5C9HA

Structural basis of template boundary definition in tetrahymena telomerase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
292
structure length
245
Chain Sequence
b'QYIYPEIQRSQIFYCNHMGREPGVFKSSFFNYYQSKNFSCQEERDLFLEFTEKIVQNFHNINFNYLLKKFCKLPENYQSLKSQVKQIVKANQQSCENLFNSLYDTEISYKQITNFLRQIIQNCVPNQLLGKKNFKVFLEKLYEFVQMKRFENQKVLDYICFMDVFDVEWFVDLKNQKFTQKRKYISDKRKILGDLIVFIINKIVIPVLRYNFYITEKHKEGSQIFYYRKPIWKLVSKLTIVKLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Telomerase reverse transcriptase
molecule tags Rna binding protein/rna
source organism Tetrahymena thermophila
publication title Structural basis of template-boundary definition in Tetrahymena telomerase.
pubmed doi rcsb
total genus 72
structure length 245
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.70 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 5c9hA01
4O26A 2R4GA 3DU6A 3KYLA 5CQGA 4LMOA 3DU5A 5C9HA
chains in the Genus database with same CATH superfamily
4AHCA 1GE9A 2NVXA 5MLC9 3FKIA 4NOKA 2CW0D 1A36A 2PMZA 1EK8A 3GTQA 2O5JD 4KB2A 1K4TA 1I3QA 5JSBB 3WVOA 3M4AA 2BE5D 4FYDA 4IP9A 2JA6A 1Y1WA 1I6VD 1TGOA 1R5ZA 1TWCA 4JLRC 3K59A 3GTPA 1MIUA 2VUMA 3GTGA 4NOLA 4GFQA 4C2MA 3DU5A 3K5OA 2WB1A 1LPQA 3MAQA 5JSNB 1RR8C 2JA7A 1DD5A 1V9MA 4F3EA 4KB4A 4QCLA 1RRJA 2E2IA 4Q5GA 3K5MA 1K4SA 3GTJA 4L8IA 4FGUA 2NVYA 3K57A 1Y1VA 1NH3A 3GTLA 3P9AA 2R92A 4IP8A 1SMYD 1WQHA 4D3ZA 3DU6A 1K83A 2R7ZA 1YNND 2A68D 3GTKA 1WCMA 2R4GA 1R9TA 2F4QA 1TWGA 4KDDA 4QIWA 4Q5VA 3H0GA 3K5LA 1IS1A 3GTOA 1TWAA 3K58A 1HQMD 1A31A 2YU9A 4EJ3A 1R49A 2E2HA 1TWFA 3CQZA 2A69D 1EJ9A 1EH1A 4FXDA 4KAWX 5C9HA 4O26A 2B63A 1ISEA 1SC7A 5CQGA 1A35A 1IW7D 3K5NA 1SEUA 4H3TA 3LHPS 4NOMA 3IAYA 3HKZA 1WQFA 2WAQA 4AYBA 1YNJD 3KYLA 4D3YA 4LMOA 2JA5A 1T8IA 1Q8IA 4KC6A 2A6ED 2A6HD 2R93A 1I50A 1ZYRD 1TL8A 1WQGA 2Y0SA 4AN8A 4OYDB 3LF9A 1TWHA 3SJRA 1SFOA 3GTMA 2B9SB 1Y698
chains in the Genus database with same CATH topology
4AHCA 1GE9A 2NVXA 5MLC9 3FKIA 4NOKA 2CW0D 1A36A 2PMZA 1EK8A 3GTQA 2O5JD 4KB2A 1K4TA 1I3QA 5JSBB 3WVOA 3M4AA 2BE5D 4FYDA 4IP9A 2JA6A 1Y1WA 1I6VD 1TGOA 1R5ZA 1TWCA 4JLRC 3K59A 3GTPA 1MIUA 2VUMA 3GTGA 4NOLA 4GFQA 4C2MA 3DU5A 3K5OA 2WB1A 1LPQA 3MAQA 5JSNB 1RR8C 2JA7A 1DD5A 1V9MA 4F3EA 4KB4A 4QCLA 1RRJA 2E2IA 4Q5GA 3K5MA 1K4SA 3GTJA 4L8IA 4FGUA 2NVYA 3K57A 1Y1VA 1NH3A 3GTLA 3P9AA 2R92A 4IP8A 1SMYD 1WQHA 4D3ZA 3DU6A 1K83A 2R7ZA 1YNND 2A68D 3GTKA 1WCMA 2R4GA 1R9TA 2F4QA 1TWGA 4KDDA 4QIWA 4Q5VA 3H0GA 3K5LA 1IS1A 3GTOA 1TWAA 3K58A 1HQMD 1A31A 2YU9A 4EJ3A 1R49A 2E2HA 1TWFA 3CQZA 2A69D 1EJ9A 1EH1A 4FXDA 4KAWX 5C9HA 4O26A 2B63A 1ISEA 1SC7A 5CQGA 1A35A 1IW7D 3K5NA 1SEUA 4H3TA 3LHPS 4NOMA 3IAYA 3HKZA 1WQFA 2WAQA 4AYBA 1YNJD 3KYLA 4D3YA 4LMOA 2JA5A 1T8IA 1Q8IA 4KC6A 2A6ED 2A6HD 2R93A 1I50A 1ZYRD 1TL8A 1WQGA 2Y0SA 4AN8A 4OYDB 3LF9A 1TWHA 3SJRA 1SFOA 3GTMA 2B9SB 1Y698
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O26 A;  2R4G A;  3DU6 A;  3KYL A;  5CQG A;  4LMO A;  3DU5 A;  5C9H A; 
#chains in the Genus database with same CATH topology
 4AHC A;  1GE9 A;  2NVX A;  5MLC 9;  3FKI A;  4NOK A;  2CW0 D;  1A36 A;  2PMZ A;  1EK8 A;  3GTQ A;  2O5J D;  4KB2 A;  1K4T A;  1I3Q A;  5JSB B;  3WVO A;  3M4A A;  2BE5 D;  4FYD A;  4IP9 A;  2JA6 A;  1Y1W A;  1I6V D;  1TGO A;  1R5Z A;  1TWC A;  4JLR C;  3K59 A;  3GTP A;  1MIU A;  2VUM A;  3GTG A;  4NOL A;  4GFQ A;  4C2M A;  3DU5 A;  3K5O A;  2WB1 A;  1LPQ A;  3MAQ A;  5JSN B;  1RR8 C;  2JA7 A;  1DD5 A;  1V9M A;  4F3E A;  4KB4 A;  4QCL A;  1RRJ A;  2E2I A;  4Q5G A;  3K5M A;  1K4S A;  3GTJ A;  4L8I A;  4FGU A;  2NVY A;  3K57 A;  1Y1V A;  1NH3 A;  3GTL A;  3P9A A;  2R92 A;  4IP8 A;  1SMY D;  1WQH A;  4D3Z A;  3DU6 A;  1K83 A;  2R7Z A;  1YNN D;  2A68 D;  3GTK A;  1WCM A;  2R4G A;  1R9T A;  2F4Q A;  1TWG A;  4KDD A;  4QIW A;  4Q5V A;  3H0G A;  3K5L A;  1IS1 A;  3GTO A;  1TWA A;  3K58 A;  1HQM D;  1A31 A;  2YU9 A;  4EJ3 A;  1R49 A;  2E2H A;  1TWF A;  3CQZ A;  2A69 D;  1EJ9 A;  1EH1 A;  4FXD A;  4KAW X;  5C9H A;  4O26 A;  2B63 A;  1ISE A;  1SC7 A;  5CQG A;  1A35 A;  1IW7 D;  3K5N A;  1SEU A;  4H3T A;  3LHP S;  4NOM A;  3IAY A;  3HKZ A;  1WQF A;  2WAQ A;  4AYB A;  1YNJ D;  3KYL A;  4D3Y A;  4LMO A;  2JA5 A;  1T8I A;  1Q8I A;  4KC6 A;  2A6E D;  2A6H D;  2R93 A;  1I50 A;  1ZYR D;  1TL8 A;  1WQG A;  2Y0S A;  4AN8 A;  4OYD B;  3LF9 A;  1TWH A;  3SJR A;  1SFO A;  3GTM A;  2B9S B;  1Y69 8; 
#chains in the Genus database with same CATH homology
 4AHC A;  1GE9 A;  2NVX A;  5MLC 9;  3FKI A;  4NOK A;  2CW0 D;  1A36 A;  2PMZ A;  1EK8 A;  3GTQ A;  2O5J D;  4KB2 A;  1K4T A;  1I3Q A;  5JSB B;  3WVO A;  3M4A A;  2BE5 D;  4FYD A;  4IP9 A;  2JA6 A;  1Y1W A;  1I6V D;  1TGO A;  1R5Z A;  1TWC A;  4JLR C;  3K59 A;  3GTP A;  1MIU A;  2VUM A;  3GTG A;  4NOL A;  4GFQ A;  4C2M A;  3DU5 A;  3K5O A;  2WB1 A;  1LPQ A;  3MAQ A;  5JSN B;  1RR8 C;  2JA7 A;  1DD5 A;  1V9M A;  4F3E A;  4KB4 A;  4QCL A;  1RRJ A;  2E2I A;  4Q5G A;  3K5M A;  1K4S A;  3GTJ A;  4L8I A;  4FGU A;  2NVY A;  3K57 A;  1Y1V A;  1NH3 A;  3GTL A;  3P9A A;  2R92 A;  4IP8 A;  1SMY D;  1WQH A;  4D3Z A;  3DU6 A;  1K83 A;  2R7Z A;  1YNN D;  2A68 D;  3GTK A;  1WCM A;  2R4G A;  1R9T A;  2F4Q A;  1TWG A;  4KDD A;  4QIW A;  4Q5V A;  3H0G A;  3K5L A;  1IS1 A;  3GTO A;  1TWA A;  3K58 A;  1HQM D;  1A31 A;  2YU9 A;  4EJ3 A;  1R49 A;  2E2H A;  1TWF A;  3CQZ A;  2A69 D;  1EJ9 A;  1EH1 A;  4FXD A;  4KAW X;  5C9H A;  4O26 A;  2B63 A;  1ISE A;  1SC7 A;  5CQG A;  1A35 A;  1IW7 D;  3K5N A;  1SEU A;  4H3T A;  3LHP S;  4NOM A;  3IAY A;  3HKZ A;  1WQF A;  2WAQ A;  4AYB A;  1YNJ D;  3KYL A;  4D3Y A;  4LMO A;  2JA5 A;  1T8I A;  1Q8I A;  4KC6 A;  2A6E D;  2A6H D;  2R93 A;  1I50 A;  1ZYR D;  1TL8 A;  1WQG A;  2Y0S A;  4AN8 A;  4OYD B;  3LF9 A;  1TWH A;  3SJR A;  1SFO A;  3GTM A;  2B9S B;  1Y69 8; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...