A;  1K83 K;  4LJZ A;  1V9M A;  3AD7 C;  4P5B A;  1USO A;  2A6H A;  3M3Y K;  2CW0 A;  1VH2 A;  1XXB A;  3K5O A;  3FKI A;  1TWG K;  3GTP C;  1IQ0 A;  4A3C C;  2R93 C;  1EJ9 A;  1SEU A;  4NOI A;  4H3T A;  2R92 A;  4BY7 C;  1SC7 A;  2A6E D;  4GTA A;  3FOE A;  4GFQ A;  1I3Q C;  1I6H C;  1O25 A;  1YNN D;  3T00 A;  3HOW C;  4KMU A;  3S14 K;  2B63 K;  1EQR A;  3M4A A;  4A3L C;  3KYL A;  3WVO A;  4XSZ A;  2JA8 K;  1IBA A;  1O2B A;  4KDD A;  4G0U A;  1JVI A;  2A6H D;  4FXD A;  2CW0 D;  1Y1W C;  5C4X C;  1Y1V K;  2A69 A;  4GTB A;  4FZB A;  5M5X K;  5FJ8 K;  2R7Z A;  2YU9 C;  3PO3 C;  3RZD K;  1I3Q A;  4A3E C;  2V6T A;  1ZXO A;  3GIR A;  1VLO A;  1TWA K;  4A3F K;  3OEP A;  4NOK A;  4FGU A;  2JA7 C;  3S15 C;  4J3N A;  4O26 A;  1YNJ A;  3S1R C;  3GTM K;  1O29 A;  4OIQ A;  2WB1 L;  2A69 D;  2WAQ A;  4C2M K;  3GTL C;  1F9N A;  3GEH A;  2E2H K;  3HOY C;  2P5M A;  3K5L A;  4XLP A;  2PMZ A;  2GSU A;  4XSX A;  3S0X A;  3NUH A;  4A3B K;  4QJV A;  4KMH A;  1HI9 A;  4AYB L;  3GTQ C;  3IPJ A;  4BBS K;  2O5J A;  1YNJ D;  1WCM A;  1TWH K;  1ZYR A;  4MQ9 A;  2WAQ D;  4EJ3 A;  3GTJ C;  1G51 A;  3S1N C;  1TWC K;  5IOT A;  2PMZ D;  1K83 C;  3GTG K;  1YCL A;  3TTG A;  3M3Y C;  2PA8 D;  1TWG C;  5M3M K;  3GTQ A;  3N3Y A;  1WSR A;  3SZY A;  4C3I K;  1WOS A;  1K4T A;  3GTK K;  3S1M K;  2JA5 K;  3DU5 A;  3H3V L;  2ZFZ A;  5D4D A;  3S14 C;  2B63 C;  4BLB A;  5IOS A;  2NVY A;  1O24 A;  3S16 K;  4GZY A;  3MAQ A;  3AH5 A;  2PPB A;  1Y1V C;  3JST A;  1J6X A;  3HKZ L;  1R9T A;  3PO2 K;  4IP9 A;  1O2F B;  3RZD C;  1ZVU A;  2XCR B;  4G7H A;  3H0G A;  4OIR A;  1XPP A;  1TWA C;  2JA6 A;  1LPQ A;  4A3F C;  3S2H K;  3AD9 C;  3GEI A;  1B4B A;  1RRJ A;  5IYD K;  5L46 A;  2WB1 A;  3GTM C;  5JVO A;  4WJ3 M;  4LR2 A;  1SFO K;  5C44 K;  2Y3P A;  4XLN A;  3G4C A;  4C2M C;  4D3Z A;  2NVX K;  2E2H C;  3S2D K;  1IS1 A;  2F4Q A;  3K5M A;  4A3J K;  4XCH A;  1RU0 A;  5IYB K;  4A3B C;  2E2I K;  3ERE D;  4MEY A;  4JLR C;  5IYC K;  4BBS C;  4FM9 A;  3GEE A;  2WB1 D;  2VUM A;  1TWH C;  4M1X A;  2Y0S L;  5FLM K;  1O27 A;  2E2J K;  1TWC C;  4IP8 A;  1X31 C;  2CFA A;  4QJV B;  3GTG C;  3HOZ K;  1AB4 A;  4A3G K;  2GAG C;  1EH1 A;  1TL8 A;  2EBB A;  3GTP A;  3GTO K;  1NH3 A;  2R93 A;  3HOX K;  3K7A K;  5HL8 A;  4C3I C;  3GTK C;  3S1M C;  3BP8 C;  2JA5 C;  4A3M K;  1XXA A;  1K4S A;  3CQZ K;  3I4N K;  1I50 K;  3P9A A;  4RMF A;  1DD5 A;  4LMO A;  3T02 A;  3S16 C;  3GTG A;  4D3Y A;  1T8I A;  3HKZ A;  1Y1W A;  1VRQ C;  1EK8 A;  2NVQ K;  4A93 K;  3PO2 C;  3GTK A;  1XZQ A;  2PHC B;  2FQO A;  4YFN A;  4KM8 A;  2JA5 A;  2YU9 A;  4A3D K;  1BJT A;  3S1Q K;  3H3V D;  1BDF A;  4P5A A;  1J6W A;  2V6S A;  5JSN B;  3S2H C;  2ZUF A;  2JA7 A;  1F7U A;  2R4G A;  1O28 A;  5IYD C;  2ZUE A;  1DCP A;  1SFO C;  3HKZ D;  5C44 C;  3FKI K;  2D6F C;  3GTL A;  3SZZ A;  4C3H K;  1V5V A;  2R92 K;  4NOM A;  2NVX C;  1DCH A;  3CAG A;  2FQT A;  4A3J C;  3BUE A;  4ZH4 A;  3HOV K;  5IYB C;  5CJ9 A;  2E2I C;  4AHC A;  1DCO A;  5IYC C;  5C4J K;  4BLA A;  3GDZ A;  2O5J D;  4KB2 A;  4GTD A;  1ZYR D;  4OIN A;  5M5Y K;  3GTJ A;  2R7Z K;  5FLM C;  1I6V A;  2E2J C;  1ZBS A;  4OIP A;  3K59 A;  2RGR A;  3K58 A;  1K83 A;  3TFI A;  3HOZ C;  4YG2 A;  4A3G C;  4FYD A;  5MLC 9;  4BBR K;  2RH6 A;  1TWG A;  1USM A;  3GTO C;  4GTL A;  4GTF A;  1A36 A;  5IOR A;  4Y52 K;  3AQO A;  1R5Z A;  3HOX C;  1IE0 A;  3K7A C;  3DU6 A;  1TGO A;  4A3M C;  3EQL A;  3CQZ C;  3I4N C;  1HQM A;  2CFA B;  1I50 C;  1I6V D;  3RZO K;  4OIO A;  2B63 A;  2P8T A;  1EFW A;  2GSO A;  4BXX K; 
#chains in the Genus database with same CATH homology
 3OEP A;  4NOK A;  2NVX A;  3AQP A;  3K5N A;  4FGU A;  5IOR A;  1Q8I A;  4J3N A;  1O27 A;  1WIH A;  4O26 A;  1Y1V A;  4IP8 A;  1R49 A;  1O29 A;  2CFA A;  3FOF A;  1GE9 A;  4ILD A;  4BKW A;  2A69 D;  2WAQ A;  3CQZ A;  1BGW A;  5JSB B;  4KAW X;  1WQG A;  2E2I A;  1AB4 A;  1F9N A;  1I50 A;  1EH1 A;  1TL8 A;  1HQM D;  3GTP A;  2P5M A;  3K5L A;  4F3E A;  1NH3 A;  1TWF A;  2PMZ A;  2R93 A;  1TWA A;  2GSU A;  4C3I C;  4L8I A;  3S0X A;  3IAY A;  4AYB A;  1XXA A;  1K4S A;  3NUH A;  3K57 A;  1O2A A;  3LAJ A;  3L4J A;  1WQF A;  3P9A A;  3GTM A;  4KMH A;  1XXC A;  3LPX A;  1DD5 A;  4LMO A;  1YNJ D;  1WCM A;  4C2M A;  4DDQ A;  4C3H C;  4KB4 A;  4OYD B;  4D3Y A;  3GTG A;  4GTC A;  3G4A A;  2E2H A;  1T8I A;  4EJ3 A;  3GTO A;  1SMY D;  3SJR A;  4QCL A;  4KAR A;  3HKZ A;  3OPF A;  3L4K A;  4QIW A;  4M1X A;  5IOQ A;  1Y1W A;  1A35 A;  1EK8 A;  5IOT A;  3GTK A;  2PHC B;  3FHZ A;  4C3J C;  4KM8 A;  2JA5 A;  2YU9 A;  4KMA A;  1BJT A;  4Q5G A;  3LHP S;  3VA7 A;  4P5A A;  4AN8 A;  5CQG A;  4KMD A;  3QX3 A;  3GTQ A;  3N3Y A;  1TWH A;  5JSN B;  4Q5V A;  4G0V A;  1K4T A;  2XCQ A;  3DU5 A;  2JA7 A;  2R4G A;  1O26 A;  3LAP A;  1O28 A;  5JFE A;  1RR8 C;  2KWA A;  1TWC A;  2ZFZ A;  4LQY A;  4GT9 A;  2BE5 D;  3Q3Q A;  2XCO A;  4NOL A;  4BLB A;  3GTL A;  5IOS A;  2NVY A;  1O24 A;  3MAQ A;  3AH5 A;  4NOM A;  4KAT A;  1KQ4 A;  3CAG A;  1B4A A;  3N0C A;  3BUE A;  5EGE A;  1R9T A;  3N0B A;  3MML B;  5C9H A;  4IP9 A;  5CJ9 A;  1V9M A;  1ZVU A;  4P5B A;  2XCR B;  1WQH A;  4AHC A;  3H0G A;  5CHP A;  1XXB A;  2A68 D;  3K5O A;  3FKI A;  4KM9 A;  1A31 A;  4BLA A;  3ORE A;  1EJ9 A;  1SEU A;  4KB2 A;  4H3T A;  2R92 A;  2O5J D;  2JA6 A;  1LPQ A;  4G0W A;  4GTD A;  1ZYR D;  5EGH A;  4GTE A;  1SC7 A;  2A6E D;  1B4B A;  4GTA A;  3FOE A;  3GTJ A;  4GFQ A;  1RRJ A;  1O25 A;  4KAS A;  2WB1 A;  1YNN D;  1ZBS A;  5JVO A;  4LR2 A;  2RGR A;  3K59 A;  4KC6 A;  2Y3P A;  1MIU A;  3K58 A;  1K83 A;  3G4C A;  3M4A A;  4C2M C;  3KYL A;  3WVO A;  4D3Z A;  2B9S B;  4FYD A;  5MLC 9;  2RH6 A;  1TWG A;  5TJ3 A;  1O2B A;  1IS1 A;  4KDD A;  1A36 A;  4GTL A;  3AQO A;  4GTF A;  1R5Z A;  2F4Q A;  2A6H D;  3K5M A;  2CW0 D;  4FXD A;  4G0U A;  1IW7 D;  3DU6 A;  4GTB A;  3LF9 A;  1TGO A;  4FZB A;  2R7Z A;  2CFA B;  1Y69 8;  1I3Q A;  2GSN A;  3ERE D;  1ISE A;  4JLR C;  2Y0S A;  1SFO A;  1ZXO A;  1I6V D;  4FM9 A;  3V4G A;  2B63 A;  2VUM A;  2GSO A;  2JH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...