5C9HA

Structural basis of template boundary definition in tetrahymena telomerase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
292
structure length
245
Chain Sequence
QYIYPEIQRSQIFYCNHMGREPGVFKSSFFNYYQSKNFSCQEERDLFLEFTEKIVQNFHNINFNYLLKKFCKLPENYQSLKSQVKQIVKANQQSCENLFNSLYDTEISYKQITNFLRQIIQNCVPNQLLGKKNFKVFLEKLYEFVQMKRFENQKVLDYICFMDVFDVEWFVDLKNQKFTQKRKYISDKRKILGDLIVFIINKIVIPVLRYNFYITEKHKEGSQIFYYRKPIWKLVSKLTIVKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of template-boundary definition in Tetrahymena telomerase.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Rna binding protein/rna
molecule keywords Telomerase reverse transcriptase
total genus 72
structure length 245
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.70 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 5c9hA01
4LMOA 4O26A 2R4GA 5C9HA 3KYLA 5CQGA 3DU6A 3DU5A
chains in the Genus database with same CATH superfamily
1EH1A 1WQFA 4GFQA 2R4GA 5JSNB 4D3ZA 3K58A 3K57A 1HQMD 2VUMA 2BE5D 2E2HA 2A68D 1NH3A 3GTJA 4IP8A 1I6VD 4QIWA 1K83A 2CW0D 4FGUA 4KAWX 4OYDB 4KB2A 5C9HA 1Y1WA 2F4QA 4NOLA 3FKIA 4AYBA 3DU5A 4FXDA 1ZYRD 1RR8C 1K4SA 2JA6A 2R93A 1TWFA 4LMOA 3SJRA 2NVXA 4L8IA 2PMZA 2B63A 2NVYA 2JA5A 3GTGA 2A6ED 1TWHA 3IAYA 2A69D 1V9MA 3KYLA 1SC7A 5JSBB 4QCLA 1MIUA 3K5OA 4KDDA 1TWGA 4Q5GA 3GTKA 1K4TA 1ISEA 4KB4A 3K5NA 3M4AA 1WQGA 2WB1A 3DU6A 1I3QA 1TGOA 4F3EA 1R9TA 3GTOA 3H0GA 1YNJD 4IP9A 3LF9A 1TWCA 1SEUA 1YNND 1LPQA 1A35A 2B9SB 3MAQA 2R92A 1WCMA 2YU9A 4JLRC 2JA7A 1R49A 2WAQA 3K5MA 3HKZA 3LHPS 1Y698 4C2MA 2E2IA 1I50A 1DD5A 3GTMA 4H3TA 5CQGA 5MLC9 1A31A 1IW7D 3P9AA 4O26A 1SFOA 1Q8IA 4Q5VA 3GTQA 2R7ZA 1A36A 1Y1VA 3K5LA 1TWAA 3K59A 2O5JD 1TL8A 4D3YA 1SMYD 1IS1A 1RRJA 3GTPA 4AN8A 1EK8A 4NOMA 1T8IA 3CQZA 4EJ3A 1EJ9A 4NOKA 1WQHA 3WVOA 3GTLA 4FYDA 1GE9A 2A6HD 1R5ZA 2Y0SA 4KC6A 4AHCA
chains in the Genus database with same CATH topology
1EH1A 1WQFA 4GFQA 2R4GA 5JSNB 4D3ZA 3K58A 3K57A 1HQMD 2VUMA 2BE5D 2E2HA 2A68D 1NH3A 3GTJA 4IP8A 1I6VD 4QIWA 1K83A 2CW0D 4FGUA 4KAWX 4OYDB 4KB2A 5C9HA 1Y1WA 2F4QA 4NOLA 3FKIA 4AYBA 3DU5A 4FXDA 1ZYRD 1RR8C 1K4SA 2JA6A 2R93A 1TWFA 4LMOA 3SJRA 2NVXA 4L8IA 2PMZA 2B63A 2NVYA 2JA5A 3GTGA 2A6ED 1TWHA 3IAYA 2A69D 1V9MA 3KYLA 1SC7A 5JSBB 4QCLA 1MIUA 3K5OA 4KDDA 1TWGA 4Q5GA 3GTKA 1K4TA 1ISEA 4KB4A 3K5NA 3M4AA 1WQGA 2WB1A 3DU6A 1I3QA 1TGOA 4F3EA 1R9TA 3GTOA 3H0GA 1YNJD 4IP9A 3LF9A 1TWCA 1SEUA 1YNND 1LPQA 1A35A 2B9SB 3MAQA 2R92A 1WCMA 2YU9A 4JLRC 2JA7A 1R49A 2WAQA 3K5MA 3HKZA 3LHPS 1Y698 4C2MA 2E2IA 1I50A 1DD5A 3GTMA 4H3TA 5CQGA 5MLC9 1A31A 1IW7D 3P9AA 4O26A 1SFOA 1Q8IA 4Q5VA 3GTQA 2R7ZA 1A36A 1Y1VA 3K5LA 1TWAA 3K59A 2O5JD 1TL8A 4D3YA 1SMYD 1IS1A 1RRJA 3GTPA 4AN8A 1EK8A 4NOMA 1T8IA 3CQZA 4EJ3A 1EJ9A 4NOKA 1WQHA 3WVOA 3GTLA 4FYDA 1GE9A 2A6HD 1R5ZA 2Y0SA 4KC6A 4AHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMO A;  4O26 A;  2R4G A;  5C9H A;  3KYL A;  5CQG A;  3DU6 A;  3DU5 A; 
#chains in the Genus database with same CATH topology
 1EH1 A;  1WQF A;  4GFQ A;  2R4G A;  5JSN B;  4D3Z A;  3K58 A;  3K57 A;  1HQM D;  2VUM A;  2BE5 D;  2E2H A;  2A68 D;  1NH3 A;  3GTJ A;  4IP8 A;  1I6V D;  4QIW A;  1K83 A;  2CW0 D;  4FGU A;  4KAW X;  4OYD B;  4KB2 A;  5C9H A;  1Y1W A;  2F4Q A;  4NOL A;  3FKI A;  4AYB A;  3DU5 A;  4FXD A;  1ZYR D;  1RR8 C;  1K4S A;  2JA6 A;  2R93 A;  1TWF A;  4LMO A;  3SJR A;  2NVX A;  4L8I A;  2PMZ A;  2B63 A;  2NVY A;  2JA5 A;  3GTG A;  2A6E D;  1TWH A;  3IAY A;  2A69 D;  1V9M A;  3KYL A;  1SC7 A;  5JSB B;  4QCL A;  1MIU A;  3K5O A;  4KDD A;  1TWG A;  4Q5G A;  3GTK A;  1K4T A;  1ISE A;  4KB4 A;  3K5N A;  3M4A A;  1WQG A;  2WB1 A;  3DU6 A;  1I3Q A;  1TGO A;  4F3E A;  1R9T A;  3GTO A;  3H0G A;  1YNJ D;  4IP9 A;  3LF9 A;  1TWC A;  1SEU A;  1YNN D;  1LPQ A;  1A35 A;  2B9S B;  3MAQ A;  2R92 A;  1WCM A;  2YU9 A;  4JLR C;  2JA7 A;  1R49 A;  2WAQ A;  3K5M A;  3HKZ A;  3LHP S;  1Y69 8;  4C2M A;  2E2I A;  1I50 A;  1DD5 A;  3GTM A;  4H3T A;  5CQG A;  5MLC 9;  1A31 A;  1IW7 D;  3P9A A;  4O26 A;  1SFO A;  1Q8I A;  4Q5V A;  3GTQ A;  2R7Z A;  1A36 A;  1Y1V A;  3K5L A;  1TWA A;  3K59 A;  2O5J D;  1TL8 A;  4D3Y A;  1SMY D;  1IS1 A;  1RRJ A;  3GTP A;  4AN8 A;  1EK8 A;  4NOM A;  1T8I A;  3CQZ A;  4EJ3 A;  1EJ9 A;  4NOK A;  1WQH A;  3WVO A;  3GTL A;  4FYD A;  1GE9 A;  2A6H D;  1R5Z A;  2Y0S A;  4KC6 A;  4AHC A; 
#chains in the Genus database with same CATH homology
 1EH1 A;  1WQF A;  4GFQ A;  2R4G A;  5JSN B;  4D3Z A;  3K58 A;  3K57 A;  1HQM D;  2VUM A;  2BE5 D;  2E2H A;  2A68 D;  1NH3 A;  3GTJ A;  4IP8 A;  1I6V D;  4QIW A;  1K83 A;  2CW0 D;  4FGU A;  4KAW X;  4OYD B;  4KB2 A;  5C9H A;  1Y1W A;  2F4Q A;  4NOL A;  3FKI A;  4AYB A;  3DU5 A;  4FXD A;  1ZYR D;  1RR8 C;  1K4S A;  2JA6 A;  2R93 A;  1TWF A;  4LMO A;  3SJR A;  2NVX A;  4L8I A;  2PMZ A;  2B63 A;  2NVY A;  2JA5 A;  3GTG A;  2A6E D;  1TWH A;  3IAY A;  2A69 D;  1V9M A;  3KYL A;  1SC7 A;  5JSB B;  4QCL A;  1MIU A;  3K5O A;  4KDD A;  1TWG A;  4Q5G A;  3GTK A;  1K4T A;  1ISE A;  4KB4 A;  3K5N A;  3M4A A;  1WQG A;  2WB1 A;  3DU6 A;  1I3Q A;  1TGO A;  4F3E A;  1R9T A;  3GTO A;  3H0G A;  1YNJ D;  4IP9 A;  3LF9 A;  1TWC A;  1SEU A;  1YNN D;  1LPQ A;  1A35 A;  2B9S B;  3MAQ A;  2R92 A;  1WCM A;  2YU9 A;  4JLR C;  2JA7 A;  1R49 A;  2WAQ A;  3K5M A;  3HKZ A;  3LHP S;  1Y69 8;  4C2M A;  2E2I A;  1I50 A;  1DD5 A;  3GTM A;  4H3T A;  5CQG A;  5MLC 9;  1A31 A;  1IW7 D;  3P9A A;  4O26 A;  1SFO A;  1Q8I A;  4Q5V A;  3GTQ A;  2R7Z A;  1A36 A;  1Y1V A;  3K5L A;  1TWA A;  3K59 A;  2O5J D;  1TL8 A;  4D3Y A;  1SMY D;  1IS1 A;  1RRJ A;  3GTP A;  4AN8 A;  1EK8 A;  4NOM A;  1T8I A;  3CQZ A;  4EJ3 A;  1EJ9 A;  4NOK A;  1WQH A;  3WVO A;  3GTL A;  4FYD A;  1GE9 A;  2A6H D;  1R5Z A;  2Y0S A;  4KC6 A;  4AHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...