4OYDB

Crystal structure of a computationally designed inhibitor of an epstein-barr viral bcl-2 protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
117
structure length
117
Chain Sequence
ADPKKVLDKAKDQAENRVRELKQKLEELYKEARKLDLTQEMRRKLELRYIAAMLMAIGDIYNAIRQAKQEADKLKKAGLVNSQQLDELKRRLEELKEEASRKARDYGREFQLKLEYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis regulator BHRF1
publication title A computationally designed inhibitor of an epstein-barr viral bcl-2 protein induces apoptosis in infected cells.
pubmed doi rcsb
source organism Epstein-barr virus
molecule tags Viral protein/inhibitor
total genus 53
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4oydB00
3LHPS 1WQHA 4L8IA 4JLRC 5JSBB 1WQFA 1GE9A 1IS1A 4KAWX 3LF9A 5JSNB 1EK8A 4GFQA 4KDDA 5MLC9 4KB2A 4OYDB 1EH1A 4KC6A 1DD5A 4KB4A 1WQGA 1ISEA 1Y698
chains in the Genus database with same CATH superfamily
1SMYD 1TGOA 1SEUA 1YNND 4IP8A 2PMZA 3DU6A 2R4GA 5JSBB 1WQFA 3K5OA 4KAWX 2A6HD 2A6ED 3IAYA 3GTGA 4C2MA 4FYDA 5MLC9 4KB2A 1A31A 1K83A 3HKZA 3GTMA 5CQGA 4D3YA 1EH1A 3FKIA 3K59A 3MAQA 1RRJA 3P9AA 2A68D 1RR8C 3K5MA 1Y698 2JA6A 1R49A 3LHPS 1WQHA 4FGUA 4L8IA 1I50A 4JLRC 2F4QA 2WB1A 4D3ZA 1LPQA 1ZYRD 1EJ9A 5JSNB 4NOKA 3GTOA 2VUMA 4H3TA 1T8IA 3GTJA 2R93A 1NH3A 4NOLA 3K5LA 3GTKA 4IP9A 1K4SA 4QCLA 2R7ZA 4QIWA 4OYDB 1A35A 1DD5A 1I3QA 1V9MA 1WQGA 1TWHA 1WCMA 1TWCA 2BE5D 1SC7A 1IW7D 2Y0SA 1GE9A 3M4AA 3K58A 1TWGA 4F3EA 2E2IA 1EK8A 1Q8IA 4Q5VA 4O26A 4KDDA 1HQMD 1TL8A 4NOMA 2B9SB 1K4TA 1TWAA 3DU5A 1Y1VA 4AN8A 1I6VD 3GTLA 4FXDA 1R9TA 3KYLA 2B63A 4KB4A 4LMOA 2JA5A 1MIUA 3SJRA 1A36A 3GTQA 2NVYA 4Q5GA 4AYBA 2R92A 2YU9A 3CQZA 1IS1A 4AHCA 3LF9A 2JA7A 4GFQA 1Y1WA 3H0GA 3K5NA 2WAQA 2NVXA 3K57A 3GTPA 1SFOA 1R5ZA 4EJ3A 2O5JD 2CW0D 3WVOA 1YNJD 4KC6A 5C9HA 2A69D 1TWFA 2E2HA 1ISEA
chains in the Genus database with same CATH topology
1SMYD 1TGOA 1SEUA 1YNND 4IP8A 2PMZA 3DU6A 2R4GA 5JSBB 1WQFA 3K5OA 4KAWX 2A6HD 2A6ED 3IAYA 3GTGA 4C2MA 4FYDA 5MLC9 4KB2A 1A31A 1K83A 3HKZA 3GTMA 5CQGA 4D3YA 1EH1A 3FKIA 3K59A 3MAQA 1RRJA 3P9AA 2A68D 1RR8C 3K5MA 1Y698 2JA6A 1R49A 3LHPS 1WQHA 4FGUA 4L8IA 1I50A 4JLRC 2F4QA 2WB1A 4D3ZA 1LPQA 1ZYRD 1EJ9A 5JSNB 4NOKA 3GTOA 2VUMA 4H3TA 1T8IA 3GTJA 2R93A 1NH3A 4NOLA 3K5LA 3GTKA 4IP9A 1K4SA 4QCLA 2R7ZA 4QIWA 4OYDB 1A35A 1DD5A 1I3QA 1V9MA 1WQGA 1TWHA 1WCMA 1TWCA 2BE5D 1SC7A 1IW7D 2Y0SA 1GE9A 3M4AA 3K58A 1TWGA 4F3EA 2E2IA 1EK8A 1Q8IA 4Q5VA 4O26A 4KDDA 1HQMD 1TL8A 4NOMA 2B9SB 1K4TA 1TWAA 3DU5A 1Y1VA 4AN8A 1I6VD 3GTLA 4FXDA 1R9TA 3KYLA 2B63A 4KB4A 4LMOA 2JA5A 1MIUA 3SJRA 1A36A 3GTQA 2NVYA 4Q5GA 4AYBA 2R92A 2YU9A 3CQZA 1IS1A 4AHCA 3LF9A 2JA7A 4GFQA 1Y1WA 3H0GA 3K5NA 2WAQA 2NVXA 3K57A 3GTPA 1SFOA 1R5ZA 4EJ3A 2O5JD 2CW0D 3WVOA 1YNJD 4KC6A 5C9HA 2A69D 1TWFA 2E2HA 1ISEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LHP S;  1WQH A;  4L8I A;  4JLR C;  5JSB B;  1WQF A;  1GE9 A;  1IS1 A;  4KAW X;  3LF9 A;  5JSN B;  1EK8 A;  4GFQ A;  4KDD A;  5MLC 9;  4KB2 A;  4OYD B;  1EH1 A;  4KC6 A;  1DD5 A;  4KB4 A;  1WQG A;  1ISE A;  1Y69 8; 
#chains in the Genus database with same CATH topology
 1SMY D;  1TGO A;  1SEU A;  1YNN D;  4IP8 A;  2PMZ A;  3DU6 A;  2R4G A;  5JSB B;  1WQF A;  3K5O A;  4KAW X;  2A6H D;  2A6E D;  3IAY A;  3GTG A;  4C2M A;  4FYD A;  5MLC 9;  4KB2 A;  1A31 A;  1K83 A;  3HKZ A;  3GTM A;  5CQG A;  4D3Y A;  1EH1 A;  3FKI A;  3K59 A;  3MAQ A;  1RRJ A;  3P9A A;  2A68 D;  1RR8 C;  3K5M A;  1Y69 8;  2JA6 A;  1R49 A;  3LHP S;  1WQH A;  4FGU A;  4L8I A;  1I50 A;  4JLR C;  2F4Q A;  2WB1 A;  4D3Z A;  1LPQ A;  1ZYR D;  1EJ9 A;  5JSN B;  4NOK A;  3GTO A;  2VUM A;  4H3T A;  1T8I A;  3GTJ A;  2R93 A;  1NH3 A;  4NOL A;  3K5L A;  3GTK A;  4IP9 A;  1K4S A;  4QCL A;  2R7Z A;  4QIW A;  4OYD B;  1A35 A;  1DD5 A;  1I3Q A;  1V9M A;  1WQG A;  1TWH A;  1WCM A;  1TWC A;  2BE5 D;  1SC7 A;  1IW7 D;  2Y0S A;  1GE9 A;  3M4A A;  3K58 A;  1TWG A;  4F3E A;  2E2I A;  1EK8 A;  1Q8I A;  4Q5V A;  4O26 A;  4KDD A;  1HQM D;  1TL8 A;  4NOM A;  2B9S B;  1K4T A;  1TWA A;  3DU5 A;  1Y1V A;  4AN8 A;  1I6V D;  3GTL A;  4FXD A;  1R9T A;  3KYL A;  2B63 A;  4KB4 A;  4LMO A;  2JA5 A;  1MIU A;  3SJR A;  1A36 A;  3GTQ A;  2NVY A;  4Q5G A;  4AYB A;  2R92 A;  2YU9 A;  3CQZ A;  1IS1 A;  4AHC A;  3LF9 A;  2JA7 A;  4GFQ A;  1Y1W A;  3H0G A;  3K5N A;  2WAQ A;  2NVX A;  3K57 A;  3GTP A;  1SFO A;  1R5Z A;  4EJ3 A;  2O5J D;  2CW0 D;  3WVO A;  1YNJ D;  4KC6 A;  5C9H A;  2A69 D;  1TWF A;  2E2H A;  1ISE A; 
#chains in the Genus database with same CATH homology
 1SMY D;  1TGO A;  1SEU A;  1YNN D;  4IP8 A;  2PMZ A;  3DU6 A;  2R4G A;  5JSB B;  1WQF A;  3K5O A;  4KAW X;  2A6H D;  2A6E D;  3IAY A;  3GTG A;  4C2M A;  4FYD A;  5MLC 9;  4KB2 A;  1A31 A;  1K83 A;  3HKZ A;  3GTM A;  5CQG A;  4D3Y A;  1EH1 A;  3FKI A;  3K59 A;  3MAQ A;  1RRJ A;  3P9A A;  2A68 D;  1RR8 C;  3K5M A;  1Y69 8;  2JA6 A;  1R49 A;  3LHP S;  1WQH A;  4FGU A;  4L8I A;  1I50 A;  4JLR C;  2F4Q A;  2WB1 A;  4D3Z A;  1LPQ A;  1ZYR D;  1EJ9 A;  5JSN B;  4NOK A;  3GTO A;  2VUM A;  4H3T A;  1T8I A;  3GTJ A;  2R93 A;  1NH3 A;  4NOL A;  3K5L A;  3GTK A;  4IP9 A;  1K4S A;  4QCL A;  2R7Z A;  4QIW A;  4OYD B;  1A35 A;  1DD5 A;  1I3Q A;  1V9M A;  1WQG A;  1TWH A;  1WCM A;  1TWC A;  2BE5 D;  1SC7 A;  1IW7 D;  2Y0S A;  1GE9 A;  3M4A A;  3K58 A;  1TWG A;  4F3E A;  2E2I A;  1EK8 A;  1Q8I A;  4Q5V A;  4O26 A;  4KDD A;  1HQM D;  1TL8 A;  4NOM A;  2B9S B;  1K4T A;  1TWA A;  3DU5 A;  1Y1V A;  4AN8 A;  1I6V D;  3GTL A;  4FXD A;  1R9T A;  3KYL A;  2B63 A;  4KB4 A;  4LMO A;  2JA5 A;  1MIU A;  3SJR A;  1A36 A;  3GTQ A;  2NVY A;  4Q5G A;  4AYB A;  2R92 A;  2YU9 A;  3CQZ A;  1IS1 A;  4AHC A;  3LF9 A;  2JA7 A;  4GFQ A;  1Y1W A;  3H0G A;  3K5N A;  2WAQ A;  2NVX A;  3K57 A;  3GTP A;  1SFO A;  1R5Z A;  4EJ3 A;  2O5J D;  2CW0 D;  3WVO A;  1YNJ D;  4KC6 A;  5C9H A;  2A69 D;  1TWF A;  2E2H A;  1ISE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...