4IP8A

Structure of human serum amyloid a1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
105
structure length
105
Chain Sequence
MRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serum amyloid A-1 protein
publication title Structural mechanism of serum amyloid A-mediated inflammatory amyloidosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 47
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00277 SAA Serum amyloid A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.110 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4ip8A00
4IP9A 4IP8A 4Q5GA
chains in the Genus database with same CATH superfamily
1HQMD 2B9SB 2F4QA 1TWCA 3DU6A 1DD5A 3H0GA 4GFQA 1A36A 2R7ZA 5C9HA 1YNND 2YU9A 3K58A 3K59A 4Q5GA 1TWGA 3MAQA 1V9MA 1IS1A 1LPQA 2WB1A 1NH3A 3LF9A 3LHPS 3GTKA 1ZYRD 4D3ZA 1SEUA 4O26A 1WQFA 4JLRC 4QCLA 3K57A 3FKIA 1MIUA 4D3YA 4OYDB 4EJ3A 1R49A 2A6ED 4Q5VA 4KC6A 1TGOA 4FYDA 4FXDA 3GTQA 2JA5A 2A68D 4AHCA 4QIWA 2CW0D 2A69D 4KB2A 1TWHA 1ISEA 2O5JD 3GTPA 4AYBA 1GE9A 1IW7D 1Y1WA 5JSNB 1K83A 3HKZA 2R93A 2R92A 4NOMA 3GTLA 3SJRA 4IP9A 1A31A 1TWAA 3KYLA 1YNJD 1EJ9A 4IP8A 2E2HA 1Y698 3IAYA 4LMOA 1A35A 1EK8A 4F3EA 1EH1A 3DU5A 1I50A 1R5ZA 2JA6A 3GTJA 3P9AA 1I3QA 2Y0SA 1TWFA 1RRJA 4C2MA 2E2IA 2R4GA 4L8IA 3K5LA 2BE5D 1RR8C 1K4SA 4FGUA 2VUMA 3M4AA 2JA7A 3GTGA 4NOKA 2WAQA 1WQGA 2PMZA 2NVXA 3CQZA 1SMYD 3GTOA 1Q8IA 1WCMA 3WVOA 5CQGA 1K4TA 1SFOA 2A6HD 4KAWX 3K5MA 4KB4A 1SC7A 1TL8A 4H3TA 4KDDA 1WQHA 2B63A 4NOLA 5MLC9 1I6VD 3GTMA 4AN8A 1R9TA 2NVYA 1T8IA 1Y1VA 3K5OA 5JSBB 3K5NA
chains in the Genus database with same CATH topology
1HQMD 2B9SB 2F4QA 1TWCA 3DU6A 1DD5A 3H0GA 4GFQA 1A36A 2R7ZA 5C9HA 1YNND 2YU9A 3K58A 3K59A 4Q5GA 1TWGA 3MAQA 1V9MA 1IS1A 1LPQA 2WB1A 1NH3A 3LF9A 3LHPS 3GTKA 1ZYRD 4D3ZA 1SEUA 4O26A 1WQFA 4JLRC 4QCLA 3K57A 3FKIA 1MIUA 4D3YA 4OYDB 4EJ3A 1R49A 2A6ED 4Q5VA 4KC6A 1TGOA 4FYDA 4FXDA 3GTQA 2JA5A 2A68D 4AHCA 4QIWA 2CW0D 2A69D 4KB2A 1TWHA 1ISEA 2O5JD 3GTPA 4AYBA 1GE9A 1IW7D 1Y1WA 5JSNB 1K83A 3HKZA 2R93A 2R92A 4NOMA 3GTLA 3SJRA 4IP9A 1A31A 1TWAA 3KYLA 1YNJD 1EJ9A 4IP8A 2E2HA 1Y698 3IAYA 4LMOA 1A35A 1EK8A 4F3EA 1EH1A 3DU5A 1I50A 1R5ZA 2JA6A 3GTJA 3P9AA 1I3QA 2Y0SA 1TWFA 1RRJA 4C2MA 2E2IA 2R4GA 4L8IA 3K5LA 2BE5D 1RR8C 1K4SA 4FGUA 2VUMA 3M4AA 2JA7A 3GTGA 4NOKA 2WAQA 1WQGA 2PMZA 2NVXA 3CQZA 1SMYD 3GTOA 1Q8IA 1WCMA 3WVOA 5CQGA 1K4TA 1SFOA 2A6HD 4KAWX 3K5MA 4KB4A 1SC7A 1TL8A 4H3TA 4KDDA 1WQHA 2B63A 4NOLA 5MLC9 1I6VD 3GTMA 4AN8A 1R9TA 2NVYA 1T8IA 1Y1VA 3K5OA 5JSBB 3K5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IP9 A;  4IP8 A;  4Q5G A; 
#chains in the Genus database with same CATH topology
 1HQM D;  2B9S B;  2F4Q A;  1TWC A;  3DU6 A;  1DD5 A;  3H0G A;  4GFQ A;  1A36 A;  2R7Z A;  5C9H A;  1YNN D;  2YU9 A;  3K58 A;  3K59 A;  4Q5G A;  1TWG A;  3MAQ A;  1V9M A;  1IS1 A;  1LPQ A;  2WB1 A;  1NH3 A;  3LF9 A;  3LHP S;  3GTK A;  1ZYR D;  4D3Z A;  1SEU A;  4O26 A;  1WQF A;  4JLR C;  4QCL A;  3K57 A;  3FKI A;  1MIU A;  4D3Y A;  4OYD B;  4EJ3 A;  1R49 A;  2A6E D;  4Q5V A;  4KC6 A;  1TGO A;  4FYD A;  4FXD A;  3GTQ A;  2JA5 A;  2A68 D;  4AHC A;  4QIW A;  2CW0 D;  2A69 D;  4KB2 A;  1TWH A;  1ISE A;  2O5J D;  3GTP A;  4AYB A;  1GE9 A;  1IW7 D;  1Y1W A;  5JSN B;  1K83 A;  3HKZ A;  2R93 A;  2R92 A;  4NOM A;  3GTL A;  3SJR A;  4IP9 A;  1A31 A;  1TWA A;  3KYL A;  1YNJ D;  1EJ9 A;  4IP8 A;  2E2H A;  1Y69 8;  3IAY A;  4LMO A;  1A35 A;  1EK8 A;  4F3E A;  1EH1 A;  3DU5 A;  1I50 A;  1R5Z A;  2JA6 A;  3GTJ A;  3P9A A;  1I3Q A;  2Y0S A;  1TWF A;  1RRJ A;  4C2M A;  2E2I A;  2R4G A;  4L8I A;  3K5L A;  2BE5 D;  1RR8 C;  1K4S A;  4FGU A;  2VUM A;  3M4A A;  2JA7 A;  3GTG A;  4NOK A;  2WAQ A;  1WQG A;  2PMZ A;  2NVX A;  3CQZ A;  1SMY D;  3GTO A;  1Q8I A;  1WCM A;  3WVO A;  5CQG A;  1K4T A;  1SFO A;  2A6H D;  4KAW X;  3K5M A;  4KB4 A;  1SC7 A;  1TL8 A;  4H3T A;  4KDD A;  1WQH A;  2B63 A;  4NOL A;  5MLC 9;  1I6V D;  3GTM A;  4AN8 A;  1R9T A;  2NVY A;  1T8I A;  1Y1V A;  3K5O A;  5JSB B;  3K5N A; 
#chains in the Genus database with same CATH homology
 1HQM D;  2B9S B;  2F4Q A;  1TWC A;  3DU6 A;  1DD5 A;  3H0G A;  4GFQ A;  1A36 A;  2R7Z A;  5C9H A;  1YNN D;  2YU9 A;  3K58 A;  3K59 A;  4Q5G A;  1TWG A;  3MAQ A;  1V9M A;  1IS1 A;  1LPQ A;  2WB1 A;  1NH3 A;  3LF9 A;  3LHP S;  3GTK A;  1ZYR D;  4D3Z A;  1SEU A;  4O26 A;  1WQF A;  4JLR C;  4QCL A;  3K57 A;  3FKI A;  1MIU A;  4D3Y A;  4OYD B;  4EJ3 A;  1R49 A;  2A6E D;  4Q5V A;  4KC6 A;  1TGO A;  4FYD A;  4FXD A;  3GTQ A;  2JA5 A;  2A68 D;  4AHC A;  4QIW A;  2CW0 D;  2A69 D;  4KB2 A;  1TWH A;  1ISE A;  2O5J D;  3GTP A;  4AYB A;  1GE9 A;  1IW7 D;  1Y1W A;  5JSN B;  1K83 A;  3HKZ A;  2R93 A;  2R92 A;  4NOM A;  3GTL A;  3SJR A;  4IP9 A;  1A31 A;  1TWA A;  3KYL A;  1YNJ D;  1EJ9 A;  4IP8 A;  2E2H A;  1Y69 8;  3IAY A;  4LMO A;  1A35 A;  1EK8 A;  4F3E A;  1EH1 A;  3DU5 A;  1I50 A;  1R5Z A;  2JA6 A;  3GTJ A;  3P9A A;  1I3Q A;  2Y0S A;  1TWF A;  1RRJ A;  4C2M A;  2E2I A;  2R4G A;  4L8I A;  3K5L A;  2BE5 D;  1RR8 C;  1K4S A;  4FGU A;  2VUM A;  3M4A A;  2JA7 A;  3GTG A;  4NOK A;  2WAQ A;  1WQG A;  2PMZ A;  2NVX A;  3CQZ A;  1SMY D;  3GTO A;  1Q8I A;  1WCM A;  3WVO A;  5CQG A;  1K4T A;  1SFO A;  2A6H D;  4KAW X;  3K5M A;  4KB4 A;  1SC7 A;  1TL8 A;  4H3T A;  4KDD A;  1WQH A;  2B63 A;  4NOL A;  5MLC 9;  1I6V D;  3GTM A;  4AN8 A;  1R9T A;  2NVY A;  1T8I A;  1Y1V A;  3K5O A;  5JSB B;  3K5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...