5C9HA

Structural basis of template boundary definition in tetrahymena telomerase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
292
structure length
245
Chain Sequence
QYIYPEIQRSQIFYCNHMGREPGVFKSSFFNYYQSKNFSCQEERDLFLEFTEKIVQNFHNINFNYLLKKFCKLPENYQSLKSQVKQIVKANQQSCENLFNSLYDTEISYKQITNFLRQIIQNCVPNQLLGKKNFKVFLEKLYEFVQMKRFENQKVLDYICFMDVFDVEWFVDLKNQKFTQKRKYISDKRKILGDLIVFIINKIVIPVLRYNFYITEKHKEGSQIFYYRKPIWKLVSKLTIVKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Telomerase reverse transcriptase
publication title Structural basis of template-boundary definition in Tetrahymena telomerase.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Rna binding protein/rna
total genus 72
structure length 245
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.70 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 5c9hA01
2R4GA 3KYLA 5CQGA 5C9HA 3DU6A 4LMOA 3DU5A 4O26A
chains in the Genus database with same CATH superfamily
2E2IA 5C9HA 2Y0SA 3GTGA 2NVYA 1ISEA 1Q8IA 1WQFA 5MLC9 1IS1A 2PMZA 2JA6A 5CQGA 3LHPS 1R49A 2VUMA 3FKIA 4AYBA 1TWGA 3K57A 3M4AA 1K4SA 1A36A 3IAYA 1SEUA 2R92A 4KB4A 4F3EA 1MIUA 1R5ZA 2WAQA 1A35A 3DU5A 2NVXA 1T8IA 1DD5A 1K4TA 4KAWX 4Q5VA 4Q5GA 1I3QA 1Y698 1V9MA 2A6HD 2A68D 1YNND 4AN8A 3LF9A 3GTOA 1EH1A 4IP9A 3H0GA 4OYDB 1R9TA 1WQGA 1WQHA 4NOKA 3GTKA 1RRJA 1I50A 1TL8A 3GTLA 1TGOA 2O5JD 3K5OA 3P9AA 2A69D 1RR8C 1TWAA 1LPQA 4O26A 1SFOA 1TWFA 4NOLA 1NH3A 1TWCA 1SMYD 4KDDA 1Y1VA 2R7ZA 3WVOA 3GTJA 3CQZA 2BE5D 1ZYRD 3HKZA 3MAQA 1A31A 3SJRA 4C2MA 4D3ZA 1WCMA 3GTPA 4FGUA 5JSNB 1IW7D 1TWHA 4NOMA 2R4GA 1K83A 2JA7A 1HQMD 4JLRC 3GTMA 1SC7A 4QIWA 2F4QA 2WB1A 1GE9A 1YNJD 4KC6A 4QCLA 4H3TA 4AHCA 4IP8A 3KYLA 3K5LA 1I6VD 4L8IA 2B63A 3K59A 4KB2A 3GTQA 4D3YA 1EJ9A 4EJ3A 2E2HA 1Y1WA 2R93A 3K58A 2B9SB 4GFQA 4FXDA 3K5MA 2CW0D 2JA5A 5JSBB 1EK8A 2YU9A 3DU6A 3K5NA 4FYDA 4LMOA 2A6ED
chains in the Genus database with same CATH topology
2E2IA 5C9HA 2Y0SA 3GTGA 2NVYA 1ISEA 1Q8IA 1WQFA 5MLC9 1IS1A 2PMZA 2JA6A 5CQGA 3LHPS 1R49A 2VUMA 3FKIA 4AYBA 1TWGA 3K57A 3M4AA 1K4SA 1A36A 3IAYA 1SEUA 2R92A 4KB4A 4F3EA 1MIUA 1R5ZA 2WAQA 1A35A 3DU5A 2NVXA 1T8IA 1DD5A 1K4TA 4KAWX 4Q5VA 4Q5GA 1I3QA 1Y698 1V9MA 2A6HD 2A68D 1YNND 4AN8A 3LF9A 3GTOA 1EH1A 4IP9A 3H0GA 4OYDB 1R9TA 1WQGA 1WQHA 4NOKA 3GTKA 1RRJA 1I50A 1TL8A 3GTLA 1TGOA 2O5JD 3K5OA 3P9AA 2A69D 1RR8C 1TWAA 1LPQA 4O26A 1SFOA 1TWFA 4NOLA 1NH3A 1TWCA 1SMYD 4KDDA 1Y1VA 2R7ZA 3WVOA 3GTJA 3CQZA 2BE5D 1ZYRD 3HKZA 3MAQA 1A31A 3SJRA 4C2MA 4D3ZA 1WCMA 3GTPA 4FGUA 5JSNB 1IW7D 1TWHA 4NOMA 2R4GA 1K83A 2JA7A 1HQMD 4JLRC 3GTMA 1SC7A 4QIWA 2F4QA 2WB1A 1GE9A 1YNJD 4KC6A 4QCLA 4H3TA 4AHCA 4IP8A 3KYLA 3K5LA 1I6VD 4L8IA 2B63A 3K59A 4KB2A 3GTQA 4D3YA 1EJ9A 4EJ3A 2E2HA 1Y1WA 2R93A 3K58A 2B9SB 4GFQA 4FXDA 3K5MA 2CW0D 2JA5A 5JSBB 1EK8A 2YU9A 3DU6A 3K5NA 4FYDA 4LMOA 2A6ED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4G A;  3KYL A;  5CQG A;  5C9H A;  3DU6 A;  4LMO A;  3DU5 A;  4O26 A; 
#chains in the Genus database with same CATH topology
 2E2I A;  5C9H A;  2Y0S A;  3GTG A;  2NVY A;  1ISE A;  1Q8I A;  1WQF A;  5MLC 9;  1IS1 A;  2PMZ A;  2JA6 A;  5CQG A;  3LHP S;  1R49 A;  2VUM A;  3FKI A;  4AYB A;  1TWG A;  3K57 A;  3M4A A;  1K4S A;  1A36 A;  3IAY A;  1SEU A;  2R92 A;  4KB4 A;  4F3E A;  1MIU A;  1R5Z A;  2WAQ A;  1A35 A;  3DU5 A;  2NVX A;  1T8I A;  1DD5 A;  1K4T A;  4KAW X;  4Q5V A;  4Q5G A;  1I3Q A;  1Y69 8;  1V9M A;  2A6H D;  2A68 D;  1YNN D;  4AN8 A;  3LF9 A;  3GTO A;  1EH1 A;  4IP9 A;  3H0G A;  4OYD B;  1R9T A;  1WQG A;  1WQH A;  4NOK A;  3GTK A;  1RRJ A;  1I50 A;  1TL8 A;  3GTL A;  1TGO A;  2O5J D;  3K5O A;  3P9A A;  2A69 D;  1RR8 C;  1TWA A;  1LPQ A;  4O26 A;  1SFO A;  1TWF A;  4NOL A;  1NH3 A;  1TWC A;  1SMY D;  4KDD A;  1Y1V A;  2R7Z A;  3WVO A;  3GTJ A;  3CQZ A;  2BE5 D;  1ZYR D;  3HKZ A;  3MAQ A;  1A31 A;  3SJR A;  4C2M A;  4D3Z A;  1WCM A;  3GTP A;  4FGU A;  5JSN B;  1IW7 D;  1TWH A;  4NOM A;  2R4G A;  1K83 A;  2JA7 A;  1HQM D;  4JLR C;  3GTM A;  1SC7 A;  4QIW A;  2F4Q A;  2WB1 A;  1GE9 A;  1YNJ D;  4KC6 A;  4QCL A;  4H3T A;  4AHC A;  4IP8 A;  3KYL A;  3K5L A;  1I6V D;  4L8I A;  2B63 A;  3K59 A;  4KB2 A;  3GTQ A;  4D3Y A;  1EJ9 A;  4EJ3 A;  2E2H A;  1Y1W A;  2R93 A;  3K58 A;  2B9S B;  4GFQ A;  4FXD A;  3K5M A;  2CW0 D;  2JA5 A;  5JSB B;  1EK8 A;  2YU9 A;  3DU6 A;  3K5N A;  4FYD A;  4LMO A;  2A6E D; 
#chains in the Genus database with same CATH homology
 2E2I A;  5C9H A;  2Y0S A;  3GTG A;  2NVY A;  1ISE A;  1Q8I A;  1WQF A;  5MLC 9;  1IS1 A;  2PMZ A;  2JA6 A;  5CQG A;  3LHP S;  1R49 A;  2VUM A;  3FKI A;  4AYB A;  1TWG A;  3K57 A;  3M4A A;  1K4S A;  1A36 A;  3IAY A;  1SEU A;  2R92 A;  4KB4 A;  4F3E A;  1MIU A;  1R5Z A;  2WAQ A;  1A35 A;  3DU5 A;  2NVX A;  1T8I A;  1DD5 A;  1K4T A;  4KAW X;  4Q5V A;  4Q5G A;  1I3Q A;  1Y69 8;  1V9M A;  2A6H D;  2A68 D;  1YNN D;  4AN8 A;  3LF9 A;  3GTO A;  1EH1 A;  4IP9 A;  3H0G A;  4OYD B;  1R9T A;  1WQG A;  1WQH A;  4NOK A;  3GTK A;  1RRJ A;  1I50 A;  1TL8 A;  3GTL A;  1TGO A;  2O5J D;  3K5O A;  3P9A A;  2A69 D;  1RR8 C;  1TWA A;  1LPQ A;  4O26 A;  1SFO A;  1TWF A;  4NOL A;  1NH3 A;  1TWC A;  1SMY D;  4KDD A;  1Y1V A;  2R7Z A;  3WVO A;  3GTJ A;  3CQZ A;  2BE5 D;  1ZYR D;  3HKZ A;  3MAQ A;  1A31 A;  3SJR A;  4C2M A;  4D3Z A;  1WCM A;  3GTP A;  4FGU A;  5JSN B;  1IW7 D;  1TWH A;  4NOM A;  2R4G A;  1K83 A;  2JA7 A;  1HQM D;  4JLR C;  3GTM A;  1SC7 A;  4QIW A;  2F4Q A;  2WB1 A;  1GE9 A;  1YNJ D;  4KC6 A;  4QCL A;  4H3T A;  4AHC A;  4IP8 A;  3KYL A;  3K5L A;  1I6V D;  4L8I A;  2B63 A;  3K59 A;  4KB2 A;  3GTQ A;  4D3Y A;  1EJ9 A;  4EJ3 A;  2E2H A;  1Y1W A;  2R93 A;  3K58 A;  2B9S B;  4GFQ A;  4FXD A;  3K5M A;  2CW0 D;  2JA5 A;  5JSB B;  1EK8 A;  2YU9 A;  3DU6 A;  3K5N A;  4FYD A;  4LMO A;  2A6E D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...