5JSBB

Crystal structure of mcl1-inhibitor complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
116
structure length
116
Chain Sequence
DPKKVLDKAKDQAENRVRELKQVLEELYKEARKLDLTQEMRKKLIERYAAAIIRAIGDINNAIYQAKQEAEKLKKAGLVNSQQLDELLRRLDELQKEASRKANEYGREFELKLEYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Induced myeloid leukemia cell differentiation protein Mcl-1
publication title Computationally designed high specificity inhibitors delineate the roles of BCL2 family proteins in cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/inhibitor
total genus 50
structure length 116
sequence length 116
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2016-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 5jsbB00
1EH1A 4KC6A 4KAWX 4GFQA 4KDDA 1GE9A 3LF9A 4L8IA 1Y698 4OYDB 1WQGA 3LHPS 5JSNB 5MLC9 4JLRC 1ISEA 1IS1A 1DD5A 4KB4A 1EK8A 4KB2A 1WQHA 1WQFA 5JSBB
chains in the Genus database with same CATH superfamily
2Y0SA 4KAWX 2R7ZA 1IW7D 4IP9A 1GE9A 2A69D 3LF9A 1Y698 3HKZA 2A6ED 1T8IA 2JA5A 2A68D 4QCLA 4JLRC 2B9SB 3DU5A 1R49A 1Y1WA 3GTMA 4NOLA 4Q5GA 3P9AA 3K5LA 1EK8A 2A6HD 1WQHA 3FKIA 3DU6A 2R92A 1SMYD 3K59A 3GTLA 1A31A 3GTOA 1EJ9A 4D3ZA 1I3QA 4KC6A 2E2HA 1TWHA 1Y1VA 4AN8A 1I6VD 4AHCA 1NH3A 3GTKA 1K4SA 3GTPA 2O5JD 4IP8A 4OYDB 2BE5D 4F3EA 3LHPS 4FYDA 2JA7A 4NOMA 1ISEA 1K4TA 3CQZA 4NOKA 1I50A 1MIUA 1HQMD 2WB1A 1V9MA 3SJRA 1DD5A 3GTQA 2VUMA 1SFOA 5JSBB 4EJ3A 1EH1A 4GFQA 4QIWA 2NVYA 1R5ZA 2JA6A 3K5NA 4L8IA 1R9TA 4FGUA 3K58A 3K5OA 3H0GA 3MAQA 5MLC9 1WCMA 1A35A 1Q8IA 1TL8A 4AYBA 4LMOA 1IS1A 3K5MA 3K57A 4Q5VA 2R4GA 2F4QA 3GTJA 4KB2A 2B63A 1RRJA 4FXDA 4D3YA 3M4AA 1ZYRD 1TWCA 1TWGA 4KDDA 1TWAA 3GTGA 2YU9A 1LPQA 1K83A 1TWFA 2WAQA 1WQGA 5CQGA 5JSNB 2R93A 1SC7A 5C9HA 2CW0D 2PMZA 3IAYA 2NVXA 1YNND 1SEUA 3WVOA 4O26A 4KB4A 4C2MA 1RR8C 1A36A 3KYLA 1TGOA 4H3TA 2E2IA 1WQFA 1YNJD
chains in the Genus database with same CATH topology
2Y0SA 4KAWX 2R7ZA 1IW7D 4IP9A 1GE9A 2A69D 3LF9A 1Y698 3HKZA 2A6ED 1T8IA 2JA5A 2A68D 4QCLA 4JLRC 2B9SB 3DU5A 1R49A 1Y1WA 3GTMA 4NOLA 4Q5GA 3P9AA 3K5LA 1EK8A 2A6HD 1WQHA 3FKIA 3DU6A 2R92A 1SMYD 3K59A 3GTLA 1A31A 3GTOA 1EJ9A 4D3ZA 1I3QA 4KC6A 2E2HA 1TWHA 1Y1VA 4AN8A 1I6VD 4AHCA 1NH3A 3GTKA 1K4SA 3GTPA 2O5JD 4IP8A 4OYDB 2BE5D 4F3EA 3LHPS 4FYDA 2JA7A 4NOMA 1ISEA 1K4TA 3CQZA 4NOKA 1I50A 1MIUA 1HQMD 2WB1A 1V9MA 3SJRA 1DD5A 3GTQA 2VUMA 1SFOA 5JSBB 4EJ3A 1EH1A 4GFQA 4QIWA 2NVYA 1R5ZA 2JA6A 3K5NA 4L8IA 1R9TA 4FGUA 3K58A 3K5OA 3H0GA 3MAQA 5MLC9 1WCMA 1A35A 1Q8IA 1TL8A 4AYBA 4LMOA 1IS1A 3K5MA 3K57A 4Q5VA 2R4GA 2F4QA 3GTJA 4KB2A 2B63A 1RRJA 4FXDA 4D3YA 3M4AA 1ZYRD 1TWCA 1TWGA 4KDDA 1TWAA 3GTGA 2YU9A 1LPQA 1K83A 1TWFA 2WAQA 1WQGA 5CQGA 5JSNB 2R93A 1SC7A 5C9HA 2CW0D 2PMZA 3IAYA 2NVXA 1YNND 1SEUA 3WVOA 4O26A 4KB4A 4C2MA 1RR8C 1A36A 3KYLA 1TGOA 4H3TA 2E2IA 1WQFA 1YNJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH1 A;  4KC6 A;  4KAW X;  4GFQ A;  4KDD A;  1GE9 A;  3LF9 A;  4L8I A;  1Y69 8;  4OYD B;  1WQG A;  3LHP S;  5JSN B;  5MLC 9;  4JLR C;  1ISE A;  1IS1 A;  1DD5 A;  4KB4 A;  1EK8 A;  4KB2 A;  1WQH A;  1WQF A;  5JSB B; 
#chains in the Genus database with same CATH topology
 2Y0S A;  4KAW X;  2R7Z A;  1IW7 D;  4IP9 A;  1GE9 A;  2A69 D;  3LF9 A;  1Y69 8;  3HKZ A;  2A6E D;  1T8I A;  2JA5 A;  2A68 D;  4QCL A;  4JLR C;  2B9S B;  3DU5 A;  1R49 A;  1Y1W A;  3GTM A;  4NOL A;  4Q5G A;  3P9A A;  3K5L A;  1EK8 A;  2A6H D;  1WQH A;  3FKI A;  3DU6 A;  2R92 A;  1SMY D;  3K59 A;  3GTL A;  1A31 A;  3GTO A;  1EJ9 A;  4D3Z A;  1I3Q A;  4KC6 A;  2E2H A;  1TWH A;  1Y1V A;  4AN8 A;  1I6V D;  4AHC A;  1NH3 A;  3GTK A;  1K4S A;  3GTP A;  2O5J D;  4IP8 A;  4OYD B;  2BE5 D;  4F3E A;  3LHP S;  4FYD A;  2JA7 A;  4NOM A;  1ISE A;  1K4T A;  3CQZ A;  4NOK A;  1I50 A;  1MIU A;  1HQM D;  2WB1 A;  1V9M A;  3SJR A;  1DD5 A;  3GTQ A;  2VUM A;  1SFO A;  5JSB B;  4EJ3 A;  1EH1 A;  4GFQ A;  4QIW A;  2NVY A;  1R5Z A;  2JA6 A;  3K5N A;  4L8I A;  1R9T A;  4FGU A;  3K58 A;  3K5O A;  3H0G A;  3MAQ A;  5MLC 9;  1WCM A;  1A35 A;  1Q8I A;  1TL8 A;  4AYB A;  4LMO A;  1IS1 A;  3K5M A;  3K57 A;  4Q5V A;  2R4G A;  2F4Q A;  3GTJ A;  4KB2 A;  2B63 A;  1RRJ A;  4FXD A;  4D3Y A;  3M4A A;  1ZYR D;  1TWC A;  1TWG A;  4KDD A;  1TWA A;  3GTG A;  2YU9 A;  1LPQ A;  1K83 A;  1TWF A;  2WAQ A;  1WQG A;  5CQG A;  5JSN B;  2R93 A;  1SC7 A;  5C9H A;  2CW0 D;  2PMZ A;  3IAY A;  2NVX A;  1YNN D;  1SEU A;  3WVO A;  4O26 A;  4KB4 A;  4C2M A;  1RR8 C;  1A36 A;  3KYL A;  1TGO A;  4H3T A;  2E2I A;  1WQF A;  1YNJ D; 
#chains in the Genus database with same CATH homology
 2Y0S A;  4KAW X;  2R7Z A;  1IW7 D;  4IP9 A;  1GE9 A;  2A69 D;  3LF9 A;  1Y69 8;  3HKZ A;  2A6E D;  1T8I A;  2JA5 A;  2A68 D;  4QCL A;  4JLR C;  2B9S B;  3DU5 A;  1R49 A;  1Y1W A;  3GTM A;  4NOL A;  4Q5G A;  3P9A A;  3K5L A;  1EK8 A;  2A6H D;  1WQH A;  3FKI A;  3DU6 A;  2R92 A;  1SMY D;  3K59 A;  3GTL A;  1A31 A;  3GTO A;  1EJ9 A;  4D3Z A;  1I3Q A;  4KC6 A;  2E2H A;  1TWH A;  1Y1V A;  4AN8 A;  1I6V D;  4AHC A;  1NH3 A;  3GTK A;  1K4S A;  3GTP A;  2O5J D;  4IP8 A;  4OYD B;  2BE5 D;  4F3E A;  3LHP S;  4FYD A;  2JA7 A;  4NOM A;  1ISE A;  1K4T A;  3CQZ A;  4NOK A;  1I50 A;  1MIU A;  1HQM D;  2WB1 A;  1V9M A;  3SJR A;  1DD5 A;  3GTQ A;  2VUM A;  1SFO A;  5JSB B;  4EJ3 A;  1EH1 A;  4GFQ A;  4QIW A;  2NVY A;  1R5Z A;  2JA6 A;  3K5N A;  4L8I A;  1R9T A;  4FGU A;  3K58 A;  3K5O A;  3H0G A;  3MAQ A;  5MLC 9;  1WCM A;  1A35 A;  1Q8I A;  1TL8 A;  4AYB A;  4LMO A;  1IS1 A;  3K5M A;  3K57 A;  4Q5V A;  2R4G A;  2F4Q A;  3GTJ A;  4KB2 A;  2B63 A;  1RRJ A;  4FXD A;  4D3Y A;  3M4A A;  1ZYR D;  1TWC A;  1TWG A;  4KDD A;  1TWA A;  3GTG A;  2YU9 A;  1LPQ A;  1K83 A;  1TWF A;  2WAQ A;  1WQG A;  5CQG A;  5JSN B;  2R93 A;  1SC7 A;  5C9H A;  2CW0 D;  2PMZ A;  3IAY A;  2NVX A;  1YNN D;  1SEU A;  3WVO A;  4O26 A;  4KB4 A;  4C2M A;  1RR8 C;  1A36 A;  3KYL A;  1TGO A;  4H3T A;  2E2I A;  1WQF A;  1YNJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...