4IP8A

Structure of human serum amyloid a1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
105
structure length
105
Chain Sequence
b'MRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serum amyloid A-1 protein
molecule tags Protein binding
source organism Homo sapiens
publication title Structural mechanism of serum amyloid A-mediated inflammatory amyloidosis.
pubmed doi rcsb
total genus 47
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00277 SAA Serum amyloid A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.110 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4ip8A00
4IP9A 4Q5GA 4IP8A
chains in the Genus database with same CATH superfamily
4NOMA 4OYDB 1ZYRD 4C2MA 5MLC9 2YU9A 3DU6A 1I50A 3CQZA 2E2IA 3GTKA 1EK8A 3K5MA 1Y698 1TGOA 1ISEA 4KB4A 3DU5A 4IP8A 2A6ED 3P9AA 4L8IA 1K4TA 3K5OA 1T8IA 4QIWA 2E2HA 4AN8A 1SFOA 4F3EA 4JLRC 3GTGA 1TWGA 1TWFA 1SMYD 2B9SB 1TWHA 1K4SA 2PMZA 4IP9A 1HQMD 4KDDA 2R7ZA 3GTOA 2WB1A 3KYLA 3K58A 1V9MA 1MIUA 2WAQA 3GTMA 4AYBA 2F4QA 3M4AA 3SJRA 3K57A 4KC6A 2JA5A 2R4GA 3IAYA 4NOLA 3GTPA 1IS1A 2A6HD 2R92A 1EH1A 1A31A 4D3YA 2A68D 5C9HA 1R9TA 1Q8IA 5CQGA 3GTQA 3LHPS 2VUMA 4FYDA 1R49A 1LPQA 1DD5A 2O5JD 4FGUA 1Y1WA 2A69D 1WQGA 1I3QA 4Q5VA 4GFQA 1TL8A 1IW7D 1SC7A 2CW0D 3FKIA 1YNJD 4KB2A 1YNND 1RR8C 3GTJA 1WQHA 4KAWX 2R93A 4LMOA 3K5NA 2NVYA 3WVOA 4D3ZA 1Y1VA 1TWAA 1I6VD 3GTLA 3HKZA 3LF9A 1WQFA 4EJ3A 1K83A 2Y0SA 1A36A 4FXDA 5JSNB 2NVXA 1WCMA 1TWCA 4Q5GA 1R5ZA 2JA6A 4H3TA 3MAQA 1GE9A 4NOKA 3K59A 1NH3A 2BE5D 3H0GA 4AHCA 1EJ9A 2JA7A 3K5LA 4QCLA 1SEUA 5JSBB 2B63A 4O26A 1A35A 1RRJA
chains in the Genus database with same CATH topology
4NOMA 4OYDB 1ZYRD 4C2MA 5MLC9 2YU9A 3DU6A 1I50A 3CQZA 2E2IA 3GTKA 1EK8A 3K5MA 1Y698 1TGOA 1ISEA 4KB4A 3DU5A 4IP8A 2A6ED 3P9AA 4L8IA 1K4TA 3K5OA 1T8IA 4QIWA 2E2HA 4AN8A 1SFOA 4F3EA 4JLRC 3GTGA 1TWGA 1TWFA 1SMYD 2B9SB 1TWHA 1K4SA 2PMZA 4IP9A 1HQMD 4KDDA 2R7ZA 3GTOA 2WB1A 3KYLA 3K58A 1V9MA 1MIUA 2WAQA 3GTMA 4AYBA 2F4QA 3M4AA 3SJRA 3K57A 4KC6A 2JA5A 2R4GA 3IAYA 4NOLA 3GTPA 1IS1A 2A6HD 2R92A 1EH1A 1A31A 4D3YA 2A68D 5C9HA 1R9TA 1Q8IA 5CQGA 3GTQA 3LHPS 2VUMA 4FYDA 1R49A 1LPQA 1DD5A 2O5JD 4FGUA 1Y1WA 2A69D 1WQGA 1I3QA 4Q5VA 4GFQA 1TL8A 1IW7D 1SC7A 2CW0D 3FKIA 1YNJD 4KB2A 1YNND 1RR8C 3GTJA 1WQHA 4KAWX 2R93A 4LMOA 3K5NA 2NVYA 3WVOA 4D3ZA 1Y1VA 1TWAA 1I6VD 3GTLA 3HKZA 3LF9A 1WQFA 4EJ3A 1K83A 2Y0SA 1A36A 4FXDA 5JSNB 2NVXA 1WCMA 1TWCA 4Q5GA 1R5ZA 2JA6A 4H3TA 3MAQA 1GE9A 4NOKA 3K59A 1NH3A 2BE5D 3H0GA 4AHCA 1EJ9A 2JA7A 3K5LA 4QCLA 1SEUA 5JSBB 2B63A 4O26A 1A35A 1RRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IP9 A;  4Q5G A;  4IP8 A; 
#chains in the Genus database with same CATH topology
 4NOM A;  4OYD B;  1ZYR D;  4C2M A;  5MLC 9;  2YU9 A;  3DU6 A;  1I50 A;  3CQZ A;  2E2I A;  3GTK A;  1EK8 A;  3K5M A;  1Y69 8;  1TGO A;  1ISE A;  4KB4 A;  3DU5 A;  4IP8 A;  2A6E D;  3P9A A;  4L8I A;  1K4T A;  3K5O A;  1T8I A;  4QIW A;  2E2H A;  4AN8 A;  1SFO A;  4F3E A;  4JLR C;  3GTG A;  1TWG A;  1TWF A;  1SMY D;  2B9S B;  1TWH A;  1K4S A;  2PMZ A;  4IP9 A;  1HQM D;  4KDD A;  2R7Z A;  3GTO A;  2WB1 A;  3KYL A;  3K58 A;  1V9M A;  1MIU A;  2WAQ A;  3GTM A;  4AYB A;  2F4Q A;  3M4A A;  3SJR A;  3K57 A;  4KC6 A;  2JA5 A;  2R4G A;  3IAY A;  4NOL A;  3GTP A;  1IS1 A;  2A6H D;  2R92 A;  1EH1 A;  1A31 A;  4D3Y A;  2A68 D;  5C9H A;  1R9T A;  1Q8I A;  5CQG A;  3GTQ A;  3LHP S;  2VUM A;  4FYD A;  1R49 A;  1LPQ A;  1DD5 A;  2O5J D;  4FGU A;  1Y1W A;  2A69 D;  1WQG A;  1I3Q A;  4Q5V A;  4GFQ A;  1TL8 A;  1IW7 D;  1SC7 A;  2CW0 D;  3FKI A;  1YNJ D;  4KB2 A;  1YNN D;  1RR8 C;  3GTJ A;  1WQH A;  4KAW X;  2R93 A;  4LMO A;  3K5N A;  2NVY A;  3WVO A;  4D3Z A;  1Y1V A;  1TWA A;  1I6V D;  3GTL A;  3HKZ A;  3LF9 A;  1WQF A;  4EJ3 A;  1K83 A;  2Y0S A;  1A36 A;  4FXD A;  5JSN B;  2NVX A;  1WCM A;  1TWC A;  4Q5G A;  1R5Z A;  2JA6 A;  4H3T A;  3MAQ A;  1GE9 A;  4NOK A;  3K59 A;  1NH3 A;  2BE5 D;  3H0G A;  4AHC A;  1EJ9 A;  2JA7 A;  3K5L A;  4QCL A;  1SEU A;  5JSB B;  2B63 A;  4O26 A;  1A35 A;  1RRJ A; 
#chains in the Genus database with same CATH homology
 4NOM A;  4OYD B;  1ZYR D;  4C2M A;  5MLC 9;  2YU9 A;  3DU6 A;  1I50 A;  3CQZ A;  2E2I A;  3GTK A;  1EK8 A;  3K5M A;  1Y69 8;  1TGO A;  1ISE A;  4KB4 A;  3DU5 A;  4IP8 A;  2A6E D;  3P9A A;  4L8I A;  1K4T A;  3K5O A;  1T8I A;  4QIW A;  2E2H A;  4AN8 A;  1SFO A;  4F3E A;  4JLR C;  3GTG A;  1TWG A;  1TWF A;  1SMY D;  2B9S B;  1TWH A;  1K4S A;  2PMZ A;  4IP9 A;  1HQM D;  4KDD A;  2R7Z A;  3GTO A;  2WB1 A;  3KYL A;  3K58 A;  1V9M A;  1MIU A;  2WAQ A;  3GTM A;  4AYB A;  2F4Q A;  3M4A A;  3SJR A;  3K57 A;  4KC6 A;  2JA5 A;  2R4G A;  3IAY A;  4NOL A;  3GTP A;  1IS1 A;  2A6H D;  2R92 A;  1EH1 A;  1A31 A;  4D3Y A;  2A68 D;  5C9H A;  1R9T A;  1Q8I A;  5CQG A;  3GTQ A;  3LHP S;  2VUM A;  4FYD A;  1R49 A;  1LPQ A;  1DD5 A;  2O5J D;  4FGU A;  1Y1W A;  2A69 D;  1WQG A;  1I3Q A;  4Q5V A;  4GFQ A;  1TL8 A;  1IW7 D;  1SC7 A;  2CW0 D;  3FKI A;  1YNJ D;  4KB2 A;  1YNN D;  1RR8 C;  3GTJ A;  1WQH A;  4KAW X;  2R93 A;  4LMO A;  3K5N A;  2NVY A;  3WVO A;  4D3Z A;  1Y1V A;  1TWA A;  1I6V D;  3GTL A;  3HKZ A;  3LF9 A;  1WQF A;  4EJ3 A;  1K83 A;  2Y0S A;  1A36 A;  4FXD A;  5JSN B;  2NVX A;  1WCM A;  1TWC A;  4Q5G A;  1R5Z A;  2JA6 A;  4H3T A;  3MAQ A;  1GE9 A;  4NOK A;  3K59 A;  1NH3 A;  2BE5 D;  3H0G A;  4AHC A;  1EJ9 A;  2JA7 A;  3K5L A;  4QCL A;  1SEU A;  5JSB B;  2B63 A;  4O26 A;  1A35 A;  1RRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...