4OYDB

Crystal structure of a computationally designed inhibitor of an epstein-barr viral bcl-2 protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
117
structure length
117
Chain Sequence
b'ADPKKVLDKAKDQAENRVRELKQKLEELYKEARKLDLTQEMRRKLELRYIAAMLMAIGDIYNAIRQAKQEADKLKKAGLVNSQQLDELKRRLEELKEEASRKARDYGREFQLKLEYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis regulator BHRF1
publication title A computationally designed inhibitor of an epstein-barr viral bcl-2 protein induces apoptosis in infected cells.
pubmed doi rcsb
source organism Epstein-barr virus
molecule tags Viral protein/inhibitor
total genus 53
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4oydB00
4L8IA 4OYDB 4JLRC 1EK8A 4KB4A 1WQHA 4KC6A 4KAWX 5MLC9 4KB2A 4GFQA 1WQGA 1Y698 1ISEA 3LHPS 1DD5A 1WQFA 1IS1A 5JSNB 5JSBB 4KDDA 1GE9A 3LF9A 1EH1A
chains in the Genus database with same CATH superfamily
1ZYRD 1SFOA 1TWFA 3SJRA 1TWHA 1K4TA 1TWGA 2PMZA 3P9AA 4KAWX 2R4GA 2A69D 2NVYA 1I6VD 1R5ZA 4KB2A 4FXDA 1YNND 4FYDA 3K5LA 1Q8IA 1SMYD 2A6HD 3MAQA 2CW0D 3K5OA 2NVXA 4AYBA 3DU6A 2BE5D 3GTQA 2E2IA 1T8IA 4FGUA 1GE9A 5C9HA 3LF9A 3GTPA 4D3YA 4NOMA 4C2MA 4L8IA 3GTJA 4OYDB 4JLRC 3H0GA 4D3ZA 4KB4A 3KYLA 4QCLA 1K4SA 1WQHA 3CQZA 4AN8A 4KC6A 1RRJA 4QIWA 2A6ED 2VUMA 3M4AA 1A35A 1TWAA 3IAYA 4F3EA 1MIUA 1A36A 3K59A 1WCMA 1YNJD 2YU9A 2JA6A 4AHCA 4NOKA 1TWCA 4KDDA 1SEUA 2F4QA 1I50A 1Y1WA 1R49A 3K5MA 4EJ3A 2E2HA 3WVOA 1TL8A 3HKZA 1V9MA 5CQGA 2Y0SA 4Q5GA 4H3TA 4IP9A 2WAQA 4GFQA 4Q5VA 3GTLA 4LMOA 4O26A 1K83A 1RR8C 1WQGA 1EJ9A 3DU5A 1ISEA 1R9TA 1I3QA 3K57A 1A31A 2R93A 4NOLA 3GTMA 3GTOA 3K58A 2WB1A 2JA7A 3K5NA 4IP8A 1IW7D 1NH3A 2JA5A 1EK8A 2B9SB 3FKIA 5MLC9 2A68D 2R92A 1TGOA 1LPQA 1Y698 2O5JD 1Y1VA 3GTKA 3LHPS 2B63A 1SC7A 1DD5A 1WQFA 1IS1A 3GTGA 5JSNB 1HQMD 5JSBB 2R7ZA 1EH1A
chains in the Genus database with same CATH topology
1ZYRD 1SFOA 1TWFA 3SJRA 1TWHA 1K4TA 1TWGA 2PMZA 3P9AA 4KAWX 2R4GA 2A69D 2NVYA 1I6VD 1R5ZA 4KB2A 4FXDA 1YNND 4FYDA 3K5LA 1Q8IA 1SMYD 2A6HD 3MAQA 2CW0D 3K5OA 2NVXA 4AYBA 3DU6A 2BE5D 3GTQA 2E2IA 1T8IA 4FGUA 1GE9A 5C9HA 3LF9A 3GTPA 4D3YA 4NOMA 4C2MA 4L8IA 3GTJA 4OYDB 4JLRC 3H0GA 4D3ZA 4KB4A 3KYLA 4QCLA 1K4SA 1WQHA 3CQZA 4AN8A 4KC6A 1RRJA 4QIWA 2A6ED 2VUMA 3M4AA 1A35A 1TWAA 3IAYA 4F3EA 1MIUA 1A36A 3K59A 1WCMA 1YNJD 2YU9A 2JA6A 4AHCA 4NOKA 1TWCA 4KDDA 1SEUA 2F4QA 1I50A 1Y1WA 1R49A 3K5MA 4EJ3A 2E2HA 3WVOA 1TL8A 3HKZA 1V9MA 5CQGA 2Y0SA 4Q5GA 4H3TA 4IP9A 2WAQA 4GFQA 4Q5VA 3GTLA 4LMOA 4O26A 1K83A 1RR8C 1WQGA 1EJ9A 3DU5A 1ISEA 1R9TA 1I3QA 3K57A 1A31A 2R93A 4NOLA 3GTMA 3GTOA 3K58A 2WB1A 2JA7A 3K5NA 4IP8A 1IW7D 1NH3A 2JA5A 1EK8A 2B9SB 3FKIA 5MLC9 2A68D 2R92A 1TGOA 1LPQA 1Y698 2O5JD 1Y1VA 3GTKA 3LHPS 2B63A 1SC7A 1DD5A 1WQFA 1IS1A 3GTGA 5JSNB 1HQMD 5JSBB 2R7ZA 1EH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8I A;  4OYD B;  4JLR C;  1EK8 A;  4KB4 A;  1WQH A;  4KC6 A;  4KAW X;  5MLC 9;  4KB2 A;  4GFQ A;  1WQG A;  1Y69 8;  1ISE A;  3LHP S;  1DD5 A;  1WQF A;  1IS1 A;  5JSN B;  5JSB B;  4KDD A;  1GE9 A;  3LF9 A;  1EH1 A; 
#chains in the Genus database with same CATH topology
 1ZYR D;  1SFO A;  1TWF A;  3SJR A;  1TWH A;  1K4T A;  1TWG A;  2PMZ A;  3P9A A;  4KAW X;  2R4G A;  2A69 D;  2NVY A;  1I6V D;  1R5Z A;  4KB2 A;  4FXD A;  1YNN D;  4FYD A;  3K5L A;  1Q8I A;  1SMY D;  2A6H D;  3MAQ A;  2CW0 D;  3K5O A;  2NVX A;  4AYB A;  3DU6 A;  2BE5 D;  3GTQ A;  2E2I A;  1T8I A;  4FGU A;  1GE9 A;  5C9H A;  3LF9 A;  3GTP A;  4D3Y A;  4NOM A;  4C2M A;  4L8I A;  3GTJ A;  4OYD B;  4JLR C;  3H0G A;  4D3Z A;  4KB4 A;  3KYL A;  4QCL A;  1K4S A;  1WQH A;  3CQZ A;  4AN8 A;  4KC6 A;  1RRJ A;  4QIW A;  2A6E D;  2VUM A;  3M4A A;  1A35 A;  1TWA A;  3IAY A;  4F3E A;  1MIU A;  1A36 A;  3K59 A;  1WCM A;  1YNJ D;  2YU9 A;  2JA6 A;  4AHC A;  4NOK A;  1TWC A;  4KDD A;  1SEU A;  2F4Q A;  1I50 A;  1Y1W A;  1R49 A;  3K5M A;  4EJ3 A;  2E2H A;  3WVO A;  1TL8 A;  3HKZ A;  1V9M A;  5CQG A;  2Y0S A;  4Q5G A;  4H3T A;  4IP9 A;  2WAQ A;  4GFQ A;  4Q5V A;  3GTL A;  4LMO A;  4O26 A;  1K83 A;  1RR8 C;  1WQG A;  1EJ9 A;  3DU5 A;  1ISE A;  1R9T A;  1I3Q A;  3K57 A;  1A31 A;  2R93 A;  4NOL A;  3GTM A;  3GTO A;  3K58 A;  2WB1 A;  2JA7 A;  3K5N A;  4IP8 A;  1IW7 D;  1NH3 A;  2JA5 A;  1EK8 A;  2B9S B;  3FKI A;  5MLC 9;  2A68 D;  2R92 A;  1TGO A;  1LPQ A;  1Y69 8;  2O5J D;  1Y1V A;  3GTK A;  3LHP S;  2B63 A;  1SC7 A;  1DD5 A;  1WQF A;  1IS1 A;  3GTG A;  5JSN B;  1HQM D;  5JSB B;  2R7Z A;  1EH1 A; 
#chains in the Genus database with same CATH homology
 1ZYR D;  1SFO A;  1TWF A;  3SJR A;  1TWH A;  1K4T A;  1TWG A;  2PMZ A;  3P9A A;  4KAW X;  2R4G A;  2A69 D;  2NVY A;  1I6V D;  1R5Z A;  4KB2 A;  4FXD A;  1YNN D;  4FYD A;  3K5L A;  1Q8I A;  1SMY D;  2A6H D;  3MAQ A;  2CW0 D;  3K5O A;  2NVX A;  4AYB A;  3DU6 A;  2BE5 D;  3GTQ A;  2E2I A;  1T8I A;  4FGU A;  1GE9 A;  5C9H A;  3LF9 A;  3GTP A;  4D3Y A;  4NOM A;  4C2M A;  4L8I A;  3GTJ A;  4OYD B;  4JLR C;  3H0G A;  4D3Z A;  4KB4 A;  3KYL A;  4QCL A;  1K4S A;  1WQH A;  3CQZ A;  4AN8 A;  4KC6 A;  1RRJ A;  4QIW A;  2A6E D;  2VUM A;  3M4A A;  1A35 A;  1TWA A;  3IAY A;  4F3E A;  1MIU A;  1A36 A;  3K59 A;  1WCM A;  1YNJ D;  2YU9 A;  2JA6 A;  4AHC A;  4NOK A;  1TWC A;  4KDD A;  1SEU A;  2F4Q A;  1I50 A;  1Y1W A;  1R49 A;  3K5M A;  4EJ3 A;  2E2H A;  3WVO A;  1TL8 A;  3HKZ A;  1V9M A;  5CQG A;  2Y0S A;  4Q5G A;  4H3T A;  4IP9 A;  2WAQ A;  4GFQ A;  4Q5V A;  3GTL A;  4LMO A;  4O26 A;  1K83 A;  1RR8 C;  1WQG A;  1EJ9 A;  3DU5 A;  1ISE A;  1R9T A;  1I3Q A;  3K57 A;  1A31 A;  2R93 A;  4NOL A;  3GTM A;  3GTO A;  3K58 A;  2WB1 A;  2JA7 A;  3K5N A;  4IP8 A;  1IW7 D;  1NH3 A;  2JA5 A;  1EK8 A;  2B9S B;  3FKI A;  5MLC 9;  2A68 D;  2R92 A;  1TGO A;  1LPQ A;  1Y69 8;  2O5J D;  1Y1V A;  3GTK A;  3LHP S;  2B63 A;  1SC7 A;  1DD5 A;  1WQF A;  1IS1 A;  3GTG A;  5JSN B;  1HQM D;  5JSB B;  2R7Z A;  1EH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...