4KB2A

Crystal structure of ribosome recycling factor mutant r109a from mycobacterium tuberculosis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
184
structure length
184
Chain Sequence
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEEARRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 64
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kb2A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kb2A02
1ISEA 4GFQA 3BUEA 5JVOA 1BGWA 1EK8A 1DD5A 3LF9A 4OYDB 1WQGA 3LHPS 1IS1A 2RGRA 4G0VA 2XCOA 5JSBB 3L4KA 1XXAA 4KB4A 4FM9A 3FOEA 5CJ9A 2XCQA 4KB2A 2Y3PA 3OEPA 1F9NA 1XXCA 3CAGA 4DDQA 1B4BA 3MMLB 1WIHA 3V4GA 2P5MA 3OPFA 2ZFZA 3FHZA 2PHCB 3VA7A 4KAWX 4J3NA 3LAJA 3QX3A 1AB4A 3LPXA 3OREA 4KC6A 3LAPA 1WQHA 3FOFA 1GE9A 3L4JA 3NUHA 4G0WA 1B4AA 1ZVUA 1EH1A 1WQFA 4JLRC 4L8IA 1Y698 2KWAA 2XCRB 5MLC9 3ERED 1BJTA 1XXBA 4G0UA 4KDDA 5JSNB
chains in the Genus database with same CATH superfamily
4GFQA 1I50C 2CFAB 2CW0A 4O2DA 2E2JK 1XZPA 2JA7A 4RMFA 5C44C 1J98A 4G0VA 5CHPA 1WCMC 1V5VA 4C3IC 2A6ED 4QJVA 5D4DA 3V4GA 1KQ4A 3GTQC 3OREA 3GTQA 4L8IA 3GTPK 1A36A 1TWAC 2PMZL 4C2MA 4KDDA 2NVQC 4BY7K 3GTGA 5JVOA 4QCLA 3GTKC 4P5AA 3ADAC 3FKIC 4LQYA 2R93K 1G51A 1TWAK 1O27A 1XXAA 4XSZA 1VRQC 3OEPA 4XLPA 1RR8C 2NVXA 1SFOC 4A3CK 3S2DK 2E2HK 4AHCA 3GTLC 2FQOA 4D3YA 3GTMC 1WQFA 5IOSA 4JK1A 4C3HC 1I50K 5IYBK 1SFOK 1Q8IA 3S2DC 4A3CC 2R4GA 1WOOA 4A3GC 3IPJA 4XCHA 3FKIK 4Q5VA 3HOXK 1TWFC 2R93C 4LMOA 3S15C 1BS2A 3GTLA 1B4BA 1V9MA 5C3EK 2P5MA 5IOTA 1T8IA 3K7AC 3TFHA 3WODA 3S1QC 1EFWA 4KMAA 2A69D 2R7ZA 5MLC9 4KMUA 4A3FC 3TFJA 4KASA 1Y1WA 4BLAA 1VH2A 1YX2A 5C4JK 2WAQA 4C2MC 3HKZL 2R7ZK 1WSVA 3K58A 3FOEA 3HOXC 2Y3PA 1XXCA 3S15K 2V6TA 5C4XK 2JA5C 1R5ZA 1YCLA 2ZFZA 2BE5D 3SJRA 4A93C 4AYBL 1C0AA 5M5YK 4C3HK 4GTCA 1XXBA 5IYCK 1I6VD 1WSRA 4AN8A 1WORA 5C44K 1YNJD 1TWHC 4A93K 5M5XK 4P9SA 1R9TC 2VUMA 2WAQL 3I4MC 4OIOA 1XZPB 1Y1WC 4KB2A 3M4OC 2JA6K 2E2IK 1INNA 1XZQB 1K83K 2Y0SL 3SZZA 4OIQA 2JA8K 4QIWA 1HQMA 4GTBA 4Y7NC 1WQHA 3S17C 4IP9A 2B9SB 2NVQK 1JOEA 3AD9C 4BY7C 4G7HA 3H3VL 4KN7A 3H0GA 2W7VA 1K83A 1UV7A 3CQZC 4Y7NK 1JQWA 4D3ZA 3GEIA 1A31A 4LK1A 4KB4A 5IYBC 1Y1WK 3HOVC 1HI9A 4LR2A 4A3GK 3FHZA 2BE5A 4KAWX 4AYBD 3FOFA 4NOLA 3L4JA 4G0WA 2GSNA 4FYDA 4EJ3A 2B63C 3M3YC 2EBBA 3N3YA 3HOYK 5IP9C 1RRJA 4OIRA 3S1NK 2F4QA 3LF9A 3HKZD 5IYDK 3GTJA 5EGHA 5TJ3A 2NVTC 1ZYRA 3FKIA 2NVYC 2R92C 5JSBB 1PJ7A 2CFAA 2E2HA 2A68A 3PO3K 3K5LA 3K5MA 1O25A 3HOUC 3HOVK 3S2HC 3S17K 1USOA 4LOWA 4NOMA 3DU6A 4G0UA 1I3QC 1ZYRD 4BY1K 1TWCA 1DCPA 1O24A 3GTGK 4BXXC 3S2HK 2GAGC 4Q5GA 2CW0D 1YNJA 5TMCA 3RZDC 1O2AA 3JSTA 4A3IK 1IS1A 3G4CA 4LJZA 1I6VA 4C3IK 3T00A 2O5JA 4KATA 4WJ3M 1TWHA 2NVTK 3L4KA 2NVYK 4Q4ZA 4GZYA 3T02A 1J6WA 4OINA 3WVOA 4MEYA 3S1MC 3HOUK 1TWFK 2R92A 5IORA 3I4MK 4QIWL 4GTEA 2A6HD 2B63K 2KWAA 3HOWC 4FXDA 2PHCB 5JSNB 3S1MK 1ISEA 1R9TK 4BBRC 2WB1A 5IYDC 2GSUA 1ZXOA 2B63A 4F3EA 1TWGA 4YG2A 3TFIA 2ZUFA 3SZYA 1SFOA 2XCQA 3GEHA 3T01A 1IW7A 3P9AA 4FGUA 2V6SA 3CQZK 1F93A 4C2MK 1O28A 3OPFA 2R7ZC 3MAQA 1I6HC 3GTKK 4G7OA 1Y698 1I3QK 1Y1VK 4NOIA 3CQZA 3KYLA 4BKWA 2O5JD 3BUEA 4X6AK 3H0GC 3GIRA 1I6HK 2YU9C 3GTPC 3LHPS 1TWCC 1I3QA 5IYCC 3BP8C 4A3LK 1K4SA 4YFKA 3M3YK 2PA8D 3K57A 2A69A 3K7AK 4KMHA 3S1QK 3VA7A 3HOZC 3RZOK 2A68D 2R92K 1B4AA 2A6EA 3HOWK 3HOYC 4XLNA 4BBSC 1LPQA 1VJEA 4A3BC 1TGOA 2PA8L 3K5OA 4KM9A 1MIUA 1BGWA 4GTAA 3GTLK 3RZOC 4PABA 4C3JK 1O2BA 4OYDB 2RGRA 3EQLA 2D6FC 4WJ4A 1SMYA 4FZBA 4A3BK 2JA5K 3GTKA 4A3LC 1XZQA 3GTGC 5CJ9A 1Y1VA 1F9NA 5CQGA 3S1RK 3LAJA 2GAHC 4PAAA 4YFNA 4OIPA 2WB1L 1YNND 1Y1VC 3H3VD 4BXXK 1K4TA 2JA6A 4KARA 4MEXA 1F7VA 5EGEA 1IL2A 4A3MC 4M1XA 2YU9A 3AH5A 4A3IC 4A3KK 4ZH4A 4KM8A 1DD5A 4LK0A 2Y0SD 3A8JA 1WQGA 3HXAA 4GT9A 1USMA 2XCOA 2E2IC 4G7ZA 2JH3A 1EQRA 3K59A 4GTFA 2PMZA 1HQMD 4QIWD 1X31C 4GTLA 3HOZK 1NH3A 2R93A 4J3NA 1TWFA 3S1RC 3G4AA 4KC6A 4BBSK 4C45A 5C9HA 4A3DC 1IBAA 1TWGC 1SMYD 1R9TA 1ZQ1C 3GDZA 3DXJA 3GTPA 4Q5SA 5IP7C 2E2IA 3PO2C 4YFXA 1PJ5A 2WB1D 4A3DK 2NVXK 1TWGK 5C4JC 1PJ6A 1R49A 1O29A 1YNNA 3I4NK 3RZDK 3H0GK 4IP8A 2YU9K 4A3JK 4P5BA 1TWCK 2VUMK 2JA5A 3GEEA 1IW7D 4KMDA 3NUHA 3A8KA 3M4OK 1ZVUA 1EH1A 4BLBA 5IOQA 2V6UA 4A3MK 1F7UA 3S14K 2JA8C 4A3KC 4A3JC 2VUMC 4WILA 3AQOA 5TMFA 5M3FK 3K5NA 1L0WA 3N0CA 4A3EC 5C3EC 1A35A 5FLMC 1TWHK 3S14C 3IAYA 4BBRK 4FM9A 4KN4A 5M5WK 1J6VA 1O26A 3CAGA 3MMLB 3S0XA 1WIHA 2PPBA 3I4NC 4AYBA 1SEUA 3M4AA 3QX3A 3N0BA 1WCMA 3LPXA 1DCOA 4LLGA 5IP9K 3LAPA 1GE9A 2RH6A 3S1NC 2E2HC 3DU5A 2JA7C 1SC7A 1XPPA 3Q3QA 1I50A 4QJVB 4ILDA 3AD7C 4GTDA 2Y0SA 3HKZA 5L46A 1IQ0A 5C4XC 2GSOA 4A3EK 4Y52C 3GSIA 5E68A 5FLMK 3S16C 4X6AC 1VLOA 2A6HA 1WOSA 5JFEA 2FQTA 5FJ8K 1IE0A 1WOPA 3GTJK 4BY1C 3GTOC 3GTQK 5M3MK 2PMZD 4AH6A 1VGXA 3ERED 3PO3C 4O26A 4MQ9A 4XSXA 2NVYA 2WAQD 3AD8C 4NOKA 3GTJC 3GTOK 2E2JC 1EK8A 4A3FK 1J6XA 2JA6C 1K83C 3A8IA 1EI6A 1WCMK 5HL8A 1TWAA 1ZBSA 2P8TA 4Y52K 1JVIA 3BP3A 3GTOA 4DDQA 3S16K 3GTMA 1O2FB 4C3JC 1EJ9A 1RU0A 2ZUEA 5IP7K 3PO2K 1DCHA 1BDFA 1AB4A 2NVXC 2JA7K 4JLRC 3AQPA 2XCRB 2O5IA 3TTGA 3GTMK 1BJTA 4H3TA 1TL8A
chains in the Genus database with same CATH topology
4AN8A 1ISEA 4GFQA 2WB1A 3GTPA 1YNJD 2E2IA 2CFAB 1ZXOA 2GSUA 2B63A 2JA7A 2VUMA 4G0VA 4F3EA 5CHPA 1TWGA 1R49A 1SFOA 4KB2A 2A6ED 1O29A 2XCQA 4C3IC 3P9AA 4FGUA 3V4GA 1KQ4A 4IP8A 1O28A 3OPFA 2PHCB 4P5BA 4QIWA 3MAQA 3GTQA 2JA5A 3OREA 4GTBA 1IW7D 1WQHA 4KMDA 3NUHA 4IP9A 1ZVUA 2B9SB 1EH1A 4L8IA 1Y698 4BLBA 5IOQA 1A36A 3CQZA 3H0GA 3KYLA 4C2MA 4KDDA 1K83A 2O5JD 4BKWA 3GTGA 3BUEA 5JVOA 4QCLA 4P5AA 3AQOA 3K5NA 3N0CA 4D3ZA 3LHPS 1A35A 4LQYA 1I3QA 1A31A 1K4SA 3IAYA 1O27A 3K57A 4KB4A 1XXAA 4FM9A 3OEPA 1O26A 1RR8C 3CAGA 4KMHA 3MMLB 3S0XA 1WIHA 2NVXA 4LR2A 4AYBA 3FHZA 1SEUA 3M4AA 3VA7A 4KAWX 3QX3A 3N0BA 1WCMA 3LPXA 2A68D 4AHCA 3LAPA 3FOFA 4NOLA 1GE9A 3L4JA 4D3YA 2RH6A 1B4AA 4G0WA 2GSNA 1WQFA 5IOSA 3DU5A 4FYDA 4EJ3A 1SC7A 1LPQA 3Q3QA 1TGOA 1I50A 4C3HC 3N3YA 3K5OA 1RRJA 1Q8IA 4KM9A 4ILDA 2R4GA 1MIUA 1BGWA 4GTDA 2Y0SA 3HKZA 4GTAA 2F4QA 3LF9A 1O2BA 4OYDB 2GSOA 3GTJA 2RGRA 5EGHA 5TJ3A 3FKIA 4Q5VA 4FZBA 3GTKA 5JSBB 1TL8A 4LMOA 2CFAA 2E2HA 5CJ9A 1Y1VA 3GTLA 1F9NA 1B4BA 1V9MA 5JFEA 5CQGA 3K5LA 3K5MA 1O25A 2P5MA 1T8IA 5IOTA 3LAJA 4NOMA 4KMAA 1YNND 3ERED 2A69D 2R7ZA 5MLC9 1K4TA 4O26A 2JA6A 4KARA 3DU6A 5EGEA 4G0UA 2NVYA 1ZYRD 1TWCA 4M1XA 1O24A 2YU9A 3AH5A 4NOKA 1EK8A 4Q5GA 1Y1WA 2CW0D 1DD5A 4KASA 4KM8A 4BLAA 1O2AA 1WQGA 1IS1A 2WAQA 3G4CA 4C2MC 1TWAA 1ZBSA 4GT9A 4KATA 1TWHA 2XCOA 3L4KA 3K58A 2JH3A 3GTOA 3K59A 3FOEA 4DDQA 2Y3PA 4GTFA 3GTMA 1XXCA 4C3JC 2PMZA 1I6VD 1EJ9A 1R5ZA 1HQMD 4GTLA 3WVOA 2ZFZA 2BE5D 3SJRA 1NH3A 1TWFA 2R93A 3G4AA 1AB4A 4J3NA 2R92A 5IORA 4KC6A 4GTEA 2A6HD 5C9HA 4JLRC 2KWAA 3AQPA 2XCRB 4FXDA 1BJTA 4GTCA 1XXBA 1SMYD 4H3TA 5JSNB 1R9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISE A;  4GFQ A;  3BUE A;  5JVO A;  1BGW A;  1EK8 A;  1DD5 A;  3LF9 A;  4OYD B;  1WQG A;  3LHP S;  1IS1 A;  2RGR A;  4G0V A;  2XCO A;  5JSB B;  3L4K A;  1XXA A;  4KB4 A;  4FM9 A;  3FOE A;  5CJ9 A;  2XCQ A;  4KB2 A;  2Y3P A;  3OEP A;  1F9N A;  1XXC A;  3CAG A;  4DDQ A;  1B4B A;  3MML B;  1WIH A;  3V4G A;  2P5M A;  3OPF A;  2ZFZ A;  3FHZ A;  2PHC B;  3VA7 A;  4KAW X;  4J3N A;  3LAJ A;  3QX3 A;  1AB4 A;  3LPX A;  3ORE A;  4KC6 A;  3LAP A;  1WQH A;  3FOF A;  1GE9 A;  3L4J A;  3NUH A;  4G0W A;  1B4A A;  1ZVU A;  1EH1 A;  1WQF A;  4JLR C;  4L8I A;  1Y69 8;  2KWA A;  2XCR B;  5MLC 9;  3ERE D;  1BJT A;  1XXB A;  4G0U A;  4KDD A;  5JSN B; 
#chains in the Genus database with same CATH topology
 4GFQ A;  1I50 C;  2CFA B;  2CW0 A;  4O2D A;  2E2J K;  1XZP A;  2JA7 A;  4RMF A;  5C44 C;  1J98 A;  4G0V A;  5CHP A;  1WCM C;  1V5V A;  4C3I C;  2A6E D;  4QJV A;  5D4D A;  3V4G A;  1KQ4 A;  3GTQ C;  3ORE A;  3GTQ A;  4L8I A;  3GTP K;  1A36 A;  1TWA C;  2PMZ L;  4C2M A;  4KDD A;  2NVQ C;  4BY7 K;  3GTG A;  5JVO A;  4QCL A;  3GTK C;  4P5A A;  3ADA C;  3FKI C;  4LQY A;  2R93 K;  1G51 A;  1TWA K;  1O27 A;  1XXA A;  4XSZ A;  1VRQ C;  3OEP A;  4XLP A;  1RR8 C;  2NVX A;  1SFO C;  4A3C K;  3S2D K;  2E2H K;  4AHC A;  3GTL C;  2FQO A;  4D3Y A;  3GTM C;  1WQF A;  5IOS A;  4JK1 A;  4C3H C;  1I50 K;  5IYB K;  1SFO K;  1Q8I A;  3S2D C;  4A3C C;  2R4G A;  1WOO A;  4A3G C;  3IPJ A;  4XCH A;  3FKI K;  4Q5V A;  3HOX K;  1TWF C;  2R93 C;  4LMO A;  3S15 C;  1BS2 A;  3GTL A;  1B4B A;  1V9M A;  5C3E K;  2P5M A;  5IOT A;  1T8I A;  3K7A C;  3TFH A;  3WOD A;  3S1Q C;  1EFW A;  4KMA A;  2A69 D;  2R7Z A;  5MLC 9;  4KMU A;  4A3F C;  3TFJ A;  4KAS A;  1Y1W A;  4BLA A;  1VH2 A;  1YX2 A;  5C4J K;  2WAQ A;  4C2M C;  3HKZ L;  2R7Z K;  1WSV A;  3K58 A;  3FOE A;  3HOX C;  2Y3P A;  1XXC A;  3S15 K;  2V6T A;  5C4X K;  2JA5 C;  1R5Z A;  1YCL A;  2ZFZ A;  2BE5 D;  3SJR A;  4A93 C;  4AYB L;  1C0A A;  5M5Y K;  4C3H K;  4GTC A;  1XXB A;  5IYC K;  1I6V D;  1WSR A;  4AN8 A;  1WOR A;  5C44 K;  1YNJ D;  1TWH C;  4A93 K;  5M5X K;  4P9S A;  1R9T C;  2VUM A;  2WAQ L;  3I4M C;  4OIO A;  1XZP B;  1Y1W C;  4KB2 A;  3M4O C;  2JA6 K;  2E2I K;  1INN A;  1XZQ B;  1K83 K;  2Y0S L;  3SZZ A;  4OIQ A;  2JA8 K;  4QIW A;  1HQM A;  4GTB A;  4Y7N C;  1WQH A;  3S17 C;  4IP9 A;  2B9S B;  2NVQ K;  1JOE A;  3AD9 C;  4BY7 C;  4G7H A;  3H3V L;  4KN7 A;  3H0G A;  2W7V A;  1K83 A;  1UV7 A;  3CQZ C;  4Y7N K;  1JQW A;  4D3Z A;  3GEI A;  1A31 A;  4LK1 A;  4KB4 A;  5IYB C;  1Y1W K;  3HOV C;  1HI9 A;  4LR2 A;  4A3G K;  3FHZ A;  2BE5 A;  4KAW X;  4AYB D;  3FOF A;  4NOL A;  3L4J A;  4G0W A;  2GSN A;  4FYD A;  4EJ3 A;  2B63 C;  3M3Y C;  2EBB A;  3N3Y A;  3HOY K;  5IP9 C;  1RRJ A;  4OIR A;  3S1N K;  2F4Q A;  3LF9 A;  3HKZ D;  5IYD K;  3GTJ A;  5EGH A;  5TJ3 A;  2NVT C;  1ZYR A;  3FKI A;  2NVY C;  2R92 C;  5JSB B;  1PJ7 A;  2CFA A;  2E2H A;  2A68 A;  3PO3 K;  3K5L A;  3K5M A;  1O25 A;  3HOU C;  3HOV K;  3S2H C;  3S17 K;  1USO A;  4LOW A;  4NOM A;  3DU6 A;  4G0U A;  1I3Q C;  1ZYR D;  4BY1 K;  1TWC A;  1DCP A;  1O24 A;  3GTG K;  4BXX C;  3S2H K;  2GAG C;  4Q5G A;  2CW0 D;  1YNJ A;  5TMC A;  3RZD C;  1O2A A;  3JST A;  4A3I K;  1IS1 A;  3G4C A;  4LJZ A;  1I6V A;  4C3I K;  3T00 A;  2O5J A;  4KAT A;  4WJ3 M;  1TWH A;  2NVT K;  3L4K A;  2NVY K;  4Q4Z A;  4GZY A;  3T02 A;  1J6W A;  4OIN A;  3WVO A;  4MEY A;  3S1M C;  3HOU K;  1TWF K;  2R92 A;  5IOR A;  3I4M K;  4QIW L;  4GTE A;  2A6H D;  2B63 K;  2KWA A;  3HOW C;  4FXD A;  2PHC B;  5JSN B;  3S1M K;  1ISE A;  1R9T K;  4BBR C;  2WB1 A;  5IYD C;  2GSU A;  1ZXO A;  2B63 A;  4F3E A;  1TWG A;  4YG2 A;  3TFI A;  2ZUF A;  3SZY A;  1SFO A;  2XCQ A;  3GEH A;  3T01 A;  1IW7 A;  3P9A A;  4FGU A;  2V6S A;  3CQZ K;  1F93 A;  4C2M K;  1O28 A;  3OPF A;  2R7Z C;  3MAQ A;  1I6H C;  3GTK K;  4G7O A;  1Y69 8;  1I3Q K;  1Y1V K;  4NOI A;  3CQZ A;  3KYL A;  4BKW A;  2O5J D;  3BUE A;  4X6A K;  3H0G C;  3GIR A;  1I6H K;  2YU9 C;  3GTP C;  3LHP S;  1TWC C;  1I3Q A;  5IYC C;  3BP8 C;  4A3L K;  1K4S A;  4YFK A;  3M3Y K;  2PA8 D;  3K57 A;  2A69 A;  3K7A K;  4KMH A;  3S1Q K;  3VA7 A;  3HOZ C;  3RZO K;  2A68 D;  2R92 K;  1B4A A;  2A6E A;  3HOW K;  3HOY C;  4XLN A;  4BBS C;  1LPQ A;  1VJE A;  4A3B C;  1TGO A;  2PA8 L;  3K5O A;  4KM9 A;  1MIU A;  1BGW A;  4GTA A;  3GTL K;  3RZO C;  4PAB A;  4C3J K;  1O2B A;  4OYD B;  2RGR A;  3EQL A;  2D6F C;  4WJ4 A;  1SMY A;  4FZB A;  4A3B K;  2JA5 K;  3GTK A;  4A3L C;  1XZQ A;  3GTG C;  5CJ9 A;  1Y1V A;  1F9N A;  5CQG A;  3S1R K;  3LAJ A;  2GAH C;  4PAA A;  4YFN A;  4OIP A;  2WB1 L;  1YNN D;  1Y1V C;  3H3V D;  4BXX K;  1K4T A;  2JA6 A;  4KAR A;  4MEX A;  1F7V A;  5EGE A;  1IL2 A;  4A3M C;  4M1X A;  2YU9 A;  3AH5 A;  4A3I C;  4A3K K;  4ZH4 A;  4KM8 A;  1DD5 A;  4LK0 A;  2Y0S D;  3A8J A;  1WQG A;  3HXA A;  4GT9 A;  1USM A;  2XCO A;  2E2I C;  4G7Z A;  2JH3 A;  1EQR A;  3K59 A;  4GTF A;  2PMZ A;  1HQM D;  4QIW D;  1X31 C;  4GTL A;  3HOZ K;  1NH3 A;  2R93 A;  4J3N A;  1TWF A;  3S1R C;  3G4A A;  4KC6 A;  4BBS K;  4C45 A;  5C9H A;  4A3D C;  1IBA A;  1TWG C;  1SMY D;  1R9T A;  1ZQ1 C;  3GDZ A;  3DXJ A;  3GTP A;  4Q5S A;  5IP7 C;  2E2I A;  3PO2 C;  4YFX A;  1PJ5 A;  2WB1 D;  4A3D K;  2NVX K;  1TWG K;  5C4J C;  1PJ6 A;  1R49 A;  1O29 A;  1YNN A;  3I4N K;  3RZD K;  3H0G K;  4IP8 A;  2YU9 K;  4A3J K;  4P5B A;  1TWC K;  2VUM K;  2JA5 A;  3GEE A;  1IW7 D;  4KMD A;  3NUH A;  3A8K A;  3M4O K;  1ZVU A;  1EH1 A;  4BLB A;  5IOQ A;  2V6U A;  4A3M K;  1F7U A;  3S14 K;  2JA8 C;  4A3K C;  4A3J C;  2VUM C;  4WIL A;  3AQO A;  5TMF A;  5M3F K;  3K5N A;  1L0W A;  3N0C A;  4A3E C;  5C3E C;  1A35 A;  5FLM C;  1TWH K;  3S14 C;  3IAY A;  4BBR K;  4FM9 A;  4KN4 A;  5M5W K;  1J6V A;  1O26 A;  3CAG A;  3MML B;  3S0X A;  1WIH A;  2PPB A;  3I4N C;  4AYB A;  1SEU A;  3M4A A;  3QX3 A;  3N0B A;  1WCM A;  3LPX A;  1DCO A;  4LLG A;  5IP9 K;  3LAP A;  1GE9 A;  2RH6 A;  3S1N C;  2E2H C;  3DU5 A;  2JA7 C;  1SC7 A;  1XPP A;  3Q3Q A;  1I50 A;  4QJV B;  4ILD A;  3AD7 C;  4GTD A;  2Y0S A;  3HKZ A;  5L46 A;  1IQ0 A;  5C4X C;  2GSO A;  4A3E K;  4Y52 C;  3GSI A;  5E68 A;  5FLM K;  3S16 C;  4X6A C;  1VLO A;  2A6H A;  1WOS A;  5JFE A;  2FQT A;  5FJ8 K;  1IE0 A;  1WOP A;  3GTJ K;  4BY1 C;  3GTO C;  3GTQ K;  5M3M K;  2PMZ D;  4AH6 A;  1VGX A;  3ERE D;  3PO3 C;  4O26 A;  4MQ9 A;  4XSX A;  2NVY A;  2WAQ D;  3AD8 C;  4NOK A;  3GTJ C;  3GTO K;  2E2J C;  1EK8 A;  4A3F K;  1J6X A;  2JA6 C;  1K83 C;  3A8I A;  1EI6 A;  1WCM K;  5HL8 A;  1TWA A;  1ZBS A;  2P8T A;  4Y52 K;  1JVI A;  3BP3 A;  3GTO A;  4DDQ A;  3S16 K;  3GTM A;  1O2F B;  4C3J C;  1EJ9 A;  1RU0 A;  2ZUE A;  5IP7 K;  3PO2 K;  1DCH A;  1BDF A;  1AB4 A;  2NVX C;  2JA7 K;  4JLR C;  3AQP A;  2XCR B;  2O5I A;  3TTG A;  3GTM K;  1BJT A;  4H3T A;  1TL8 A; 
#chains in the Genus database with same CATH homology
 4AN8 A;  1ISE A;  4GFQ A;  2WB1 A;  3GTP A;  1YNJ D;  2E2I A;  2CFA B;  1ZXO A;  2GSU A;  2B63 A;  2JA7 A;  2VUM A;  4G0V A;  4F3E A;  5CHP A;  1TWG A;  1R49 A;  1SFO A;  4KB2 A;  2A6E D;  1O29 A;  2XCQ A;  4C3I C;  3P9A A;  4FGU A;  3V4G A;  1KQ4 A;  4IP8 A;  1O28 A;  3OPF A;  2PHC B;  4P5B A;  4QIW A;  3MAQ A;  3GTQ A;  2JA5 A;  3ORE A;  4GTB A;  1IW7 D;  1WQH A;  4KMD A;  3NUH A;  4IP9 A;  1ZVU A;  2B9S B;  1EH1 A;  4L8I A;  1Y69 8;  4BLB A;  5IOQ A;  1A36 A;  3CQZ A;  3H0G A;  3KYL A;  4C2M A;  4KDD A;  1K83 A;  2O5J D;  4BKW A;  3GTG A;  3BUE A;  5JVO A;  4QCL A;  4P5A A;  3AQO A;  3K5N A;  3N0C A;  4D3Z A;  3LHP S;  1A35 A;  4LQY A;  1I3Q A;  1A31 A;  1K4S A;  3IAY A;  1O27 A;  3K57 A;  4KB4 A;  1XXA A;  4FM9 A;  3OEP A;  1O26 A;  1RR8 C;  3CAG A;  4KMH A;  3MML B;  3S0X A;  1WIH A;  2NVX A;  4LR2 A;  4AYB A;  3FHZ A;  1SEU A;  3M4A A;  3VA7 A;  4KAW X;  3QX3 A;  3N0B A;  1WCM A;  3LPX A;  2A68 D;  4AHC A;  3LAP A;  3FOF A;  4NOL A;  1GE9 A;  3L4J A;  4D3Y A;  2RH6 A;  1B4A A;  4G0W A;  2GSN A;  1WQF A;  5IOS A;  3DU5 A;  4FYD A;  4EJ3 A;  1SC7 A;  1LPQ A;  3Q3Q A;  1TGO A;  1I50 A;  4C3H C;  3N3Y A;  3K5O A;  1RRJ A;  1Q8I A;  4KM9 A;  4ILD A;  2R4G A;  1MIU A;  1BGW A;  4GTD A;  2Y0S A;  3HKZ A;  4GTA A;  2F4Q A;  3LF9 A;  1O2B A;  4OYD B;  2GSO A;  3GTJ A;  2RGR A;  5EGH A;  5TJ3 A;  3FKI A;  4Q5V A;  4FZB A;  3GTK A;  5JSB B;  1TL8 A;  4LMO A;  2CFA A;  2E2H A;  5CJ9 A;  1Y1V A;  3GTL A;  1F9N A;  1B4B A;  1V9M A;  5JFE A;  5CQG A;  3K5L A;  3K5M A;  1O25 A;  2P5M A;  1T8I A;  5IOT A;  3LAJ A;  4NOM A;  4KMA A;  1YNN D;  3ERE D;  2A69 D;  2R7Z A;  5MLC 9;  1K4T A;  4O26 A;  2JA6 A;  4KAR A;  3DU6 A;  5EGE A;  4G0U A;  2NVY A;  1ZYR D;  1TWC A;  4M1X A;  1O24 A;  2YU9 A;  3AH5 A;  4NOK A;  1EK8 A;  4Q5G A;  1Y1W A;  2CW0 D;  1DD5 A;  4KAS A;  4KM8 A;  4BLA A;  1O2A A;  1WQG A;  1IS1 A;  2WAQ A;  3G4C A;  4C2M C;  1TWA A;  1ZBS A;  4GT9 A;  4KAT A;  1TWH A;  2XCO A;  3L4K A;  3K58 A;  2JH3 A;  3GTO A;  3K59 A;  3FOE A;  4DDQ A;  2Y3P A;  4GTF A;  3GTM A;  1XXC A;  4C3J C;  2PMZ A;  1I6V D;  1EJ9 A;  1R5Z A;  1HQM D;  4GTL A;  3WVO A;  2ZFZ A;  2BE5 D;  3SJR A;  1NH3 A;  1TWF A;  2R93 A;  3G4A A;  1AB4 A;  4J3N A;  2R92 A;  5IOR A;  4KC6 A;  4GTE A;  2A6H D;  5C9H A;  4JLR C;  2KWA A;  3AQP A;  2XCR B;  4FXD A;  1BJT A;  4GTC A;  1XXB A;  1SMY D;  4H3T A;  5JSN B;  1R9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...