5JSBB

Crystal structure of mcl1-inhibitor complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
116
structure length
116
Chain Sequence
DPKKVLDKAKDQAENRVRELKQVLEELYKEARKLDLTQEMRKKLIERYAAAIIRAIGDINNAIYQAKQEAEKLKKAGLVNSQQLDELLRRLDELQKEASRKANEYGREFELKLEYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally designed high specificity inhibitors delineate the roles of BCL2 family proteins in cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/inhibitor
molecule keywords Induced myeloid leukemia cell differentiation protein Mcl-1
total genus 50
structure length 116
sequence length 116
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2016-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 5jsbB00
4KDDA 1DD5A 1EK8A 4KC6A 3LF9A 1Y698 4JLRC 1WQGA 3LHPS 1ISEA 4KAWX 4L8IA 4KB2A 5MLC9 4GFQA 5JSBB 5JSNB 1EH1A 4OYDB 1WQFA 4KB4A 1IS1A 1WQHA 1GE9A
chains in the Genus database with same CATH superfamily
4KDDA 1TWCA 3K58A 3GTPA 1WQGA 4L8IA 2JA7A 1TWHA 4EJ3A 3K5LA 1R9TA 2NVYA 4NOLA 1NH3A 3GTMA 2R7ZA 1YNND 1TWGA 1MIUA 4Q5VA 1K83A 5JSBB 3GTJA 1RRJA 3M4AA 1EH1A 3GTQA 2VUMA 4KB4A 4IP8A 1GE9A 1TWFA 2E2IA 1DD5A 4AN8A 1T8IA 3K57A 2JA5A 3K5MA 4D3ZA 2CW0D 1Y1VA 2E2HA 4FYDA 2NVXA 1K4SA 4FGUA 2A69D 5MLC9 1TGOA 5JSNB 4QCLA 1A36A 4C2MA 1A31A 1IS1A 2B63A 3MAQA 1WQHA 3IAYA 1V9MA 1EK8A 2PMZA 3GTOA 3KYLA 1YNJD 1K4TA 5C9HA 1Q8IA 3WVOA 4JLRC 4O26A 2R4GA 3LHPS 3P9AA 3FKIA 3HKZA 3CQZA 1SFOA 4H3TA 2WAQA 4Q5GA 1EJ9A 1HQMD 1R49A 1LPQA 1I3QA 4KB2A 2R92A 4LMOA 2Y0SA 1A35A 1I50A 3GTLA 4GFQA 1IW7D 1WQFA 1ZYRD 2B9SB 2A6HD 1TWAA 2WB1A 3K59A 1TL8A 1SC7A 4FXDA 4KC6A 4F3EA 3LF9A 2R93A 4NOMA 1Y698 2A68D 4D3YA 1ISEA 4KAWX 1WCMA 3DU5A 1SEUA 2BE5D 3GTKA 2O5JD 2A6ED 1RR8C 1Y1WA 5CQGA 2JA6A 1R5ZA 4AHCA 3K5NA 3GTGA 2F4QA 4OYDB 3SJRA 2YU9A 4AYBA 3H0GA 4NOKA 3DU6A 3K5OA 4QIWA 4IP9A 1I6VD 1SMYD
chains in the Genus database with same CATH topology
4KDDA 1TWCA 3K58A 3GTPA 1WQGA 4L8IA 2JA7A 1TWHA 4EJ3A 3K5LA 1R9TA 2NVYA 4NOLA 1NH3A 3GTMA 2R7ZA 1YNND 1TWGA 1MIUA 4Q5VA 1K83A 5JSBB 3GTJA 1RRJA 3M4AA 1EH1A 3GTQA 2VUMA 4KB4A 4IP8A 1GE9A 1TWFA 2E2IA 1DD5A 4AN8A 1T8IA 3K57A 2JA5A 3K5MA 4D3ZA 2CW0D 1Y1VA 2E2HA 4FYDA 2NVXA 1K4SA 4FGUA 2A69D 5MLC9 1TGOA 5JSNB 4QCLA 1A36A 4C2MA 1A31A 1IS1A 2B63A 3MAQA 1WQHA 3IAYA 1V9MA 1EK8A 2PMZA 3GTOA 3KYLA 1YNJD 1K4TA 5C9HA 1Q8IA 3WVOA 4JLRC 4O26A 2R4GA 3LHPS 3P9AA 3FKIA 3HKZA 3CQZA 1SFOA 4H3TA 2WAQA 4Q5GA 1EJ9A 1HQMD 1R49A 1LPQA 1I3QA 4KB2A 2R92A 4LMOA 2Y0SA 1A35A 1I50A 3GTLA 4GFQA 1IW7D 1WQFA 1ZYRD 2B9SB 2A6HD 1TWAA 2WB1A 3K59A 1TL8A 1SC7A 4FXDA 4KC6A 4F3EA 3LF9A 2R93A 4NOMA 1Y698 2A68D 4D3YA 1ISEA 4KAWX 1WCMA 3DU5A 1SEUA 2BE5D 3GTKA 2O5JD 2A6ED 1RR8C 1Y1WA 5CQGA 2JA6A 1R5ZA 4AHCA 3K5NA 3GTGA 2F4QA 4OYDB 3SJRA 2YU9A 4AYBA 3H0GA 4NOKA 3DU6A 3K5OA 4QIWA 4IP9A 1I6VD 1SMYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDD A;  1DD5 A;  1EK8 A;  4KC6 A;  3LF9 A;  1Y69 8;  4JLR C;  1WQG A;  3LHP S;  1ISE A;  4KAW X;  4L8I A;  4KB2 A;  5MLC 9;  4GFQ A;  5JSB B;  5JSN B;  1EH1 A;  4OYD B;  1WQF A;  4KB4 A;  1IS1 A;  1WQH A;  1GE9 A; 
#chains in the Genus database with same CATH topology
 4KDD A;  1TWC A;  3K58 A;  3GTP A;  1WQG A;  4L8I A;  2JA7 A;  1TWH A;  4EJ3 A;  3K5L A;  1R9T A;  2NVY A;  4NOL A;  1NH3 A;  3GTM A;  2R7Z A;  1YNN D;  1TWG A;  1MIU A;  4Q5V A;  1K83 A;  5JSB B;  3GTJ A;  1RRJ A;  3M4A A;  1EH1 A;  3GTQ A;  2VUM A;  4KB4 A;  4IP8 A;  1GE9 A;  1TWF A;  2E2I A;  1DD5 A;  4AN8 A;  1T8I A;  3K57 A;  2JA5 A;  3K5M A;  4D3Z A;  2CW0 D;  1Y1V A;  2E2H A;  4FYD A;  2NVX A;  1K4S A;  4FGU A;  2A69 D;  5MLC 9;  1TGO A;  5JSN B;  4QCL A;  1A36 A;  4C2M A;  1A31 A;  1IS1 A;  2B63 A;  3MAQ A;  1WQH A;  3IAY A;  1V9M A;  1EK8 A;  2PMZ A;  3GTO A;  3KYL A;  1YNJ D;  1K4T A;  5C9H A;  1Q8I A;  3WVO A;  4JLR C;  4O26 A;  2R4G A;  3LHP S;  3P9A A;  3FKI A;  3HKZ A;  3CQZ A;  1SFO A;  4H3T A;  2WAQ A;  4Q5G A;  1EJ9 A;  1HQM D;  1R49 A;  1LPQ A;  1I3Q A;  4KB2 A;  2R92 A;  4LMO A;  2Y0S A;  1A35 A;  1I50 A;  3GTL A;  4GFQ A;  1IW7 D;  1WQF A;  1ZYR D;  2B9S B;  2A6H D;  1TWA A;  2WB1 A;  3K59 A;  1TL8 A;  1SC7 A;  4FXD A;  4KC6 A;  4F3E A;  3LF9 A;  2R93 A;  4NOM A;  1Y69 8;  2A68 D;  4D3Y A;  1ISE A;  4KAW X;  1WCM A;  3DU5 A;  1SEU A;  2BE5 D;  3GTK A;  2O5J D;  2A6E D;  1RR8 C;  1Y1W A;  5CQG A;  2JA6 A;  1R5Z A;  4AHC A;  3K5N A;  3GTG A;  2F4Q A;  4OYD B;  3SJR A;  2YU9 A;  4AYB A;  3H0G A;  4NOK A;  3DU6 A;  3K5O A;  4QIW A;  4IP9 A;  1I6V D;  1SMY D; 
#chains in the Genus database with same CATH homology
 4KDD A;  1TWC A;  3K58 A;  3GTP A;  1WQG A;  4L8I A;  2JA7 A;  1TWH A;  4EJ3 A;  3K5L A;  1R9T A;  2NVY A;  4NOL A;  1NH3 A;  3GTM A;  2R7Z A;  1YNN D;  1TWG A;  1MIU A;  4Q5V A;  1K83 A;  5JSB B;  3GTJ A;  1RRJ A;  3M4A A;  1EH1 A;  3GTQ A;  2VUM A;  4KB4 A;  4IP8 A;  1GE9 A;  1TWF A;  2E2I A;  1DD5 A;  4AN8 A;  1T8I A;  3K57 A;  2JA5 A;  3K5M A;  4D3Z A;  2CW0 D;  1Y1V A;  2E2H A;  4FYD A;  2NVX A;  1K4S A;  4FGU A;  2A69 D;  5MLC 9;  1TGO A;  5JSN B;  4QCL A;  1A36 A;  4C2M A;  1A31 A;  1IS1 A;  2B63 A;  3MAQ A;  1WQH A;  3IAY A;  1V9M A;  1EK8 A;  2PMZ A;  3GTO A;  3KYL A;  1YNJ D;  1K4T A;  5C9H A;  1Q8I A;  3WVO A;  4JLR C;  4O26 A;  2R4G A;  3LHP S;  3P9A A;  3FKI A;  3HKZ A;  3CQZ A;  1SFO A;  4H3T A;  2WAQ A;  4Q5G A;  1EJ9 A;  1HQM D;  1R49 A;  1LPQ A;  1I3Q A;  4KB2 A;  2R92 A;  4LMO A;  2Y0S A;  1A35 A;  1I50 A;  3GTL A;  4GFQ A;  1IW7 D;  1WQF A;  1ZYR D;  2B9S B;  2A6H D;  1TWA A;  2WB1 A;  3K59 A;  1TL8 A;  1SC7 A;  4FXD A;  4KC6 A;  4F3E A;  3LF9 A;  2R93 A;  4NOM A;  1Y69 8;  2A68 D;  4D3Y A;  1ISE A;  4KAW X;  1WCM A;  3DU5 A;  1SEU A;  2BE5 D;  3GTK A;  2O5J D;  2A6E D;  1RR8 C;  1Y1W A;  5CQG A;  2JA6 A;  1R5Z A;  4AHC A;  3K5N A;  3GTG A;  2F4Q A;  4OYD B;  3SJR A;  2YU9 A;  4AYB A;  3H0G A;  4NOK A;  3DU6 A;  3K5O A;  4QIW A;  4IP9 A;  1I6V D;  1SMY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...