4IP8A

Structure of human serum amyloid a1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
105
structure length
105
Chain Sequence
MRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of serum amyloid A-mediated inflammatory amyloidosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Serum amyloid A-1 protein
total genus 47
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00277 SAA Serum amyloid A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.110 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4ip8A00
4IP9A 4IP8A 4Q5GA
chains in the Genus database with same CATH superfamily
3H0GA 1WCMA 4O26A 4IP8A 3DU6A 2CW0D 1YNND 4FGUA 5JSNB 4NOMA 5MLC9 1K4TA 4NOLA 1K83A 4QCLA 1IW7D 3K5OA 3K59A 1DD5A 1SMYD 1R49A 5JSBB 1LPQA 2R4GA 1WQFA 4QIWA 4FXDA 1NH3A 3M4AA 2BE5D 2PMZA 1TWGA 2JA7A 4NOKA 3KYLA 5CQGA 1WQHA 2B63A 3GTMA 2JA5A 1MIUA 1IS1A 1Q8IA 4EJ3A 1K4SA 3LHPS 4Q5GA 4L8IA 4KC6A 2A69D 3GTLA 4AYBA 1TWFA 1R9TA 1TGOA 1Y698 2WB1A 1Y1WA 3GTKA 3WVOA 4FYDA 3K5LA 2Y0SA 2VUMA 1I50A 2NVYA 2YU9A 3K5NA 4KB4A 1WQGA 2R7ZA 1A31A 1SFOA 1YNJD 4OYDB 5C9HA 3LF9A 4IP9A 2A68D 3IAYA 1A35A 4C2MA 2O5JD 2JA6A 1RR8C 2E2HA 1V9MA 3GTGA 2R93A 2F4QA 2A6HD 2NVXA 1T8IA 3GTJA 4JLRC 3K58A 2E2IA 2WAQA 4KB2A 2B9SB 3GTQA 4H3TA 1HQMD 1A36A 4AHCA 4Q5VA 3SJRA 3CQZA 1SC7A 4GFQA 3FKIA 1I3QA 1RRJA 1TWHA 1SEUA 1EH1A 3K5MA 2R92A 1TL8A 4D3YA 1EJ9A 4F3EA 1TWAA 3GTPA 3MAQA 3K57A 4AN8A 1GE9A 1EK8A 1Y1VA 4KAWX 1TWCA 1ISEA 2A6ED 3HKZA 4D3ZA 1I6VD 1R5ZA 1ZYRD 3GTOA 4KDDA 3DU5A 3P9AA 4LMOA
chains in the Genus database with same CATH topology
3H0GA 1WCMA 4O26A 4IP8A 3DU6A 2CW0D 1YNND 4FGUA 5JSNB 4NOMA 5MLC9 1K4TA 4NOLA 1K83A 4QCLA 1IW7D 3K5OA 3K59A 1DD5A 1SMYD 1R49A 5JSBB 1LPQA 2R4GA 1WQFA 4QIWA 4FXDA 1NH3A 3M4AA 2BE5D 2PMZA 1TWGA 2JA7A 4NOKA 3KYLA 5CQGA 1WQHA 2B63A 3GTMA 2JA5A 1MIUA 1IS1A 1Q8IA 4EJ3A 1K4SA 3LHPS 4Q5GA 4L8IA 4KC6A 2A69D 3GTLA 4AYBA 1TWFA 1R9TA 1TGOA 1Y698 2WB1A 1Y1WA 3GTKA 3WVOA 4FYDA 3K5LA 2Y0SA 2VUMA 1I50A 2NVYA 2YU9A 3K5NA 4KB4A 1WQGA 2R7ZA 1A31A 1SFOA 1YNJD 4OYDB 5C9HA 3LF9A 4IP9A 2A68D 3IAYA 1A35A 4C2MA 2O5JD 2JA6A 1RR8C 2E2HA 1V9MA 3GTGA 2R93A 2F4QA 2A6HD 2NVXA 1T8IA 3GTJA 4JLRC 3K58A 2E2IA 2WAQA 4KB2A 2B9SB 3GTQA 4H3TA 1HQMD 1A36A 4AHCA 4Q5VA 3SJRA 3CQZA 1SC7A 4GFQA 3FKIA 1I3QA 1RRJA 1TWHA 1SEUA 1EH1A 3K5MA 2R92A 1TL8A 4D3YA 1EJ9A 4F3EA 1TWAA 3GTPA 3MAQA 3K57A 4AN8A 1GE9A 1EK8A 1Y1VA 4KAWX 1TWCA 1ISEA 2A6ED 3HKZA 4D3ZA 1I6VD 1R5ZA 1ZYRD 3GTOA 4KDDA 3DU5A 3P9AA 4LMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IP9 A;  4IP8 A;  4Q5G A; 
#chains in the Genus database with same CATH topology
 3H0G A;  1WCM A;  4O26 A;  4IP8 A;  3DU6 A;  2CW0 D;  1YNN D;  4FGU A;  5JSN B;  4NOM A;  5MLC 9;  1K4T A;  4NOL A;  1K83 A;  4QCL A;  1IW7 D;  3K5O A;  3K59 A;  1DD5 A;  1SMY D;  1R49 A;  5JSB B;  1LPQ A;  2R4G A;  1WQF A;  4QIW A;  4FXD A;  1NH3 A;  3M4A A;  2BE5 D;  2PMZ A;  1TWG A;  2JA7 A;  4NOK A;  3KYL A;  5CQG A;  1WQH A;  2B63 A;  3GTM A;  2JA5 A;  1MIU A;  1IS1 A;  1Q8I A;  4EJ3 A;  1K4S A;  3LHP S;  4Q5G A;  4L8I A;  4KC6 A;  2A69 D;  3GTL A;  4AYB A;  1TWF A;  1R9T A;  1TGO A;  1Y69 8;  2WB1 A;  1Y1W A;  3GTK A;  3WVO A;  4FYD A;  3K5L A;  2Y0S A;  2VUM A;  1I50 A;  2NVY A;  2YU9 A;  3K5N A;  4KB4 A;  1WQG A;  2R7Z A;  1A31 A;  1SFO A;  1YNJ D;  4OYD B;  5C9H A;  3LF9 A;  4IP9 A;  2A68 D;  3IAY A;  1A35 A;  4C2M A;  2O5J D;  2JA6 A;  1RR8 C;  2E2H A;  1V9M A;  3GTG A;  2R93 A;  2F4Q A;  2A6H D;  2NVX A;  1T8I A;  3GTJ A;  4JLR C;  3K58 A;  2E2I A;  2WAQ A;  4KB2 A;  2B9S B;  3GTQ A;  4H3T A;  1HQM D;  1A36 A;  4AHC A;  4Q5V A;  3SJR A;  3CQZ A;  1SC7 A;  4GFQ A;  3FKI A;  1I3Q A;  1RRJ A;  1TWH A;  1SEU A;  1EH1 A;  3K5M A;  2R92 A;  1TL8 A;  4D3Y A;  1EJ9 A;  4F3E A;  1TWA A;  3GTP A;  3MAQ A;  3K57 A;  4AN8 A;  1GE9 A;  1EK8 A;  1Y1V A;  4KAW X;  1TWC A;  1ISE A;  2A6E D;  3HKZ A;  4D3Z A;  1I6V D;  1R5Z A;  1ZYR D;  3GTO A;  4KDD A;  3DU5 A;  3P9A A;  4LMO A; 
#chains in the Genus database with same CATH homology
 3H0G A;  1WCM A;  4O26 A;  4IP8 A;  3DU6 A;  2CW0 D;  1YNN D;  4FGU A;  5JSN B;  4NOM A;  5MLC 9;  1K4T A;  4NOL A;  1K83 A;  4QCL A;  1IW7 D;  3K5O A;  3K59 A;  1DD5 A;  1SMY D;  1R49 A;  5JSB B;  1LPQ A;  2R4G A;  1WQF A;  4QIW A;  4FXD A;  1NH3 A;  3M4A A;  2BE5 D;  2PMZ A;  1TWG A;  2JA7 A;  4NOK A;  3KYL A;  5CQG A;  1WQH A;  2B63 A;  3GTM A;  2JA5 A;  1MIU A;  1IS1 A;  1Q8I A;  4EJ3 A;  1K4S A;  3LHP S;  4Q5G A;  4L8I A;  4KC6 A;  2A69 D;  3GTL A;  4AYB A;  1TWF A;  1R9T A;  1TGO A;  1Y69 8;  2WB1 A;  1Y1W A;  3GTK A;  3WVO A;  4FYD A;  3K5L A;  2Y0S A;  2VUM A;  1I50 A;  2NVY A;  2YU9 A;  3K5N A;  4KB4 A;  1WQG A;  2R7Z A;  1A31 A;  1SFO A;  1YNJ D;  4OYD B;  5C9H A;  3LF9 A;  4IP9 A;  2A68 D;  3IAY A;  1A35 A;  4C2M A;  2O5J D;  2JA6 A;  1RR8 C;  2E2H A;  1V9M A;  3GTG A;  2R93 A;  2F4Q A;  2A6H D;  2NVX A;  1T8I A;  3GTJ A;  4JLR C;  3K58 A;  2E2I A;  2WAQ A;  4KB2 A;  2B9S B;  3GTQ A;  4H3T A;  1HQM D;  1A36 A;  4AHC A;  4Q5V A;  3SJR A;  3CQZ A;  1SC7 A;  4GFQ A;  3FKI A;  1I3Q A;  1RRJ A;  1TWH A;  1SEU A;  1EH1 A;  3K5M A;  2R92 A;  1TL8 A;  4D3Y A;  1EJ9 A;  4F3E A;  1TWA A;  3GTP A;  3MAQ A;  3K57 A;  4AN8 A;  1GE9 A;  1EK8 A;  1Y1V A;  4KAW X;  1TWC A;  1ISE A;  2A6E D;  3HKZ A;  4D3Z A;  1I6V D;  1R5Z A;  1ZYR D;  3GTO A;  4KDD A;  3DU5 A;  3P9A A;  4LMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...