4KB2A

Crystal structure of ribosome recycling factor mutant r109a from mycobacterium tuberculosis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
184
structure length
184
Chain Sequence
b'MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEEARRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
molecule tags Translation
source organism Mycobacterium tuberculosis
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
total genus 64
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kb2A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kb2A02
1WQGA 1WQHA 1AB4A 4GFQA 1WIHA 1XXBA 1F9NA 4DDQA 3OEPA 3BUEA 3NUHA 5JSBB 3LPXA 1BGWA 1XXCA 1WQFA 5JVOA 4KDDA 3QX3A 4JLRC 1ISEA 1XXAA 3L4KA 1EH1A 2PHCB 2XCOA 1DD5A 3L4JA 3OREA 1BJTA 3CAGA 2XCQA 1EK8A 5CJ9A 2ZFZA 4J3NA 2RGRA 4KB4A 3LF9A 1B4AA 3LAJA 5MLC9 4KC6A 3FOEA 4G0VA 3LHPS 3FHZA 4KB2A 3V4GA 4G0UA 4KAWX 5JSNB 1ZVUA 4G0WA 2XCRB 3MMLB 3FOFA 1GE9A 3ERED 4OYDB 4L8IA 4FM9A 3LAPA 1B4BA 2Y3PA 3OPFA 1IS1A 3VA7A 2KWAA 2P5MA 1Y698
chains in the Genus database with same CATH superfamily
3PO2K 3GEHA 1WCMA 1A31A 5C44C 1WCMC 1PJ7A 4GTAA 3CQZA 3K5NA 1EFWA 4LMOA 1TWGC 1YNJD 1ZBSA 4BLBA 2O5JA 3GTQC 2PMZL 4NOKA 4IP8A 4BY1C 5M3FK 4GTBA 3PO3K 2R92A 4MQ9A 3M3YK 1PJ5A 3LF9A 3GTKA 2JA5K 2V6SA 4A3BK 1Q8IA 3S1QC 2Y0SL 4KB2A 3GTJA 4QJVB 4AN8A 4O26A 3S1MC 1GE9A 1WORA 1TWFC 3DU5A 5C3EK 1O25A 3OPFA 2YU9C 4G7ZA 4FXDA 1V5VA 2V6UA 3GTJK 1SEUA 2CW0D 3LPXA 2FQTA 4KDDA 3S2HC 4C3HK 1EH1A 4BLAA 5IYCC 1I50A 3GTGA 3H0GC 1I50C 1HQMA 2A68A 4G0VA 5MLC9 3KYLA 2YU9K 1WCMK 4YFKA 3GTOK 1VH2A 2JA6C 3GTGK 3ERED 1USMA 1TWCA 4A3BC 3GTJC 2A6EA 4KM8A 3VA7A 2P5MA 2B63A 4KMUA 2R93C 3K5OA 3IPJA 3OEPA 1YNJA 4Q5GA 1XZQA 5IOTA 1BGWA 3H0GK 3N0BA 4A3JC 1ISEA 5JFEA 3K57A 4A3LK 1YX2A 4A3IK 3H3VD 3HOXC 1L0WA 4A3MC 1EK8A 2E2HK 1I3QC 4BKWA 4A3GK 1Y1WA 2D6FC 4XLNA 1ZYRA 4BY7K 1VRQC 3PO2C 4G7OA 1IS1A 3T01A 2JA7K 5M3MK 3S1NC 5FLMK 2JA7C 1TWAA 3BUEA 5HL8A 3S16C 2JA6A 1WQFA 2O5JD 2PPBA 3T00A 1Y1VA 3GTMA 4GTCA 4WJ4A 3I4MK 5IOSA 4A93K 1KQ4A 3GSIA 1PJ6A 4QIWL 3GTGC 2E2IA 1J6XA 3LAJA 2R7ZA 1Y1VK 1MIUA 5JSNB 1USOA 4A3IC 2R4GA 3LAPA 2NVTC 3HOUK 1I6VD 5IYDK 4KMAA 2NVXA 1IBAA 3GTPA 4A3DC 3S14C 3RZDC 3N0CA 2EBBA 3JSTA 2WAQL 4OIOA 3S15K 4A3CC 1XXAA 4AYBA 2Y0SD 3S17C 3GTOC 3GTOA 1VGXA 3OREA 3GTMC 2ZUEA 4BY7C 5C4XC 5CJ9A 2VUMK 4OIPA 1TWCK 1O2FB 4Y7NC 3FKIK 2JA7A 4BXXC 4C3JC 1I6HC 1XZPB 4JK1A 4LOWA 1JVIA 1TWAK 3GTPC 2JA5C 1SC7A 1J6WA 1IQ0A 5TMFA 1LPQA 2WAQD 3N3YA 3EQLA 4Y52K 4Q5SA 4FYDA 4GT9A 1I3QA 3BP8C 4D3YA 2B9SB 1R5ZA 3H3VL 3CQZK 2ZUFA 4AH6A 1VJEA 1O24A 5CHPA 4WILA 3S14K 3HOVC 4FGUA 2GSNA 2NVYK 3FOFA 4C3IK 3MAQA 2XCQA 2V6TA 3M4OK 1YNNA 4YFXA 2E2JK 1RRJA 2NVYA 5M5XK 1SFOC 1TGOA 4A3DK 3L4KA 3DXJA 3T02A 2A68D 3S1MK 3SZZA 2NVTK 4KN4A 5TMCA 4KARA 3S2HK 2NVQK 4OYDB 4FM9A 2WB1D 4EJ3A 2WB1L 2PMZA 4C2MC 1O2BA 1F7UA 4O2DA 3HKZL 4XCHA 2O5IA 4P5AA 5M5YK 3SZYA 4GTFA 3FKIA 3S1QK 4BBSC 3K7AK 1BJTA 4KMDA 4A3JK 1TWGA 1RU0A 3RZDK 3GEEA 1TL8A 2A69A 4LR2A 4NOMA 3S16K 1ZYRD 4GZYA 1IL2A 1J98A 1TWHC 3S1RC 2CW0A 2GSUA 2JH3A 1Y698 4C2MA 2PA8D 4KATA 4KMHA 2R93A 1TWHK 3S1RK 5JSBB 1O2AA 5L46A 2R7ZK 2E2HC 2RH6A 3S2DK 1K83K 1TWHA 2NVQC 2RGRA 5IP9K 5EGEA 3LHPS 5FJ8K 2A6ED 1ZVUA 4Y7NK 4A3KK 4BXXK 1SFOA 2A69D 4WJ3M 2E2IK 1JOEA 4NOIA 4OIQA 1SMYA 3GTKK 1R9TK 2PMZD 3HOWC 1I50K 4DDQA 4C3HC 1RR8C 3TTGA 3HOXK 4A3MK 1TWFA 1UV7A 1XXCA 3GTLK 1DCOA 1R9TA 2B63C 3IAYA 3GTPK 2PHCB 3G4CA 4PABA 2ZFZA 3AQPA 3GDZA 4LJZA 3GTMK 4XLPA 3FHZA 5IP7K 1C0AA 1YNND 1DCHA 3Q3QA 1WOPA 3P9AA 4Q4ZA 2E2IC 3RZOK 4GFQA 5IYDC 1F9NA 2R7ZC 1SMYD 3TFJA 4QCLA 4Y52C 3HOYK 2A6HD 4P9SA 1V9MA 3HKZA 4GTEA 1WSVA 2JA8C 3TFIA 4KASA 4LK1A 5EGHA 1T8IA 3CAGA 1A36A 3AD9C 1B4AA 3A8IA 1ZQ1C 3GTKC 4A93C 1TWGK 5C3EC 5C4XK 1INNA 4QJVA 3WVOA 2GAHC 1B4BA 2R92C 1EJ9A 2WAQA 2PA8L 4NOLA 5C4JC 1WQHA 3K58A 3GTQA 1AB4A 1YCLA 1IE0A 1DCPA 1K83C 1K83A 3M3YC 1HI9A 3QX3A 1O26A 4LLGA 4LK0A 2JA5A 2GSOA 3HOUC 1BDFA 3HOZC 3BP3A 1DD5A 4XSXA 3GTQK 4H3TA 5M5WK 1I3QK 4BBSK 3HKZD 1O29A 3A8JA 4QIWD 3DU6A 3HXAA 4KC6A 3S0XA 1XZQB 1O28A 4G0UA 3A8KA 4G0WA 4C45A 2JA8K 4YFNA 4L8IA 3HOYC 2BE5D 3AH5A 3I4MC 2KWAA 3TFHA 2NVXC 2W7VA 1WIHA 5C9HA 3GTLC 2VUMA 1IW7D 3SJRA 5JVOA 4JLRC 4GTDA 4P5BA 4BBRK 4A3EC 1VLOA 5IORA 1TWFK 3K5LA 4OIRA 2F4QA 4C3IC 3FOEA 4A3GC 2P8TA 1WOOA 1EQRA 3AQOA 2NVYC 3WODA 4LQYA 5IYCK 4QIWA 1F7VA 2E2JC 1WOSA 3AD8C 2YU9A 3M4OC 4YG2A 4A3LC 1R49A 1TWAC 2XCRB 4PAAA 3AD7C 4C3JK 4OINA 2R92K 1EI6A 5CQGA 1TWCC 3RZOC 4KN7A 1X31C 5C44K 4A3KC 2XCOA 3S15C 3L4JA 4A3CK 1WSRA 5IYBK 3K5MA 3CQZC 4KB4A 2Y0SA 4Q5VA 4AYBD 1O27A 3M4AA 1J6VA 3G4AA 4AYBL 1XZPA 2NVXK 2WB1A 1Y1WC 3V4GA 4G7HA 2CFAA 3I4NC 1G51A 1JQWA 1F93A 1I6VA 3GTLA 1Y1WK 1WQGA 5TJ3A 1BS2A 4KM9A 4MEYA 3S17K 5E68A 1IW7A 4M1XA 5IYBC 1XPPA 3GEIA 5D4DA 4ZH4A 5IP7C 4D3ZA 4A3FK 1R9TC 4C2MK 4J3NA 4GTLA 2B63K 5C4JK 4ILDA 2Y3PA 2BE5A 4BY1K 3H0GA 1I6HK 4F3EA 1K4SA 3FKIC 4A3FC 1A35A 3HOWK 1ZXOA 1XXBA 1SFOK 2VUMC 3GIRA 3NUHA 5IOQA 4IP9A 2A6HA 2E2HA 3ADAC 1Y1VC 2CFAB 4FZBA 4BBRC 4A3EK 2FQOA 4X6AC 1NH3A 3S1NK 5IP9C 3K59A 1HQMD 4XSZA 3HOZK 3S2DC 3I4NK 2GAGC 4AHCA 4MEXA 3PO3C 1K4TA 4RMFA 4KAWX 3HOVK 2R93K 3MMLB 5FLMC 3K7AC 2JA6K 4X6AK
chains in the Genus database with same CATH topology
4C2MA 4KMAA 1WCMA 1A31A 2NVXA 4KATA 4KMHA 4GTAA 3CQZA 3GTPA 5C9HA 3K5NA 1WIHA 2R93A 4LMOA 2VUMA 1YNJD 1ZBSA 5JSBB 1IW7D 3N0CA 4BLBA 3SJRA 5JVOA 4NOKA 4JLRC 1O2AA 4GTDA 4IP8A 1XXAA 4AYBA 4GTBA 2R92A 4P5BA 2RH6A 3GTOA 3OREA 5IORA 5CJ9A 1TWHA 3K5LA 2RGRA 3LF9A 3GTKA 2F4QA 4C3IC 3FOEA 3AQOA 2JA7A 1Q8IA 5EGEA 3LHPS 4C3JC 2A6ED 4KB2A 3GTJA 1ZVUA 4LQYA 4QIWA 4AN8A 1SFOA 4O26A 1SC7A 1GE9A 2A69D 2YU9A 3DU5A 1O25A 3OPFA 1LPQA 1R49A 2XCRB 4FXDA 3N3YA 1SEUA 4DDQA 4FYDA 4GT9A 5CQGA 2CW0D 1I3QA 1RR8C 4C3HC 3LPXA 1TWFA 1XXCA 4KDDA 4D3YA 2B9SB 1R5ZA 1R9TA 3IAYA 1EH1A 4BLAA 2PHCB 1I50A 2XCOA 3GTGA 3L4JA 3G4CA 3K5MA 2ZFZA 1O24A 4KB4A 5CHPA 2Y0SA 4Q5VA 5MLC9 3KYLA 3M4AA 1O27A 3AQPA 3G4AA 4G0VA 4FGUA 2GSNA 1Y698 2WB1A 3FHZA 3V4GA 2CFAA 3FOFA 3ERED 1YNND 1TWCA 3Q3QA 3MAQA 4KM8A 3VA7A 2XCQA 3GTLA 2B63A 2P5MA 3P9AA 1WQGA 5TJ3A 4KM9A 3K5OA 4GFQA 1RRJA 1F9NA 3OEPA 1SMYD 2NVYA 4Q5GA 4M1XA 5IOTA 1BGWA 4QCLA 3N0BA 2A6HD 1ISEA 5JFEA 1V9MA 1TGOA 3HKZA 4D3ZA 3K57A 4GTEA 3L4KA 4KASA 5EGHA 1T8IA 2A68D 3CAGA 1A36A 1EK8A 4J3NA 1B4AA 4BKWA 3QX3A 4GTLA 1Y1WA 4KARA 4ILDA 4OYDB 4FM9A 3WVOA 1B4BA 4EJ3A 2Y3PA 1IS1A 3H0GA 1EJ9A 2WAQA 2PMZA 4NOLA 4F3EA 1O2BA 1K4SA 4C2MC 1WQHA 3K58A 1A35A 3GTQA 1AB4A 1ZXOA 1XXBA 1TWAA 3BUEA 3NUHA 5IOQA 4IP9A 1K83A 2JA6A 1WQFA 2O5JD 2E2HA 2CFAB 4FZBA 1O26A 1Y1VA 3GTMA 4GTCA 2JA5A 4P5AA 2GSOA 5IOSA 4GTFA 3FKIA 1NH3A 1DD5A 1KQ4A 4H3TA 1BJTA 4KMDA 3K59A 1TWGA 1HQMD 1O29A 1TL8A 3AH5A 3DU6A 2E2IA 4KC6A 2R7ZA 3S0XA 3LAJA 4AHCA 1O28A 4G0UA 1K4TA 1MIUA 4KAWX 5JSNB 4LR2A 4NOMA 4G0WA 1ZYRD 3MMLB 2R4GA 4L8IA 3LAPA 2BE5D 2GSUA 2KWAA 2JH3A 1I6VD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQG A;  1WQH A;  1AB4 A;  4GFQ A;  1WIH A;  1XXB A;  1F9N A;  4DDQ A;  3OEP A;  3BUE A;  3NUH A;  5JSB B;  3LPX A;  1BGW A;  1XXC A;  1WQF A;  5JVO A;  4KDD A;  3QX3 A;  4JLR C;  1ISE A;  1XXA A;  3L4K A;  1EH1 A;  2PHC B;  2XCO A;  1DD5 A;  3L4J A;  3ORE A;  1BJT A;  3CAG A;  2XCQ A;  1EK8 A;  5CJ9 A;  2ZFZ A;  4J3N A;  2RGR A;  4KB4 A;  3LF9 A;  1B4A A;  3LAJ A;  5MLC 9;  4KC6 A;  3FOE A;  4G0V A;  3LHP S;  3FHZ A;  4KB2 A;  3V4G A;  4G0U A;  4KAW X;  5JSN B;  1ZVU A;  4G0W A;  2XCR B;  3MML B;  3FOF A;  1GE9 A;  3ERE D;  4OYD B;  4L8I A;  4FM9 A;  3LAP A;  1B4B A;  2Y3P A;  3OPF A;  1IS1 A;  3VA7 A;  2KWA A;  2P5M A;  1Y69 8; 
#chains in the Genus database with same CATH topology
 3PO2 K;  3GEH A;  1WCM A;  1A31 A;  5C44 C;  1WCM C;  1PJ7 A;  4GTA A;  3CQZ A;  3K5N A;  1EFW A;  4LMO A;  1TWG C;  1YNJ D;  1ZBS A;  4BLB A;  2O5J A;  3GTQ C;  2PMZ L;  4NOK A;  4IP8 A;  4BY1 C;  5M3F K;  4GTB A;  3PO3 K;  2R92 A;  4MQ9 A;  3M3Y K;  1PJ5 A;  3LF9 A;  3GTK A;  2JA5 K;  2V6S A;  4A3B K;  1Q8I A;  3S1Q C;  2Y0S L;  4KB2 A;  3GTJ A;  4QJV B;  4AN8 A;  4O26 A;  3S1M C;  1GE9 A;  1WOR A;  1TWF C;  3DU5 A;  5C3E K;  1O25 A;  3OPF A;  2YU9 C;  4G7Z A;  4FXD A;  1V5V A;  2V6U A;  3GTJ K;  1SEU A;  2CW0 D;  3LPX A;  2FQT A;  4KDD A;  3S2H C;  4C3H K;  1EH1 A;  4BLA A;  5IYC C;  1I50 A;  3GTG A;  3H0G C;  1I50 C;  1HQM A;  2A68 A;  4G0V A;  5MLC 9;  3KYL A;  2YU9 K;  1WCM K;  4YFK A;  3GTO K;  1VH2 A;  2JA6 C;  3GTG K;  3ERE D;  1USM A;  1TWC A;  4A3B C;  3GTJ C;  2A6E A;  4KM8 A;  3VA7 A;  2P5M A;  2B63 A;  4KMU A;  2R93 C;  3K5O A;  3IPJ A;  3OEP A;  1YNJ A;  4Q5G A;  1XZQ A;  5IOT A;  1BGW A;  3H0G K;  3N0B A;  4A3J C;  1ISE A;  5JFE A;  3K57 A;  4A3L K;  1YX2 A;  4A3I K;  3H3V D;  3HOX C;  1L0W A;  4A3M C;  1EK8 A;  2E2H K;  1I3Q C;  4BKW A;  4A3G K;  1Y1W A;  2D6F C;  4XLN A;  1ZYR A;  4BY7 K;  1VRQ C;  3PO2 C;  4G7O A;  1IS1 A;  3T01 A;  2JA7 K;  5M3M K;  3S1N C;  5FLM K;  2JA7 C;  1TWA A;  3BUE A;  5HL8 A;  3S16 C;  2JA6 A;  1WQF A;  2O5J D;  2PPB A;  3T00 A;  1Y1V A;  3GTM A;  4GTC A;  4WJ4 A;  3I4M K;  5IOS A;  4A93 K;  1KQ4 A;  3GSI A;  1PJ6 A;  4QIW L;  3GTG C;  2E2I A;  1J6X A;  3LAJ A;  2R7Z A;  1Y1V K;  1MIU A;  5JSN B;  1USO A;  4A3I C;  2R4G A;  3LAP A;  2NVT C;  3HOU K;  1I6V D;  5IYD K;  4KMA A;  2NVX A;  1IBA A;  3GTP A;  4A3D C;  3S14 C;  3RZD C;  3N0C A;  2EBB A;  3JST A;  2WAQ L;  4OIO A;  3S15 K;  4A3C C;  1XXA A;  4AYB A;  2Y0S D;  3S17 C;  3GTO C;  3GTO A;  1VGX A;  3ORE A;  3GTM C;  2ZUE A;  4BY7 C;  5C4X C;  5CJ9 A;  2VUM K;  4OIP A;  1TWC K;  1O2F B;  4Y7N C;  3FKI K;  2JA7 A;  4BXX C;  4C3J C;  1I6H C;  1XZP B;  4JK1 A;  4LOW A;  1JVI A;  1TWA K;  3GTP C;  2JA5 C;  1SC7 A;  1J6W A;  1IQ0 A;  5TMF A;  1LPQ A;  2WAQ D;  3N3Y A;  3EQL A;  4Y52 K;  4Q5S A;  4FYD A;  4GT9 A;  1I3Q A;  3BP8 C;  4D3Y A;  2B9S B;  1R5Z A;  3H3V L;  3CQZ K;  2ZUF A;  4AH6 A;  1VJE A;  1O24 A;  5CHP A;  4WIL A;  3S14 K;  3HOV C;  4FGU A;  2GSN A;  2NVY K;  3FOF A;  4C3I K;  3MAQ A;  2XCQ A;  2V6T A;  3M4O K;  1YNN A;  4YFX A;  2E2J K;  1RRJ A;  2NVY A;  5M5X K;  1SFO C;  1TGO A;  4A3D K;  3L4K A;  3DXJ A;  3T02 A;  2A68 D;  3S1M K;  3SZZ A;  2NVT K;  4KN4 A;  5TMC A;  4KAR A;  3S2H K;  2NVQ K;  4OYD B;  4FM9 A;  2WB1 D;  4EJ3 A;  2WB1 L;  2PMZ A;  4C2M C;  1O2B A;  1F7U A;  4O2D A;  3HKZ L;  4XCH A;  2O5I A;  4P5A A;  5M5Y K;  3SZY A;  4GTF A;  3FKI A;  3S1Q K;  4BBS C;  3K7A K;  1BJT A;  4KMD A;  4A3J K;  1TWG A;  1RU0 A;  3RZD K;  3GEE A;  1TL8 A;  2A69 A;  4LR2 A;  4NOM A;  3S16 K;  1ZYR D;  4GZY A;  1IL2 A;  1J98 A;  1TWH C;  3S1R C;  2CW0 A;  2GSU A;  2JH3 A;  1Y69 8;  4C2M A;  2PA8 D;  4KAT A;  4KMH A;  2R93 A;  1TWH K;  3S1R K;  5JSB B;  1O2A A;  5L46 A;  2R7Z K;  2E2H C;  2RH6 A;  3S2D K;  1K83 K;  1TWH A;  2NVQ C;  2RGR A;  5IP9 K;  5EGE A;  3LHP S;  5FJ8 K;  2A6E D;  1ZVU A;  4Y7N K;  4A3K K;  4BXX K;  1SFO A;  2A69 D;  4WJ3 M;  2E2I K;  1JOE A;  4NOI A;  4OIQ A;  1SMY A;  3GTK K;  1R9T K;  2PMZ D;  3HOW C;  1I50 K;  4DDQ A;  4C3H C;  1RR8 C;  3TTG A;  3HOX K;  4A3M K;  1TWF A;  1UV7 A;  1XXC A;  3GTL K;  1DCO A;  1R9T A;  2B63 C;  3IAY A;  3GTP K;  2PHC B;  3G4C A;  4PAB A;  2ZFZ A;  3AQP A;  3GDZ A;  4LJZ A;  3GTM K;  4XLP A;  3FHZ A;  5IP7 K;  1C0A A;  1YNN D;  1DCH A;  3Q3Q A;  1WOP A;  3P9A A;  4Q4Z A;  2E2I C;  3RZO K;  4GFQ A;  5IYD C;  1F9N A;  2R7Z C;  1SMY D;  3TFJ A;  4QCL A;  4Y52 C;  3HOY K;  2A6H D;  4P9S A;  1V9M A;  3HKZ A;  4GTE A;  1WSV A;  2JA8 C;  3TFI A;  4KAS A;  4LK1 A;  5EGH A;  1T8I A;  3CAG A;  1A36 A;  3AD9 C;  1B4A A;  3A8I A;  1ZQ1 C;  3GTK C;  4A93 C;  1TWG K;  5C3E C;  5C4X K;  1INN A;  4QJV A;  3WVO A;  2GAH C;  1B4B A;  2R92 C;  1EJ9 A;  2WAQ A;  2PA8 L;  4NOL A;  5C4J C;  1WQH A;  3K58 A;  3GTQ A;  1AB4 A;  1YCL A;  1IE0 A;  1DCP A;  1K83 C;  1K83 A;  3M3Y C;  1HI9 A;  3QX3 A;  1O26 A;  4LLG A;  4LK0 A;  2JA5 A;  2GSO A;  3HOU C;  1BDF A;  3HOZ C;  3BP3 A;  1DD5 A;  4XSX A;  3GTQ K;  4H3T A;  5M5W K;  1I3Q K;  4BBS K;  3HKZ D;  1O29 A;  3A8J A;  4QIW D;  3DU6 A;  3HXA A;  4KC6 A;  3S0X A;  1XZQ B;  1O28 A;  4G0U A;  3A8K A;  4G0W A;  4C45 A;  2JA8 K;  4YFN A;  4L8I A;  3HOY C;  2BE5 D;  3AH5 A;  3I4M C;  2KWA A;  3TFH A;  2NVX C;  2W7V A;  1WIH A;  5C9H A;  3GTL C;  2VUM A;  1IW7 D;  3SJR A;  5JVO A;  4JLR C;  4GTD A;  4P5B A;  4BBR K;  4A3E C;  1VLO A;  5IOR A;  1TWF K;  3K5L A;  4OIR A;  2F4Q A;  4C3I C;  3FOE A;  4A3G C;  2P8T A;  1WOO A;  1EQR A;  3AQO A;  2NVY C;  3WOD A;  4LQY A;  5IYC K;  4QIW A;  1F7V A;  2E2J C;  1WOS A;  3AD8 C;  2YU9 A;  3M4O C;  4YG2 A;  4A3L C;  1R49 A;  1TWA C;  2XCR B;  4PAA A;  3AD7 C;  4C3J K;  4OIN A;  2R92 K;  1EI6 A;  5CQG A;  1TWC C;  3RZO C;  4KN7 A;  1X31 C;  5C44 K;  4A3K C;  2XCO A;  3S15 C;  3L4J A;  4A3C K;  1WSR A;  5IYB K;  3K5M A;  3CQZ C;  4KB4 A;  2Y0S A;  4Q5V A;  4AYB D;  1O27 A;  3M4A A;  1J6V A;  3G4A A;  4AYB L;  1XZP A;  2NVX K;  2WB1 A;  1Y1W C;  3V4G A;  4G7H A;  2CFA A;  3I4N C;  1G51 A;  1JQW A;  1F93 A;  1I6V A;  3GTL A;  1Y1W K;  1WQG A;  5TJ3 A;  1BS2 A;  4KM9 A;  4MEY A;  3S17 K;  5E68 A;  1IW7 A;  4M1X A;  5IYB C;  1XPP A;  3GEI A;  5D4D A;  4ZH4 A;  5IP7 C;  4D3Z A;  4A3F K;  1R9T C;  4C2M K;  4J3N A;  4GTL A;  2B63 K;  5C4J K;  4ILD A;  2Y3P A;  2BE5 A;  4BY1 K;  3H0G A;  1I6H K;  4F3E A;  1K4S A;  3FKI C;  4A3F C;  1A35 A;  3HOW K;  1ZXO A;  1XXB A;  1SFO K;  2VUM C;  3GIR A;  3NUH A;  5IOQ A;  4IP9 A;  2A6H A;  2E2H A;  3ADA C;  1Y1V C;  2CFA B;  4FZB A;  4BBR C;  4A3E K;  2FQO A;  4X6A C;  1NH3 A;  3S1N K;  5IP9 C;  3K59 A;  1HQM D;  4XSZ A;  3HOZ K;  3S2D C;  3I4N K;  2GAG C;  4AHC A;  4MEX A;  3PO3 C;  1K4T A;  4RMF A;  4KAW X;  3HOV K;  2R93 K;  3MML B;  5FLM C;  3K7A C;  2JA6 K;  4X6A K; 
#chains in the Genus database with same CATH homology
 4C2M A;  4KMA A;  1WCM A;  1A31 A;  2NVX A;  4KAT A;  4KMH A;  4GTA A;  3CQZ A;  3GTP A;  5C9H A;  3K5N A;  1WIH A;  2R93 A;  4LMO A;  2VUM A;  1YNJ D;  1ZBS A;  5JSB B;  1IW7 D;  3N0C A;  4BLB A;  3SJR A;  5JVO A;  4NOK A;  4JLR C;  1O2A A;  4GTD A;  4IP8 A;  1XXA A;  4AYB A;  4GTB A;  2R92 A;  4P5B A;  2RH6 A;  3GTO A;  3ORE A;  5IOR A;  5CJ9 A;  1TWH A;  3K5L A;  2RGR A;  3LF9 A;  3GTK A;  2F4Q A;  4C3I C;  3FOE A;  3AQO A;  2JA7 A;  1Q8I A;  5EGE A;  3LHP S;  4C3J C;  2A6E D;  4KB2 A;  3GTJ A;  1ZVU A;  4LQY A;  4QIW A;  4AN8 A;  1SFO A;  4O26 A;  1SC7 A;  1GE9 A;  2A69 D;  2YU9 A;  3DU5 A;  1O25 A;  3OPF A;  1LPQ A;  1R49 A;  2XCR B;  4FXD A;  3N3Y A;  1SEU A;  4DDQ A;  4FYD A;  4GT9 A;  5CQG A;  2CW0 D;  1I3Q A;  1RR8 C;  4C3H C;  3LPX A;  1TWF A;  1XXC A;  4KDD A;  4D3Y A;  2B9S B;  1R5Z A;  1R9T A;  3IAY A;  1EH1 A;  4BLA A;  2PHC B;  1I50 A;  2XCO A;  3GTG A;  3L4J A;  3G4C A;  3K5M A;  2ZFZ A;  1O24 A;  4KB4 A;  5CHP A;  2Y0S A;  4Q5V A;  5MLC 9;  3KYL A;  3M4A A;  1O27 A;  3AQP A;  3G4A A;  4G0V A;  4FGU A;  2GSN A;  1Y69 8;  2WB1 A;  3FHZ A;  3V4G A;  2CFA A;  3FOF A;  3ERE D;  1YNN D;  1TWC A;  3Q3Q A;  3MAQ A;  4KM8 A;  3VA7 A;  2XCQ A;  3GTL A;  2B63 A;  2P5M A;  3P9A A;  1WQG A;  5TJ3 A;  4KM9 A;  3K5O A;  4GFQ A;  1RRJ A;  1F9N A;  3OEP A;  1SMY D;  2NVY A;  4Q5G A;  4M1X A;  5IOT A;  1BGW A;  4QCL A;  3N0B A;  2A6H D;  1ISE A;  5JFE A;  1V9M A;  1TGO A;  3HKZ A;  4D3Z A;  3K57 A;  4GTE A;  3L4K A;  4KAS A;  5EGH A;  1T8I A;  2A68 D;  3CAG A;  1A36 A;  1EK8 A;  4J3N A;  1B4A A;  4BKW A;  3QX3 A;  4GTL A;  1Y1W A;  4KAR A;  4ILD A;  4OYD B;  4FM9 A;  3WVO A;  1B4B A;  4EJ3 A;  2Y3P A;  1IS1 A;  3H0G A;  1EJ9 A;  2WAQ A;  2PMZ A;  4NOL A;  4F3E A;  1O2B A;  1K4S A;  4C2M C;  1WQH A;  3K58 A;  1A35 A;  3GTQ A;  1AB4 A;  1ZXO A;  1XXB A;  1TWA A;  3BUE A;  3NUH A;  5IOQ A;  4IP9 A;  1K83 A;  2JA6 A;  1WQF A;  2O5J D;  2E2H A;  2CFA B;  4FZB A;  1O26 A;  1Y1V A;  3GTM A;  4GTC A;  2JA5 A;  4P5A A;  2GSO A;  5IOS A;  4GTF A;  3FKI A;  1NH3 A;  1DD5 A;  1KQ4 A;  4H3T A;  1BJT A;  4KMD A;  3K59 A;  1TWG A;  1HQM D;  1O29 A;  1TL8 A;  3AH5 A;  3DU6 A;  2E2I A;  4KC6 A;  2R7Z A;  3S0X A;  3LAJ A;  4AHC A;  1O28 A;  4G0U A;  1K4T A;  1MIU A;  4KAW X;  5JSN B;  4LR2 A;  4NOM A;  4G0W A;  1ZYR D;  3MML B;  2R4G A;  4L8I A;  3LAP A;  2BE5 D;  2GSU A;  2KWA A;  2JH3 A;  1I6V D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...