4OYDB

Crystal structure of a computationally designed inhibitor of an epstein-barr viral bcl-2 protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
117
structure length
117
Chain Sequence
ADPKKVLDKAKDQAENRVRELKQKLEELYKEARKLDLTQEMRRKLELRYIAAMLMAIGDIYNAIRQAKQEADKLKKAGLVNSQQLDELKRRLEELKEEASRKARDYGREFQLKLEYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A computationally designed inhibitor of an epstein-barr viral bcl-2 protein induces apoptosis in infected cells.
pubmed doi rcsb
source organism Epstein-barr virus
molecule tags Viral protein/inhibitor
molecule keywords Apoptosis regulator BHRF1
total genus 53
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4oydB00
1WQGA 1GE9A 1Y698 1DD5A 4JLRC 4KDDA 1IS1A 1EH1A 5JSNB 1WQFA 4KAWX 5MLC9 4KB4A 4KC6A 5JSBB 4OYDB 4KB2A 3LF9A 4L8IA 1WQHA 1EK8A 3LHPS 1ISEA 4GFQA
chains in the Genus database with same CATH superfamily
2PMZA 4NOLA 2Y0SA 1IW7D 1I6VD 1GE9A 1Y698 2R7ZA 4Q5GA 4D3ZA 3GTMA 5CQGA 3GTJA 2NVXA 3M4AA 2B63A 1EH1A 3SJRA 1K4TA 5JSNB 1V9MA 1K4SA 3GTPA 1YNJD 4FXDA 1R49A 4EJ3A 3K5OA 2CW0D 3LF9A 1TWHA 4LMOA 4H3TA 1EK8A 2A6HD 1A35A 2WAQA 4GFQA 4IP9A 1WQGA 1HQMD 2BE5D 3K59A 2JA5A 3GTLA 2R93A 1I3QA 2E2IA 3DU6A 1TWAA 1R5ZA 2A69D 4O26A 2VUMA 4F3EA 3GTKA 1TL8A 2A6ED 1A31A 3P9AA 3K5MA 4KAWX 1TWGA 4QCLA 4KB4A 4KC6A 5JSBB 3MAQA 4OYDB 2E2HA 3K5LA 1I50A 3IAYA 3HKZA 3GTOA 4NOKA 1R9TA 3LHPS 2R92A 3GTQA 3WVOA 1Y1VA 1ZYRD 1Q8IA 4IP8A 4Q5VA 3GTGA 1WCMA 4C2MA 4D3YA 1DD5A 4JLRC 4KDDA 1Y1WA 3K5NA 1SFOA 1RRJA 2O5JD 3K57A 1TWFA 4FGUA 1YNND 4KB2A 4NOMA 1SEUA 2R4GA 1WQHA 2B9SB 3FKIA 1EJ9A 1ISEA 1K83A 4AN8A 1SMYD 3DU5A 2A68D 4AHCA 2JA6A 1SC7A 1NH3A 1T8IA 4QIWA 3CQZA 1TGOA 3K58A 5C9HA 1IS1A 1MIUA 2NVYA 2WB1A 1WQFA 1LPQA 2F4QA 5MLC9 1A36A 4FYDA 4AYBA 4L8IA 3KYLA 2YU9A 1RR8C 2JA7A 3H0GA 1TWCA
chains in the Genus database with same CATH topology
2PMZA 4NOLA 2Y0SA 1IW7D 1I6VD 1GE9A 1Y698 2R7ZA 4Q5GA 4D3ZA 3GTMA 5CQGA 3GTJA 2NVXA 3M4AA 2B63A 1EH1A 3SJRA 1K4TA 5JSNB 1V9MA 1K4SA 3GTPA 1YNJD 4FXDA 1R49A 4EJ3A 3K5OA 2CW0D 3LF9A 1TWHA 4LMOA 4H3TA 1EK8A 2A6HD 1A35A 2WAQA 4GFQA 4IP9A 1WQGA 1HQMD 2BE5D 3K59A 2JA5A 3GTLA 2R93A 1I3QA 2E2IA 3DU6A 1TWAA 1R5ZA 2A69D 4O26A 2VUMA 4F3EA 3GTKA 1TL8A 2A6ED 1A31A 3P9AA 3K5MA 4KAWX 1TWGA 4QCLA 4KB4A 4KC6A 5JSBB 3MAQA 4OYDB 2E2HA 3K5LA 1I50A 3IAYA 3HKZA 3GTOA 4NOKA 1R9TA 3LHPS 2R92A 3GTQA 3WVOA 1Y1VA 1ZYRD 1Q8IA 4IP8A 4Q5VA 3GTGA 1WCMA 4C2MA 4D3YA 1DD5A 4JLRC 4KDDA 1Y1WA 3K5NA 1SFOA 1RRJA 2O5JD 3K57A 1TWFA 4FGUA 1YNND 4KB2A 4NOMA 1SEUA 2R4GA 1WQHA 2B9SB 3FKIA 1EJ9A 1ISEA 1K83A 4AN8A 1SMYD 3DU5A 2A68D 4AHCA 2JA6A 1SC7A 1NH3A 1T8IA 4QIWA 3CQZA 1TGOA 3K58A 5C9HA 1IS1A 1MIUA 2NVYA 2WB1A 1WQFA 1LPQA 2F4QA 5MLC9 1A36A 4FYDA 4AYBA 4L8IA 3KYLA 2YU9A 1RR8C 2JA7A 3H0GA 1TWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQG A;  1GE9 A;  1Y69 8;  1DD5 A;  4JLR C;  4KDD A;  1IS1 A;  1EH1 A;  5JSN B;  1WQF A;  4KAW X;  5MLC 9;  4KB4 A;  4KC6 A;  5JSB B;  4OYD B;  4KB2 A;  3LF9 A;  4L8I A;  1WQH A;  1EK8 A;  3LHP S;  1ISE A;  4GFQ A; 
#chains in the Genus database with same CATH topology
 2PMZ A;  4NOL A;  2Y0S A;  1IW7 D;  1I6V D;  1GE9 A;  1Y69 8;  2R7Z A;  4Q5G A;  4D3Z A;  3GTM A;  5CQG A;  3GTJ A;  2NVX A;  3M4A A;  2B63 A;  1EH1 A;  3SJR A;  1K4T A;  5JSN B;  1V9M A;  1K4S A;  3GTP A;  1YNJ D;  4FXD A;  1R49 A;  4EJ3 A;  3K5O A;  2CW0 D;  3LF9 A;  1TWH A;  4LMO A;  4H3T A;  1EK8 A;  2A6H D;  1A35 A;  2WAQ A;  4GFQ A;  4IP9 A;  1WQG A;  1HQM D;  2BE5 D;  3K59 A;  2JA5 A;  3GTL A;  2R93 A;  1I3Q A;  2E2I A;  3DU6 A;  1TWA A;  1R5Z A;  2A69 D;  4O26 A;  2VUM A;  4F3E A;  3GTK A;  1TL8 A;  2A6E D;  1A31 A;  3P9A A;  3K5M A;  4KAW X;  1TWG A;  4QCL A;  4KB4 A;  4KC6 A;  5JSB B;  3MAQ A;  4OYD B;  2E2H A;  3K5L A;  1I50 A;  3IAY A;  3HKZ A;  3GTO A;  4NOK A;  1R9T A;  3LHP S;  2R92 A;  3GTQ A;  3WVO A;  1Y1V A;  1ZYR D;  1Q8I A;  4IP8 A;  4Q5V A;  3GTG A;  1WCM A;  4C2M A;  4D3Y A;  1DD5 A;  4JLR C;  4KDD A;  1Y1W A;  3K5N A;  1SFO A;  1RRJ A;  2O5J D;  3K57 A;  1TWF A;  4FGU A;  1YNN D;  4KB2 A;  4NOM A;  1SEU A;  2R4G A;  1WQH A;  2B9S B;  3FKI A;  1EJ9 A;  1ISE A;  1K83 A;  4AN8 A;  1SMY D;  3DU5 A;  2A68 D;  4AHC A;  2JA6 A;  1SC7 A;  1NH3 A;  1T8I A;  4QIW A;  3CQZ A;  1TGO A;  3K58 A;  5C9H A;  1IS1 A;  1MIU A;  2NVY A;  2WB1 A;  1WQF A;  1LPQ A;  2F4Q A;  5MLC 9;  1A36 A;  4FYD A;  4AYB A;  4L8I A;  3KYL A;  2YU9 A;  1RR8 C;  2JA7 A;  3H0G A;  1TWC A; 
#chains in the Genus database with same CATH homology
 2PMZ A;  4NOL A;  2Y0S A;  1IW7 D;  1I6V D;  1GE9 A;  1Y69 8;  2R7Z A;  4Q5G A;  4D3Z A;  3GTM A;  5CQG A;  3GTJ A;  2NVX A;  3M4A A;  2B63 A;  1EH1 A;  3SJR A;  1K4T A;  5JSN B;  1V9M A;  1K4S A;  3GTP A;  1YNJ D;  4FXD A;  1R49 A;  4EJ3 A;  3K5O A;  2CW0 D;  3LF9 A;  1TWH A;  4LMO A;  4H3T A;  1EK8 A;  2A6H D;  1A35 A;  2WAQ A;  4GFQ A;  4IP9 A;  1WQG A;  1HQM D;  2BE5 D;  3K59 A;  2JA5 A;  3GTL A;  2R93 A;  1I3Q A;  2E2I A;  3DU6 A;  1TWA A;  1R5Z A;  2A69 D;  4O26 A;  2VUM A;  4F3E A;  3GTK A;  1TL8 A;  2A6E D;  1A31 A;  3P9A A;  3K5M A;  4KAW X;  1TWG A;  4QCL A;  4KB4 A;  4KC6 A;  5JSB B;  3MAQ A;  4OYD B;  2E2H A;  3K5L A;  1I50 A;  3IAY A;  3HKZ A;  3GTO A;  4NOK A;  1R9T A;  3LHP S;  2R92 A;  3GTQ A;  3WVO A;  1Y1V A;  1ZYR D;  1Q8I A;  4IP8 A;  4Q5V A;  3GTG A;  1WCM A;  4C2M A;  4D3Y A;  1DD5 A;  4JLR C;  4KDD A;  1Y1W A;  3K5N A;  1SFO A;  1RRJ A;  2O5J D;  3K57 A;  1TWF A;  4FGU A;  1YNN D;  4KB2 A;  4NOM A;  1SEU A;  2R4G A;  1WQH A;  2B9S B;  3FKI A;  1EJ9 A;  1ISE A;  1K83 A;  4AN8 A;  1SMY D;  3DU5 A;  2A68 D;  4AHC A;  2JA6 A;  1SC7 A;  1NH3 A;  1T8I A;  4QIW A;  3CQZ A;  1TGO A;  3K58 A;  5C9H A;  1IS1 A;  1MIU A;  2NVY A;  2WB1 A;  1WQF A;  1LPQ A;  2F4Q A;  5MLC 9;  1A36 A;  4FYD A;  4AYB A;  4L8I A;  3KYL A;  2YU9 A;  1RR8 C;  2JA7 A;  3H0G A;  1TWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...