4GFQA

2.65 angstrom resolution crystal structure of ribosome recycling factor (frr) from bacillus anthracis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
186
structure length
186
Chain Sequence
AMGQQVLKFSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPYDKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLVKVVKKYAEEAKVAVRNVRRDGNDDLKKLEKAGEITEDDLRGYTEDIQKETDKYIAKVDEIAKNKEKEIMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.65 Angstrom Resolution Crystal Structure of Ribosome Recycling Factor (frr) from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 70
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4gfqA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gfqA02
1WQHA 3LAPA 4L8IA 4OYDB 3BUEA 2PHCB 2XCOA 5JSBB 1XXAA 1GE9A 3LAJA 4JLRC 1XXBA 5MLC9 2RGRA 1XXCA 3LHPS 4KB2A 1ZVUA 1BJTA 4KB4A 2XCQA 1AB4A 3OREA 2Y3PA 3VA7A 2ZFZA 3CAGA 3ERED 1WQFA 1DD5A 1WIHA 3L4JA 1F9NA 5JSNB 4GFQA 1WQGA 4KC6A 1Y698 2P5MA 3LPXA 4DDQA 3QX3A 1B4BA 4J3NA 1EK8A 4KAWX 4G0WA 5JVOA 4FM9A 4KDDA 4G0UA 1B4AA 3V4GA 3FOFA 5CJ9A 1EH1A 3NUHA 3FHZA 3OPFA 3FOEA 2KWAA 2XCRB 3LF9A 4G0VA 1ISEA 3OEPA 1IS1A 3MMLB 1BGWA 3L4KA
chains in the Genus database with same CATH superfamily
2A6HA 3HOYC 1IE0A 1WOOA 5JSBB 1YCLA 4AYBD 3DU5A 3HOXK 4AN8A 4WJ4A 4A93K 3T00A 2P8TA 1AB4A 3AD7C 4OIQA 1T8IA 3S14K 2E2HC 1VH2A 2WAQA 4NOMA 4P5AA 5M3FK 3AD8C 3S1RC 3S2DC 2E2IC 1O2BA 5FLMK 1TWGK 1YNJD 3TFJA 3PO2K 5C9HA 1TWCC 3MMLB 4XLNA 3L4KA 2O5JA 3P9AA 3LAPA 3TFHA 3HOUC 4LJZA 4A3GK 4OINA 2GSOA 2WB1D 3N0BA 5C4JC 2B63C 4GTEA 4C3HC 4GTLA 4D3YA 4Q5VA 1SFOK 1BJTA 2R93C 2VUMK 5CHPA 2V6SA 5C4XK 3SJRA 3LPXA 1V5VA 1Y698 1EK8A 3TTGA 3V4GA 5CJ9A 1V9MA 5JFEA 1YX2A 4A3BC 1HI9A 2A68A 1WCMC 1O24A 5CQGA 5IP9K 1WCMA 3S17K 4AHCA 2R4GA 2WB1A 1XXAA 2JA5K 4LR2A 4BBRC 1O2FB 1R9TC 2GAHC 2Y3PA 3VA7A 3ERED 1UV7A 3I4NC 1ZYRA 2A6ED 3IAYA 2R92C 4KMDA 3QX3A 2NVXA 2WAQD 4G0WA 4A3IC 3GTOC 1O27A 1JQWA 2CFAA 3GTGC 4GZYA 1WORA 3FOEA 3OPFA 1O29A 4G0VA 3I4MK 5IOTA 4QIWD 3H0GA 1TWFC 3FKIC 2A6HD 1IQ0A 2F4QA 2GSUA 2ZUFA 2E2JC 2XCQA 1HQMA 4FXDA 4BY7C 1R49A 5JSNB 1SEUA 1IW7A 4C3IC 1I6VA 2NVXK 2YU9A 5JVOA 3H3VD 2JA7C 1K4TA 3HOVK 2E2IK 1J6WA 2WB1L 1YNND 1YNJA 2JA6K 1Y1VK 1ISEA 3OEPA 3GTMK 5E68A 4C2MK 3BUEA 4YFXA 5C4JK 1Y1VA 3GTMA 4C3JK 4GTBA 4WJ3M 3K58A 1XZQA 3K59A 3BP3A 1K83K 1DD5A 4C45A 4A3FK 1ZXOA 4NOIA 1B4BA 3GTKC 3M3YC 1R5ZA 4EJ3A 4FYDA 4XSZA 1SMYD 3GTJA 4FGUA 2NVYC 4BKWA 3H3VL 1I3QC 5IYBK 4XLPA 2NVQK 3S1NK 3S14C 3PO3C 3GTJK 4KN7A 2XCOA 3GTOA 1WOSA 2BE5A 2O5JD 3HOWC 3S1RK 5TJ3A 2R92A 2ZFZA 1WQFA 3T02A 2W7VA 4FZBA 2JA6C 3GTLK 2JA5A 3HOUK 4Y7NC 2R7ZA 3GEHA 3K7AK 1TGOA 2FQTA 4A3KC 1G51A 1L0WA 4BBSK 3AQPA 1I6HK 2PMZA 4NOLA 4MQ9A 1WCMK 2VUMC 1IL2A 3IPJA 3SZYA 4RMFA 4Q4ZA 3S15K 1WQHA 3WODA 4BXXK 3S16K 3S1MK 4AYBA 1TL8A 1A31A 3LAJA 4A3EC 3A8IA 4YFKA 4JLRC 1USOA 4MEYA 4QJVA 4BBRK 5IP7C 4O2DA 4KB2A 5IYCK 1R9TK 4A3JC 2WAQL 4A3LC 3I4NK 4LQYA 1I50A 4Q5SA 4BLBA 2R93A 4KC6A 4LK0A 3S1NC 1EI6A 4XSXA 4A3MC 4IP8A 1RU0A 1USMA 2B63A 1I50K 1B4AA 4C3HK 2R93K 5FLMC 1VLOA 1TWCA 4Q5GA 4AH6A 3S1QC 2YU9K 3H0GK 2A69A 4L8IA 2E2IA 1GE9A 1WSVA 4A3KK 4BBSC 1I6HC 3AD9C 3DXJA 1SFOC 1O25A 5C3EC 1PJ7A 1XZPA 3HXAA 3HKZL 3GEEA 3GTQK 3L4JA 4A3FC 1EQRA 4GFQA 1F9NA 3S15C 3HKZD 1BDFA 1A36A 4D3ZA 1TWHA 4OIPA 2PA8D 4GTAA 4X6AC 1F93A 4KM9A 4A93C 2Y0SA 1O2AA 1RRJA 3LF9A 2NVTC 3M4OK 1INNA 3DU6A 4C2MC 4A3CK 4Y52C 2CW0D 5MLC9 3HOZK 2B9SB 1F7UA 1K83C 1C0AA 1DCPA 2FQOA 3RZOC 4F3EA 4FM9A 4G0UA 3AH5A 1TWAC 3GIRA 1IBAA 3G4CA 1I3QK 2KWAA 5IP9C 2XCRB 4WILA 2V6UA 2E2HK 3GTKA 1TWGA 4OYDB 1WSRA 2GSNA 2PHCB 3TFIA 4C3IK 4KM8A 3S1MC 3A8KA 5FJ8K 3GEIA 4O26A 1K4SA 4KN4A 4X6AK 3LHPS 3AQOA 2E2JK 3GTLA 3K5MA 3EQLA 5L46A 4BY1C 3CAGA 1Y1VC 3GTMC 4BY7K 3M4OC 2R92K 3GTPA 4KATA 4A3DC 4A3GC 3K7AC 4KAWX 4Y52K 2JA7K 5M3MK 2A69D 4G7ZA 5IOSA 5IYDK 1PJ6A 2JA7A 1TWHC 1XXCA 2YU9C 3GTKK 4G7HA 5TMCA 4Y7NK 5D4DA 2R7ZK 3RZDK 5TMFA 5EGEA 3GDZA 1SFOA 4A3JK 3ADAC 3MAQA 5C4XC 3FKIA 4ILDA 3BP8C 1WOPA 3M4AA 3HOYK 4H3TA 1TWFK 4IP9A 3K5OA 1JVIA 3WVOA 3K57A 1TWGC 4GTCA 2PPBA 3GTGA 4A3BK 4AYBL 1KQ4A 1J98A 3K5LA 2PMZL 4G7OA 4A3IK 1I50C 3S2DK 4LMOA 1J6XA 3CQZA 1K83A 1BS2A 4XCHA 1WIHA 4QIWL 3Q3QA 1TWCK 1TWHK 2CW0A 1Y1WC 2JA8K 3T01A 1IW7D 1IS1A 4KARA 4C2MA 4OIOA 3GTGK 4QJVB 1LPQA 2Y0SD 2PMZD 4J3NA 2NVQC 3NUHA 4M1XA 1SC7A 1MIUA 4KMHA 5M5WK 2JA5C 5M5XK 4A3EK 4NOKA 2JA6A 2JH3A 3JSTA 1F7VA 1Y1WA 2D6FC 3HOVC 1DCHA 4KB4A 2GAGC 4BY1K 3CQZC 4LLGA 3N0CA 4A3MK 2Y0SL 3A8JA 1XZPB 1NH3A 3N3YA 5C44C 4KDDA 5IOQA 3HOWK 4GTFA 1I3QA 4MEXA 1ZYRD 3KYLA 2NVYA 3GTPK 4YFNA 3PO2C 1YNNA 4KMAA 1X31C 2E2HA 2CFAB 3GSIA 3HKZA 1A35A 3HOXC 2JA8C 2RGRA 1XZQB 4JK1A 4KASA 5IYCC 4OIRA 3RZDC 2EBBA 3OREA 1VJEA 4P9SA 1J6VA 4GTDA 1SMYA 2P5MA 4BXXC 5HL8A 3G4AA 5IP7K 1EH1A 2NVYK 3SZZA 2ZUEA 5IYBC 2VUMA 3S17C 1EFWA 1XPPA 3S2HC 3GTOK 5C44K 2R7ZC 2A6EA 1VRQC 1O28A 1JOEA 4ZH4A 3GTPC 3I4MC 3GTQC 3GTLC 1TWFA 3H0GC 3S16C 3FKIK 5M5YK 1I6VD 1DCOA 3K5NA 3S0XA 4GT9A 1O26A 5IORA 1TWAK 3FHZA 2NVTK 2A68D 4PABA 1BGWA 4YG2A 3GTJC 1TWAA 2NVXC 2RH6A 3M3YK 1Q8IA 4QCLA 3GTQA 1EJ9A 4QIWA 1XXBA 4LOWA 4LK1A 1PJ5A 1ZBSA 2PA8L 1ZVUA 3HOZC 1R9TA 3S1QK 4A3LK 4KMUA 3CQZK 1WQGA 4DDQA 4A3DK 3S2HK 2BE5D 4P5BA 3RZOK 3PO3K 1VGXA 1Y1WK 4A3CC 1RR8C 2B63K 2O5IA 4PAAA 5EGHA 4BLAA 4C3JC 3FOFA 2V6TA 5C3EK 1HQMD 5IYDC 1ZQ1C
chains in the Genus database with same CATH topology
4C2MC 1SC7A 3BUEA 1MIUA 5JSBB 4KMHA 2CW0D 3DU5A 4NOKA 2JA6A 2JH3A 1Y1VA 4AN8A 5MLC9 3GTMA 1Y1WA 4GTBA 4KB4A 3K58A 2B9SB 1AB4A 3K59A 1DD5A 1T8IA 1ZXOA 1B4BA 3N0CA 4F3EA 2WAQA 4NOMA 4P5AA 3N3YA 1NH3A 1R5ZA 4FM9A 4KDDA 5IOQA 4G0UA 4EJ3A 3AH5A 4FYDA 1O2BA 1I3QA 1SMYD 4GTFA 3GTJA 1YNJD 1ZYRD 4FGUA 2NVYA 3KYLA 4BKWA 3G4CA 2KWAA 2XCRB 5C9HA 4KMAA 3MMLB 3L4KA 3P9AA 3LAPA 3GTKA 1TWGA 4OYDB 2GSNA 2PHCB 2XCOA 2E2HA 2CFAB 4KM8A 2GSOA 3GTOA 3N0BA 3HKZA 1A35A 2O5JD 4O26A 4GTEA 2RGRA 5TJ3A 1K4SA 4C3HC 4KASA 4GTLA 3LHPS 4D3YA 4Q5VA 1BJTA 3AQOA 3GTLA 3K5MA 2R92A 3OREA 5CHPA 2ZFZA 3CAGA 1WQFA 4GTDA 3SJRA 3GTPA 4FZBA 4KATA 3LPXA 2JA5A 2P5MA 1Y698 4J3NA 1EK8A 4KAWX 2R7ZA 1TGOA 3G4AA 3V4GA 5CJ9A 3AQPA 2A69D 2PMZA 4NOLA 1V9MA 5IOSA 5JFEA 1EH1A 1O24A 5CQGA 1WCMA 2JA7A 2VUMA 1XXCA 1WQHA 4AHCA 2R4GA 3L4JA 2WB1A 4AYBA 1TL8A 1A31A 1XXAA 3LAJA 4LR2A 4JLRC 4KB2A 1O28A 5EGEA 1SFOA 2Y3PA 3VA7A 4LQYA 1I50A 3ERED 3MAQA 2A6ED 3IAYA 4BLBA 3FKIA 4ILDA 2R93A 1TWFA 4KC6A 4KMDA 3M4AA 3QX3A 2NVXA 4IP8A 4H3TA 4G0WA 2B63A 1I6VD 4IP9A 3K5OA 3K5NA 3WVOA 1B4AA 1O27A 3K57A 3S0XA 2CFAA 1O26A 4GT9A 5IORA 4GTCA 3GTGA 3FHZA 1TWCA 4Q5GA 1KQ4A 1O29A 3OPFA 3FOEA 2A68D 4G0VA 3K5LA 1BGWA 5IOTA 1TWAA 4L8IA 2RH6A 2E2IA 3H0GA 1Q8IA 2A6HD 1GE9A 4QCLA 3GTQA 1EJ9A 4QIWA 2F4QA 1XXBA 1ZBSA 4LMOA 1ZVUA 2GSUA 1R9TA 2XCQA 1O25A 3CQZA 4FXDA 1K83A 1WIHA 1R49A 3Q3QA 1F9NA 1WQGA 4GFQA 5JSNB 1SEUA 2BE5D 4P5BA 4DDQA 4C3IC 1A36A 4D3ZA 1TWHA 2YU9A 1RR8C 5JVOA 1K4TA 5EGHA 4BLAA 1IW7D 4GTAA 4C3JC 3FOFA 4KARA 4KM9A 4C2MA 1YNND 2Y0SA 1HQMD 1LPQA 1O2AA 1RRJA 3LF9A 1ISEA 3OEPA 1IS1A 3DU6A 3NUHA 4M1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQH A;  3LAP A;  4L8I A;  4OYD B;  3BUE A;  2PHC B;  2XCO A;  5JSB B;  1XXA A;  1GE9 A;  3LAJ A;  4JLR C;  1XXB A;  5MLC 9;  2RGR A;  1XXC A;  3LHP S;  4KB2 A;  1ZVU A;  1BJT A;  4KB4 A;  2XCQ A;  1AB4 A;  3ORE A;  2Y3P A;  3VA7 A;  2ZFZ A;  3CAG A;  3ERE D;  1WQF A;  1DD5 A;  1WIH A;  3L4J A;  1F9N A;  5JSN B;  4GFQ A;  1WQG A;  4KC6 A;  1Y69 8;  2P5M A;  3LPX A;  4DDQ A;  3QX3 A;  1B4B A;  4J3N A;  1EK8 A;  4KAW X;  4G0W A;  5JVO A;  4FM9 A;  4KDD A;  4G0U A;  1B4A A;  3V4G A;  3FOF A;  5CJ9 A;  1EH1 A;  3NUH A;  3FHZ A;  3OPF A;  3FOE A;  2KWA A;  2XCR B;  3LF9 A;  4G0V A;  1ISE A;  3OEP A;  1IS1 A;  3MML B;  1BGW A;  3L4K A; 
#chains in the Genus database with same CATH topology
 2A6H A;  3HOY C;  1IE0 A;  1WOO A;  5JSB B;  1YCL A;  4AYB D;  3DU5 A;  3HOX K;  4AN8 A;  4WJ4 A;  4A93 K;  3T00 A;  2P8T A;  1AB4 A;  3AD7 C;  4OIQ A;  1T8I A;  3S14 K;  2E2H C;  1VH2 A;  2WAQ A;  4NOM A;  4P5A A;  5M3F K;  3AD8 C;  3S1R C;  3S2D C;  2E2I C;  1O2B A;  5FLM K;  1TWG K;  1YNJ D;  3TFJ A;  3PO2 K;  5C9H A;  1TWC C;  3MML B;  4XLN A;  3L4K A;  2O5J A;  3P9A A;  3LAP A;  3TFH A;  3HOU C;  4LJZ A;  4A3G K;  4OIN A;  2GSO A;  2WB1 D;  3N0B A;  5C4J C;  2B63 C;  4GTE A;  4C3H C;  4GTL A;  4D3Y A;  4Q5V A;  1SFO K;  1BJT A;  2R93 C;  2VUM K;  5CHP A;  2V6S A;  5C4X K;  3SJR A;  3LPX A;  1V5V A;  1Y69 8;  1EK8 A;  3TTG A;  3V4G A;  5CJ9 A;  1V9M A;  5JFE A;  1YX2 A;  4A3B C;  1HI9 A;  2A68 A;  1WCM C;  1O24 A;  5CQG A;  5IP9 K;  1WCM A;  3S17 K;  4AHC A;  2R4G A;  2WB1 A;  1XXA A;  2JA5 K;  4LR2 A;  4BBR C;  1O2F B;  1R9T C;  2GAH C;  2Y3P A;  3VA7 A;  3ERE D;  1UV7 A;  3I4N C;  1ZYR A;  2A6E D;  3IAY A;  2R92 C;  4KMD A;  3QX3 A;  2NVX A;  2WAQ D;  4G0W A;  4A3I C;  3GTO C;  1O27 A;  1JQW A;  2CFA A;  3GTG C;  4GZY A;  1WOR A;  3FOE A;  3OPF A;  1O29 A;  4G0V A;  3I4M K;  5IOT A;  4QIW D;  3H0G A;  1TWF C;  3FKI C;  2A6H D;  1IQ0 A;  2F4Q A;  2GSU A;  2ZUF A;  2E2J C;  2XCQ A;  1HQM A;  4FXD A;  4BY7 C;  1R49 A;  5JSN B;  1SEU A;  1IW7 A;  4C3I C;  1I6V A;  2NVX K;  2YU9 A;  5JVO A;  3H3V D;  2JA7 C;  1K4T A;  3HOV K;  2E2I K;  1J6W A;  2WB1 L;  1YNN D;  1YNJ A;  2JA6 K;  1Y1V K;  1ISE A;  3OEP A;  3GTM K;  5E68 A;  4C2M K;  3BUE A;  4YFX A;  5C4J K;  1Y1V A;  3GTM A;  4C3J K;  4GTB A;  4WJ3 M;  3K58 A;  1XZQ A;  3K59 A;  3BP3 A;  1K83 K;  1DD5 A;  4C45 A;  4A3F K;  1ZXO A;  4NOI A;  1B4B A;  3GTK C;  3M3Y C;  1R5Z A;  4EJ3 A;  4FYD A;  4XSZ A;  1SMY D;  3GTJ A;  4FGU A;  2NVY C;  4BKW A;  3H3V L;  1I3Q C;  5IYB K;  4XLP A;  2NVQ K;  3S1N K;  3S14 C;  3PO3 C;  3GTJ K;  4KN7 A;  2XCO A;  3GTO A;  1WOS A;  2BE5 A;  2O5J D;  3HOW C;  3S1R K;  5TJ3 A;  2R92 A;  2ZFZ A;  1WQF A;  3T02 A;  2W7V A;  4FZB A;  2JA6 C;  3GTL K;  2JA5 A;  3HOU K;  4Y7N C;  2R7Z A;  3GEH A;  3K7A K;  1TGO A;  2FQT A;  4A3K C;  1G51 A;  1L0W A;  4BBS K;  3AQP A;  1I6H K;  2PMZ A;  4NOL A;  4MQ9 A;  1WCM K;  2VUM C;  1IL2 A;  3IPJ A;  3SZY A;  4RMF A;  4Q4Z A;  3S15 K;  1WQH A;  3WOD A;  4BXX K;  3S16 K;  3S1M K;  4AYB A;  1TL8 A;  1A31 A;  3LAJ A;  4A3E C;  3A8I A;  4YFK A;  4JLR C;  1USO A;  4MEY A;  4QJV A;  4BBR K;  5IP7 C;  4O2D A;  4KB2 A;  5IYC K;  1R9T K;  4A3J C;  2WAQ L;  4A3L C;  3I4N K;  4LQY A;  1I50 A;  4Q5S A;  4BLB A;  2R93 A;  4KC6 A;  4LK0 A;  3S1N C;  1EI6 A;  4XSX A;  4A3M C;  4IP8 A;  1RU0 A;  1USM A;  2B63 A;  1I50 K;  1B4A A;  4C3H K;  2R93 K;  5FLM C;  1VLO A;  1TWC A;  4Q5G A;  4AH6 A;  3S1Q C;  2YU9 K;  3H0G K;  2A69 A;  4L8I A;  2E2I A;  1GE9 A;  1WSV A;  4A3K K;  4BBS C;  1I6H C;  3AD9 C;  3DXJ A;  1SFO C;  1O25 A;  5C3E C;  1PJ7 A;  1XZP A;  3HXA A;  3HKZ L;  3GEE A;  3GTQ K;  3L4J A;  4A3F C;  1EQR A;  4GFQ A;  1F9N A;  3S15 C;  3HKZ D;  1BDF A;  1A36 A;  4D3Z A;  1TWH A;  4OIP A;  2PA8 D;  4GTA A;  4X6A C;  1F93 A;  4KM9 A;  4A93 C;  2Y0S A;  1O2A A;  1RRJ A;  3LF9 A;  2NVT C;  3M4O K;  1INN A;  3DU6 A;  4C2M C;  4A3C K;  4Y52 C;  2CW0 D;  5MLC 9;  3HOZ K;  2B9S B;  1F7U A;  1K83 C;  1C0A A;  1DCP A;  2FQO A;  3RZO C;  4F3E A;  4FM9 A;  4G0U A;  3AH5 A;  1TWA C;  3GIR A;  1IBA A;  3G4C A;  1I3Q K;  2KWA A;  5IP9 C;  2XCR B;  4WIL A;  2V6U A;  2E2H K;  3GTK A;  1TWG A;  4OYD B;  1WSR A;  2GSN A;  2PHC B;  3TFI A;  4C3I K;  4KM8 A;  3S1M C;  3A8K A;  5FJ8 K;  3GEI A;  4O26 A;  1K4S A;  4KN4 A;  4X6A K;  3LHP S;  3AQO A;  2E2J K;  3GTL A;  3K5M A;  3EQL A;  5L46 A;  4BY1 C;  3CAG A;  1Y1V C;  3GTM C;  4BY7 K;  3M4O C;  2R92 K;  3GTP A;  4KAT A;  4A3D C;  4A3G C;  3K7A C;  4KAW X;  4Y52 K;  2JA7 K;  5M3M K;  2A69 D;  4G7Z A;  5IOS A;  5IYD K;  1PJ6 A;  2JA7 A;  1TWH C;  1XXC A;  2YU9 C;  3GTK K;  4G7H A;  5TMC A;  4Y7N K;  5D4D A;  2R7Z K;  3RZD K;  5TMF A;  5EGE A;  3GDZ A;  1SFO A;  4A3J K;  3ADA C;  3MAQ A;  5C4X C;  3FKI A;  4ILD A;  3BP8 C;  1WOP A;  3M4A A;  3HOY K;  4H3T A;  1TWF K;  4IP9 A;  3K5O A;  1JVI A;  3WVO A;  3K57 A;  1TWG C;  4GTC A;  2PPB A;  3GTG A;  4A3B K;  4AYB L;  1KQ4 A;  1J98 A;  3K5L A;  2PMZ L;  4G7O A;  4A3I K;  1I50 C;  3S2D K;  4LMO A;  1J6X A;  3CQZ A;  1K83 A;  1BS2 A;  4XCH A;  1WIH A;  4QIW L;  3Q3Q A;  1TWC K;  1TWH K;  2CW0 A;  1Y1W C;  2JA8 K;  3T01 A;  1IW7 D;  1IS1 A;  4KAR A;  4C2M A;  4OIO A;  3GTG K;  4QJV B;  1LPQ A;  2Y0S D;  2PMZ D;  4J3N A;  2NVQ C;  3NUH A;  4M1X A;  1SC7 A;  1MIU A;  4KMH A;  5M5W K;  2JA5 C;  5M5X K;  4A3E K;  4NOK A;  2JA6 A;  2JH3 A;  3JST A;  1F7V A;  1Y1W A;  2D6F C;  3HOV C;  1DCH A;  4KB4 A;  2GAG C;  4BY1 K;  3CQZ C;  4LLG A;  3N0C A;  4A3M K;  2Y0S L;  3A8J A;  1XZP B;  1NH3 A;  3N3Y A;  5C44 C;  4KDD A;  5IOQ A;  3HOW K;  4GTF A;  1I3Q A;  4MEX A;  1ZYR D;  3KYL A;  2NVY A;  3GTP K;  4YFN A;  3PO2 C;  1YNN A;  4KMA A;  1X31 C;  2E2H A;  2CFA B;  3GSI A;  3HKZ A;  1A35 A;  3HOX C;  2JA8 C;  2RGR A;  1XZQ B;  4JK1 A;  4KAS A;  5IYC C;  4OIR A;  3RZD C;  2EBB A;  3ORE A;  1VJE A;  4P9S A;  1J6V A;  4GTD A;  1SMY A;  2P5M A;  4BXX C;  5HL8 A;  3G4A A;  5IP7 K;  1EH1 A;  2NVY K;  3SZZ A;  2ZUE A;  5IYB C;  2VUM A;  3S17 C;  1EFW A;  1XPP A;  3S2H C;  3GTO K;  5C44 K;  2R7Z C;  2A6E A;  1VRQ C;  1O28 A;  1JOE A;  4ZH4 A;  3GTP C;  3I4M C;  3GTQ C;  3GTL C;  1TWF A;  3H0G C;  3S16 C;  3FKI K;  5M5Y K;  1I6V D;  1DCO A;  3K5N A;  3S0X A;  4GT9 A;  1O26 A;  5IOR A;  1TWA K;  3FHZ A;  2NVT K;  2A68 D;  4PAB A;  1BGW A;  4YG2 A;  3GTJ C;  1TWA A;  2NVX C;  2RH6 A;  3M3Y K;  1Q8I A;  4QCL A;  3GTQ A;  1EJ9 A;  4QIW A;  1XXB A;  4LOW A;  4LK1 A;  1PJ5 A;  1ZBS A;  2PA8 L;  1ZVU A;  3HOZ C;  1R9T A;  3S1Q K;  4A3L K;  4KMU A;  3CQZ K;  1WQG A;  4DDQ A;  4A3D K;  3S2H K;  2BE5 D;  4P5B A;  3RZO K;  3PO3 K;  1VGX A;  1Y1W K;  4A3C C;  1RR8 C;  2B63 K;  2O5I A;  4PAA A;  5EGH A;  4BLA A;  4C3J C;  3FOF A;  2V6T A;  5C3E K;  1HQM D;  5IYD C;  1ZQ1 C; 
#chains in the Genus database with same CATH homology
 4C2M C;  1SC7 A;  3BUE A;  1MIU A;  5JSB B;  4KMH A;  2CW0 D;  3DU5 A;  4NOK A;  2JA6 A;  2JH3 A;  1Y1V A;  4AN8 A;  5MLC 9;  3GTM A;  1Y1W A;  4GTB A;  4KB4 A;  3K58 A;  2B9S B;  1AB4 A;  3K59 A;  1DD5 A;  1T8I A;  1ZXO A;  1B4B A;  3N0C A;  4F3E A;  2WAQ A;  4NOM A;  4P5A A;  3N3Y A;  1NH3 A;  1R5Z A;  4FM9 A;  4KDD A;  5IOQ A;  4G0U A;  4EJ3 A;  3AH5 A;  4FYD A;  1O2B A;  1I3Q A;  1SMY D;  4GTF A;  3GTJ A;  1YNJ D;  1ZYR D;  4FGU A;  2NVY A;  3KYL A;  4BKW A;  3G4C A;  2KWA A;  2XCR B;  5C9H A;  4KMA A;  3MML B;  3L4K A;  3P9A A;  3LAP A;  3GTK A;  1TWG A;  4OYD B;  2GSN A;  2PHC B;  2XCO A;  2E2H A;  2CFA B;  4KM8 A;  2GSO A;  3GTO A;  3N0B A;  3HKZ A;  1A35 A;  2O5J D;  4O26 A;  4GTE A;  2RGR A;  5TJ3 A;  1K4S A;  4C3H C;  4KAS A;  4GTL A;  3LHP S;  4D3Y A;  4Q5V A;  1BJT A;  3AQO A;  3GTL A;  3K5M A;  2R92 A;  3ORE A;  5CHP A;  2ZFZ A;  3CAG A;  1WQF A;  4GTD A;  3SJR A;  3GTP A;  4FZB A;  4KAT A;  3LPX A;  2JA5 A;  2P5M A;  1Y69 8;  4J3N A;  1EK8 A;  4KAW X;  2R7Z A;  1TGO A;  3G4A A;  3V4G A;  5CJ9 A;  3AQP A;  2A69 D;  2PMZ A;  4NOL A;  1V9M A;  5IOS A;  5JFE A;  1EH1 A;  1O24 A;  5CQG A;  1WCM A;  2JA7 A;  2VUM A;  1XXC A;  1WQH A;  4AHC A;  2R4G A;  3L4J A;  2WB1 A;  4AYB A;  1TL8 A;  1A31 A;  1XXA A;  3LAJ A;  4LR2 A;  4JLR C;  4KB2 A;  1O28 A;  5EGE A;  1SFO A;  2Y3P A;  3VA7 A;  4LQY A;  1I50 A;  3ERE D;  3MAQ A;  2A6E D;  3IAY A;  4BLB A;  3FKI A;  4ILD A;  2R93 A;  1TWF A;  4KC6 A;  4KMD A;  3M4A A;  3QX3 A;  2NVX A;  4IP8 A;  4H3T A;  4G0W A;  2B63 A;  1I6V D;  4IP9 A;  3K5O A;  3K5N A;  3WVO A;  1B4A A;  1O27 A;  3K57 A;  3S0X A;  2CFA A;  1O26 A;  4GT9 A;  5IOR A;  4GTC A;  3GTG A;  3FHZ A;  1TWC A;  4Q5G A;  1KQ4 A;  1O29 A;  3OPF A;  3FOE A;  2A68 D;  4G0V A;  3K5L A;  1BGW A;  5IOT A;  1TWA A;  4L8I A;  2RH6 A;  2E2I A;  3H0G A;  1Q8I A;  2A6H D;  1GE9 A;  4QCL A;  3GTQ A;  1EJ9 A;  4QIW A;  2F4Q A;  1XXB A;  1ZBS A;  4LMO A;  1ZVU A;  2GSU A;  1R9T A;  2XCQ A;  1O25 A;  3CQZ A;  4FXD A;  1K83 A;  1WIH A;  1R49 A;  3Q3Q A;  1F9N A;  1WQG A;  4GFQ A;  5JSN B;  1SEU A;  2BE5 D;  4P5B A;  4DDQ A;  4C3I C;  1A36 A;  4D3Z A;  1TWH A;  2YU9 A;  1RR8 C;  5JVO A;  1K4T A;  5EGH A;  4BLA A;  1IW7 D;  4GTA A;  4C3J C;  3FOF A;  4KAR A;  4KM9 A;  4C2M A;  1YNN D;  2Y0S A;  1HQM D;  1LPQ A;  1O2A A;  1RRJ A;  3LF9 A;  1ISE A;  3OEP A;  1IS1 A;  3DU6 A;  3NUH A;  4M1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...