4GFQA

2.65 angstrom resolution crystal structure of ribosome recycling factor (frr) from bacillus anthracis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
186
structure length
186
Chain Sequence
b'AMGQQVLKFSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPYDKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLVKVVKKYAEEAKVAVRNVRRDGNDDLKKLEKAGEITEDDLRGYTEDIQKETDKYIAKVDEIAKNKEKEIMEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title 2.65 Angstrom Resolution Crystal Structure of Ribosome Recycling Factor (frr) from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Translation
total genus 70
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4gfqA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gfqA02
3CAGA 1ZVUA 3LHPS 4L8IA 2XCQA 3OPFA 3FHZA 2XCOA 4OYDB 4J3NA 4KDDA 1WIHA 1ISEA 4GFQA 3LAJA 1DD5A 1BJTA 3NUHA 3V4GA 3FOEA 5CJ9A 4KAWX 1WQHA 2KWAA 1F9NA 2RGRA 1IS1A 4FM9A 3OEPA 4JLRC 1B4AA 3MMLB 4G0VA 1XXBA 3OREA 1B4BA 3BUEA 3LPXA 3L4KA 3QX3A 1BGWA 3ERED 1XXCA 2XCRB 3LAPA 4G0WA 1GE9A 2PHCB 4DDQA 3L4JA 1XXAA 1WQGA 1EH1A 4KC6A 5JSBB 5MLC9 5JVOA 2P5MA 3FOFA 1Y698 4G0UA 4KB4A 3VA7A 1EK8A 5JSNB 2ZFZA 1WQFA 2Y3PA 4KB2A 3LF9A 1AB4A
chains in the Genus database with same CATH superfamily
1ZVUA 2B63K 4GTFA 3T01A 2PPBA 4GTDA 4GT9A 1JVIA 4KMHA 3HKZL 2WB1D 2FQOA 2NVTC 2JA8K 1TWCA 4D3ZA 4OIOA 3MMLB 1VJEA 1T8IA 5TJ3A 2PMZD 3RZDK 1YNJA 5IYBK 3HXAA 1F93A 1UV7A 2BE5D 4A3LK 2O5JD 4JK1A 2Y0SA 1Y698 1ZQ1C 3P9AA 1J6WA 3GSIA 4C3HK 3K59A 1K4SA 2E2HC 4OIRA 1PJ7A 2XCOA 4MEYA 4KDDA 3GTOA 1C0AA 1Y1WA 3M3YK 1BJTA 1XZQB 3FOEA 4GTLA 3HOZC 2JA6K 4AHCA 3H3VD 2YU9K 3OREA 2FQTA 4PABA 4FXDA 1TL8A 1XXCA 3FKIC 1SMYD 1GE9A 4BLBA 4DDQA 1DCPA 4P5BA 4A3EK 2R92C 3S1RK 2PA8D 2WAQL 2R93C 3GIRA 5FJ8K 1USMA 3HOWC 1IBAA 2E2IK 5JSNB 2NVXA 2A68A 1I50K 1VGXA 4LJZA 4NOMA 5HL8A 3M4OK 1DD5A 2NVYK 1TWAK 4AN8A 1K83K 1BDFA 4FM9A 1EFWA 4QIWA 1ZYRD 1TWHC 3DXJA 4BXXK 5D4DA 1TWFC 3PO3C 3S2DC 3HOYC 3GTPA 3ERED 3GTLC 1O29A 2PHCB 2JA7K 4BY7K 5MLC9 4YFNA 1A36A 1XZQA 4KMAA 5M3FK 2A68D 2WB1L 5IP9C 2XCQA 4AYBA 1R9TK 4J3NA 5C4XC 3GTMC 1IW7A 1I6VD 1O24A 1IE0A 2PMZL 4P5AA 2B63C 2RH6A 2V6UA 3S2HK 3BUEA 3LPXA 1F7UA 5C3EK 2JA8C 4LK1A 2JA6A 4A3KK 1WOSA 2GSOA 4C3JC 3SJRA 2YU9A 5JSBB 4A93K 5IYBC 3A8IA 4G0UA 3GTOK 1VH2A 1RRJA 1Y1WK 1MIUA 4LLGA 1XPPA 1R5ZA 5C9HA 1Y1VA 3HOXK 3H3VL 4GFQA 1USOA 2V6SA 5CJ9A 3HOUK 5IORA 4YG2A 2E2IA 3GTGK 4D3YA 1I50A 4BBRC 4GTEA 1SC7A 2PA8L 1TWAA 5EGHA 3K5MA 5CQGA 1BGWA 1K83A 3LAPA 3S16K 1XXAA 1SFOK 4XLPA 4A3EC 3S1RC 3CAGA 1WOOA 1I6HC 4OYDB 1WIHA 4MQ9A 4A3IC 3LAJA 3TFIA 4A3FK 3AD7C 4NOIA 4A3MK 4OINA 3GTPK 4XSXA 5CHPA 3S15K 2NVYC 1R9TA 1XXBA 1WCMA 1I3QA 4OIQA 4EJ3A 5TMFA 4G0WA 4Q5SA 4WILA 3SZYA 3IPJA 5C4JK 2JA5A 3WODA 4C3IK 4GZYA 4O2DA 2JA7C 1JOEA 3Q3QA 5FLMC 1AB4A 4A3BK 3OPFA 1ISEA 3NUHA 4BBSK 2KWAA 3HOVK 5IYCK 1EI6A 1TWCC 3I4NK 4G7OA 2W7VA 1ZBSA 3K57A 4X6AC 1YNJD 3GTGA 1DCOA 4Y52K 4A3CC 4Q4ZA 3RZOC 4BLAA 4G7ZA 2GAGC 3A8JA 3CQZK 5JVOA 5C3EC 2Y0SD 3N3YA 4Y7NK 1TWGK 1Y1VK 5EGEA 5JFEA 4F3EA 2ZFZA 4MEXA 2VUMK 3GTKK 1V5VA 4A93C 1SEUA 2O5IA 1EJ9A 1ZXOA 3GTOC 1SFOA 3PO2K 1Y1WC 2R7ZC 3S1MK 2A69A 3GTQK 1WQHA 3S1QK 2D6FC 3A8KA 3K58A 5TMCA 1TWFA 4Q5GA 1BS2A 3BP8C 4BKWA 3S17C 5M5WK 3SZZA 2P5MA 3K5LA 3VA7A 1NH3A 4FYDA 3TTGA 2NVXC 2A6EA 3S1NC 1J98A 4L8IA 1VRQC 4WJ4A 5E68A 4YFXA 1WCMK 4KAWX 5C44K 1I3QK 1HI9A 1F9NA 2B9SB 3OEPA 4A3FC 4KATA 4QIWD 5IP7K 4A3MC 2JA5K 3L4JA 1VLOA 3EQLA 2ZUEA 2E2HK 3RZDC 4KC6A 2E2JK 4M1XA 4KB4A 4PAAA 4Q5VA 4XSZA 2Y3PA 1XZPB 3LF9A 1A35A 4C3IC 5C4JC 4A3LC 2WAQA 3JSTA 3CQZA 2CFAB 1YCLA 4AYBD 1TWGA 4LOWA 4C3HC 4C2MA 4A3BC 1IW7D 3GTKA 2VUMA 1WOPA 1EQRA 1O27A 1K4TA 3TFHA 2R92K 4P9SA 2A6HA 4IP8A 3M3YC 3L4KA 4G7HA 4BBSC 3HOVC 1O2AA 3GTQA 5IYCC 2R93K 1G51A 2Y0SL 2JA6C 3GTJA 3HOWK 5M5YK 3H0GA 1A31A 4KM9A 2YU9C 3I4MK 1INNA 4OIPA 3S0XA 3G4CA 5M5XK 3N0BA 4C45A 2P8TA 4Y7NC 3AQPA 1WSVA 3K7AK 4FZBA 2GSNA 2WB1A 1TWFK 2E2IC 3HOYK 2ZUFA 1I50C 3PO2C 4NOLA 3DU6A 3N0CA 3GTLK 3M4OC 4KMDA 2NVQK 2PMZA 1TWAC 2CW0A 3S1QC 4LMOA 3ADAC 1K83C 1TGOA 1XZPA 2BE5A 2O5JA 4BXXC 1F7VA 1O25A 2CFAA 3FOFA 1KQ4A 5C4XK 3GEHA 5L46A 3AD8C 5IYDK 4BY7C 3LHPS 2E2HA 4ZH4A 4QIWL 1O28A 4H3TA 2RGRA 1R9TC 1RU0A 4XCHA 1WCMC 4C3JK 2CW0D 5C44C 1I3QC 4QJVB 3QX3A 1R49A 2XCRB 1SMYA 3FKIA 5IP7C 3S2HC 3S14K 3BP3A 3AD9C 2JA5C 2R92A 1WQGA 1IL2A 1Q8IA 2R93A 4AYBL 4A3KC 4A3GK 4LR2A 4C2MK 3IAYA 2E2JC 1WORA 4A3DK 4BBRK 2R7ZA 3T02A 1X31C 1L0WA 4O26A 3GTJK 4BY1K 3HOXC 1ZYRA 3H0GK 1B4AA 4A3JK 4G0VA 1PJ5A 1TWHA 3HKZA 3HOUC 3GTGC 4WJ3M 1J6XA 1YX2A 1RR8C 4KASA 4FGUA 3GTLA 4KARA 5IOQA 4LQYA 1EH1A 2GAHC 4XLNA 4KN7A 1I6HK 5M3MK 3S16C 4A3IK 1WQFA 3I4MC 1SFOC 4YFKA 1HQMA 2NVTK 3V4GA 2A69D 3GTMA 1I6VA 4QJVA 1WSRA 2B63A 3K7AC 4JLRC 3AQOA 3HKZD 3GTPC 1PJ6A 4RMFA 3TFJA 3S15C 3GEIA 3M4AA 5IOSA 2NVQC 2JH3A 5FLMK 4GTBA 5IOTA 4ILDA 3G4AA 3K5OA 4KMUA 2A6ED 4KN4A 3DU5A 1TWCK 2R4GA 3FHZA 1HQMD 3HOZK 1V9MA 5IYDC 3WVOA 4X6AK 1IQ0A 4GTCA 1IS1A 4QCLA 4A3CK 3GDZA 3KYLA 1LPQA 3FKIK 3RZOK 1B4BA 3GEEA 1O2BA 3I4NC 4NOKA 4GTAA 3AH5A 4LK0A 4Y52C 2R7ZK 4AH6A 3S14C 4IP9A 2F4QA 4KB2A 1YNNA 3CQZC 2WAQD 2EBBA 1DCHA 2V6TA 1TWGC 1Y1VC 4A3GC 4C2MC 3GTKC 1O2FB 2VUMC 1TWHK 4A3DC 3PO3K 4KM8A 3S2DK 1JQWA 3T00A 3S1MC 3S17K 2NVYA 2A6HD 3GTQC 1O26A 3GTJC 4BY1C 1J6VA 3H0GC 4A3JC 2NVXK 3S1NK 5IP9K 3MAQA 1EK8A 2GSUA 2JA7A 1YNND 3GTMK 3K5NA
chains in the Genus database with same CATH topology
1ZVUA 1R5ZA 4L8IA 5C9HA 1Y1VA 4GTFA 2R7ZA 4GFQA 4GTDA 4GT9A 4KMHA 5CJ9A 4KAWX 5IORA 2E2IA 1F9NA 2B9SB 4D3YA 4O26A 1I50A 3OEPA 1TWCA 4D3ZA 4KATA 1B4AA 3MMLB 4G0VA 4GTEA 1T8IA 1TWHA 3HKZA 1SC7A 5TJ3A 1TWAA 5EGHA 3K5MA 5CQGA 1BGWA 1K83A 1RR8C 4KASA 3LAPA 4FGUA 3L4JA 3GTLA 4KARA 2BE5D 1XXAA 5IOQA 2O5JD 4LQYA 1EH1A 4KC6A 2Y0SA 4M1XA 1Y698 3P9AA 4KB4A 4Q5VA 1WQFA 3K59A 2Y3PA 3CAGA 3LF9A 1A35A 4C3IC 1K4SA 2WAQA 3CQZA 2CFAB 4OYDB 2XCOA 4KDDA 3GTOA 1TWGA 1WIHA 3LAJA 4C3HC 1Y1WA 1BJTA 3V4GA 2A69D 4C2MA 1IW7D 3GTKA 3GTMA 2VUMA 4GTLA 3FOEA 4AHCA 5CHPA 2B63A 1O27A 4JLRC 1K4TA 1R9TA 3AQOA 1XXBA 4IP8A 3OREA 3L4KA 1WCMA 4FXDA 1O2AA 3GTQA 1I3QA 1TL8A 4EJ3A 1XXCA 3GTJA 5IOSA 3M4AA 4G0WA 1SMYD 1GE9A 4BLBA 3H0GA 1A31A 4KM9A 4LR2A 2JH3A 4P5BA 4DDQA 4GTBA 2JA5A 5IOTA 4ILDA 3S0XA 3G4CA 3G4AA 3K5OA 3N0BA 5JSNB 3Q3QA 2A6ED 1AB4A 2NVXA 3DU5A 3OPFA 3AQPA 2R4GA 3FHZA 1HQMD 1ISEA 1V9MA 4NOMA 1DD5A 4FZBA 3NUHA 2GSNA 2WB1A 3WVOA 4AN8A 2KWAA 4GTCA 1IS1A 4QCLA 4NOLA 3DU6A 3N0CA 4FM9A 3KYLA 1LPQA 4QIWA 1ZYRD 4KMDA 1B4BA 2PMZA 1ZBSA 4LMOA 3K57A 3GTPA 1YNJD 3GTGA 3ERED 1O2BA 1TGOA 1O29A 2PHCB 4NOKA 4BLAA 2JA7A 4GTAA 5JVOA 5MLC9 1O25A 2CFAA 3AH5A 3N3YA 3FOFA 1KQ4A 5EGEA 1A36A 4KMAA 5JFEA 4F3EA 2ZFZA 4IP9A 2F4QA 4KB2A 2A68D 1SEUA 3LHPS 1EJ9A 2E2HA 1ZXOA 1SFOA 2XCQA 4AYBA 4J3NA 4C2MC 1O28A 1I6VD 4H3TA 1O24A 1WQHA 4KM8A 4P5AA 2RGRA 3K58A 2RH6A 2CW0D 2NVYA 1TWFA 2A6HD 4Q5GA 3BUEA 3LPXA 1O26A 3QX3A 1R49A 4BKWA 2XCRB 2JA6A 3FKIA 2GSOA 4C3JC 3SJRA 2YU9A 1WQGA 2R92A 5JSBB 2P5MA 3K5LA 1Q8IA 2R93A 3MAQA 4G0UA 3VA7A 1EK8A 2GSUA 1NH3A 4FYDA 1RRJA 1YNND 1MIUA 3K5NA 3IAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAG A;  1ZVU A;  3LHP S;  4L8I A;  2XCQ A;  3OPF A;  3FHZ A;  2XCO A;  4OYD B;  4J3N A;  4KDD A;  1WIH A;  1ISE A;  4GFQ A;  3LAJ A;  1DD5 A;  1BJT A;  3NUH A;  3V4G A;  3FOE A;  5CJ9 A;  4KAW X;  1WQH A;  2KWA A;  1F9N A;  2RGR A;  1IS1 A;  4FM9 A;  3OEP A;  4JLR C;  1B4A A;  3MML B;  4G0V A;  1XXB A;  3ORE A;  1B4B A;  3BUE A;  3LPX A;  3L4K A;  3QX3 A;  1BGW A;  3ERE D;  1XXC A;  2XCR B;  3LAP A;  4G0W A;  1GE9 A;  2PHC B;  4DDQ A;  3L4J A;  1XXA A;  1WQG A;  1EH1 A;  4KC6 A;  5JSB B;  5MLC 9;  5JVO A;  2P5M A;  3FOF A;  1Y69 8;  4G0U A;  4KB4 A;  3VA7 A;  1EK8 A;  5JSN B;  2ZFZ A;  1WQF A;  2Y3P A;  4KB2 A;  3LF9 A;  1AB4 A; 
#chains in the Genus database with same CATH topology
 1ZVU A;  2B63 K;  4GTF A;  3T01 A;  2PPB A;  4GTD A;  4GT9 A;  1JVI A;  4KMH A;  3HKZ L;  2WB1 D;  2FQO A;  2NVT C;  2JA8 K;  1TWC A;  4D3Z A;  4OIO A;  3MML B;  1VJE A;  1T8I A;  5TJ3 A;  2PMZ D;  3RZD K;  1YNJ A;  5IYB K;  3HXA A;  1F93 A;  1UV7 A;  2BE5 D;  4A3L K;  2O5J D;  4JK1 A;  2Y0S A;  1Y69 8;  1ZQ1 C;  3P9A A;  1J6W A;  3GSI A;  4C3H K;  3K59 A;  1K4S A;  2E2H C;  4OIR A;  1PJ7 A;  2XCO A;  4MEY A;  4KDD A;  3GTO A;  1C0A A;  1Y1W A;  3M3Y K;  1BJT A;  1XZQ B;  3FOE A;  4GTL A;  3HOZ C;  2JA6 K;  4AHC A;  3H3V D;  2YU9 K;  3ORE A;  2FQT A;  4PAB A;  4FXD A;  1TL8 A;  1XXC A;  3FKI C;  1SMY D;  1GE9 A;  4BLB A;  4DDQ A;  1DCP A;  4P5B A;  4A3E K;  2R92 C;  3S1R K;  2PA8 D;  2WAQ L;  2R93 C;  3GIR A;  5FJ8 K;  1USM A;  3HOW C;  1IBA A;  2E2I K;  5JSN B;  2NVX A;  2A68 A;  1I50 K;  1VGX A;  4LJZ A;  4NOM A;  5HL8 A;  3M4O K;  1DD5 A;  2NVY K;  1TWA K;  4AN8 A;  1K83 K;  1BDF A;  4FM9 A;  1EFW A;  4QIW A;  1ZYR D;  1TWH C;  3DXJ A;  4BXX K;  5D4D A;  1TWF C;  3PO3 C;  3S2D C;  3HOY C;  3GTP A;  3ERE D;  3GTL C;  1O29 A;  2PHC B;  2JA7 K;  4BY7 K;  5MLC 9;  4YFN A;  1A36 A;  1XZQ A;  4KMA A;  5M3F K;  2A68 D;  2WB1 L;  5IP9 C;  2XCQ A;  4AYB A;  1R9T K;  4J3N A;  5C4X C;  3GTM C;  1IW7 A;  1I6V D;  1O24 A;  1IE0 A;  2PMZ L;  4P5A A;  2B63 C;  2RH6 A;  2V6U A;  3S2H K;  3BUE A;  3LPX A;  1F7U A;  5C3E K;  2JA8 C;  4LK1 A;  2JA6 A;  4A3K K;  1WOS A;  2GSO A;  4C3J C;  3SJR A;  2YU9 A;  5JSB B;  4A93 K;  5IYB C;  3A8I A;  4G0U A;  3GTO K;  1VH2 A;  1RRJ A;  1Y1W K;  1MIU A;  4LLG A;  1XPP A;  1R5Z A;  5C9H A;  1Y1V A;  3HOX K;  3H3V L;  4GFQ A;  1USO A;  2V6S A;  5CJ9 A;  3HOU K;  5IOR A;  4YG2 A;  2E2I A;  3GTG K;  4D3Y A;  1I50 A;  4BBR C;  4GTE A;  1SC7 A;  2PA8 L;  1TWA A;  5EGH A;  3K5M A;  5CQG A;  1BGW A;  1K83 A;  3LAP A;  3S16 K;  1XXA A;  1SFO K;  4XLP A;  4A3E C;  3S1R C;  3CAG A;  1WOO A;  1I6H C;  4OYD B;  1WIH A;  4MQ9 A;  4A3I C;  3LAJ A;  3TFI A;  4A3F K;  3AD7 C;  4NOI A;  4A3M K;  4OIN A;  3GTP K;  4XSX A;  5CHP A;  3S15 K;  2NVY C;  1R9T A;  1XXB A;  1WCM A;  1I3Q A;  4OIQ A;  4EJ3 A;  5TMF A;  4G0W A;  4Q5S A;  4WIL A;  3SZY A;  3IPJ A;  5C4J K;  2JA5 A;  3WOD A;  4C3I K;  4GZY A;  4O2D A;  2JA7 C;  1JOE A;  3Q3Q A;  5FLM C;  1AB4 A;  4A3B K;  3OPF A;  1ISE A;  3NUH A;  4BBS K;  2KWA A;  3HOV K;  5IYC K;  1EI6 A;  1TWC C;  3I4N K;  4G7O A;  2W7V A;  1ZBS A;  3K57 A;  4X6A C;  1YNJ D;  3GTG A;  1DCO A;  4Y52 K;  4A3C C;  4Q4Z A;  3RZO C;  4BLA A;  4G7Z A;  2GAG C;  3A8J A;  3CQZ K;  5JVO A;  5C3E C;  2Y0S D;  3N3Y A;  4Y7N K;  1TWG K;  1Y1V K;  5EGE A;  5JFE A;  4F3E A;  2ZFZ A;  4MEX A;  2VUM K;  3GTK K;  1V5V A;  4A93 C;  1SEU A;  2O5I A;  1EJ9 A;  1ZXO A;  3GTO C;  1SFO A;  3PO2 K;  1Y1W C;  2R7Z C;  3S1M K;  2A69 A;  3GTQ K;  1WQH A;  3S1Q K;  2D6F C;  3A8K A;  3K58 A;  5TMC A;  1TWF A;  4Q5G A;  1BS2 A;  3BP8 C;  4BKW A;  3S17 C;  5M5W K;  3SZZ A;  2P5M A;  3K5L A;  3VA7 A;  1NH3 A;  4FYD A;  3TTG A;  2NVX C;  2A6E A;  3S1N C;  1J98 A;  4L8I A;  1VRQ C;  4WJ4 A;  5E68 A;  4YFX A;  1WCM K;  4KAW X;  5C44 K;  1I3Q K;  1HI9 A;  1F9N A;  2B9S B;  3OEP A;  4A3F C;  4KAT A;  4QIW D;  5IP7 K;  4A3M C;  2JA5 K;  3L4J A;  1VLO A;  3EQL A;  2ZUE A;  2E2H K;  3RZD C;  4KC6 A;  2E2J K;  4M1X A;  4KB4 A;  4PAA A;  4Q5V A;  4XSZ A;  2Y3P A;  1XZP B;  3LF9 A;  1A35 A;  4C3I C;  5C4J C;  4A3L C;  2WAQ A;  3JST A;  3CQZ A;  2CFA B;  1YCL A;  4AYB D;  1TWG A;  4LOW A;  4C3H C;  4C2M A;  4A3B C;  1IW7 D;  3GTK A;  2VUM A;  1WOP A;  1EQR A;  1O27 A;  1K4T A;  3TFH A;  2R92 K;  4P9S A;  2A6H A;  4IP8 A;  3M3Y C;  3L4K A;  4G7H A;  4BBS C;  3HOV C;  1O2A A;  3GTQ A;  5IYC C;  2R93 K;  1G51 A;  2Y0S L;  2JA6 C;  3GTJ A;  3HOW K;  5M5Y K;  3H0G A;  1A31 A;  4KM9 A;  2YU9 C;  3I4M K;  1INN A;  4OIP A;  3S0X A;  3G4C A;  5M5X K;  3N0B A;  4C45 A;  2P8T A;  4Y7N C;  3AQP A;  1WSV A;  3K7A K;  4FZB A;  2GSN A;  2WB1 A;  1TWF K;  2E2I C;  3HOY K;  2ZUF A;  1I50 C;  3PO2 C;  4NOL A;  3DU6 A;  3N0C A;  3GTL K;  3M4O C;  4KMD A;  2NVQ K;  2PMZ A;  1TWA C;  2CW0 A;  3S1Q C;  4LMO A;  3ADA C;  1K83 C;  1TGO A;  1XZP A;  2BE5 A;  2O5J A;  4BXX C;  1F7V A;  1O25 A;  2CFA A;  3FOF A;  1KQ4 A;  5C4X K;  3GEH A;  5L46 A;  3AD8 C;  5IYD K;  4BY7 C;  3LHP S;  2E2H A;  4ZH4 A;  4QIW L;  1O28 A;  4H3T A;  2RGR A;  1R9T C;  1RU0 A;  4XCH A;  1WCM C;  4C3J K;  2CW0 D;  5C44 C;  1I3Q C;  4QJV B;  3QX3 A;  1R49 A;  2XCR B;  1SMY A;  3FKI A;  5IP7 C;  3S2H C;  3S14 K;  3BP3 A;  3AD9 C;  2JA5 C;  2R92 A;  1WQG A;  1IL2 A;  1Q8I A;  2R93 A;  4AYB L;  4A3K C;  4A3G K;  4LR2 A;  4C2M K;  3IAY A;  2E2J C;  1WOR A;  4A3D K;  4BBR K;  2R7Z A;  3T02 A;  1X31 C;  1L0W A;  4O26 A;  3GTJ K;  4BY1 K;  3HOX C;  1ZYR A;  3H0G K;  1B4A A;  4A3J K;  4G0V A;  1PJ5 A;  1TWH A;  3HKZ A;  3HOU C;  3GTG C;  4WJ3 M;  1J6X A;  1YX2 A;  1RR8 C;  4KAS A;  4FGU A;  3GTL A;  4KAR A;  5IOQ A;  4LQY A;  1EH1 A;  2GAH C;  4XLN A;  4KN7 A;  1I6H K;  5M3M K;  3S16 C;  4A3I K;  1WQF A;  3I4M C;  1SFO C;  4YFK A;  1HQM A;  2NVT K;  3V4G A;  2A69 D;  3GTM A;  1I6V A;  4QJV A;  1WSR A;  2B63 A;  3K7A C;  4JLR C;  3AQO A;  3HKZ D;  3GTP C;  1PJ6 A;  4RMF A;  3TFJ A;  3S15 C;  3GEI A;  3M4A A;  5IOS A;  2NVQ C;  2JH3 A;  5FLM K;  4GTB A;  5IOT A;  4ILD A;  3G4A A;  3K5O A;  4KMU A;  2A6E D;  4KN4 A;  3DU5 A;  1TWC K;  2R4G A;  3FHZ A;  1HQM D;  3HOZ K;  1V9M A;  5IYD C;  3WVO A;  4X6A K;  1IQ0 A;  4GTC A;  1IS1 A;  4QCL A;  4A3C K;  3GDZ A;  3KYL A;  1LPQ A;  3FKI K;  3RZO K;  1B4B A;  3GEE A;  1O2B A;  3I4N C;  4NOK A;  4GTA A;  3AH5 A;  4LK0 A;  4Y52 C;  2R7Z K;  4AH6 A;  3S14 C;  4IP9 A;  2F4Q A;  4KB2 A;  1YNN A;  3CQZ C;  2WAQ D;  2EBB A;  1DCH A;  2V6T A;  1TWG C;  1Y1V C;  4A3G C;  4C2M C;  3GTK C;  1O2F B;  2VUM C;  1TWH K;  4A3D C;  3PO3 K;  4KM8 A;  3S2D K;  1JQW A;  3T00 A;  3S1M C;  3S17 K;  2NVY A;  2A6H D;  3GTQ C;  1O26 A;  3GTJ C;  4BY1 C;  1J6V A;  3H0G C;  4A3J C;  2NVX K;  3S1N K;  5IP9 K;  3MAQ A;  1EK8 A;  2GSU A;  2JA7 A;  1YNN D;  3GTM K;  3K5N A; 
#chains in the Genus database with same CATH homology
 1ZVU A;  1R5Z A;  4L8I A;  5C9H A;  1Y1V A;  4GTF A;  2R7Z A;  4GFQ A;  4GTD A;  4GT9 A;  4KMH A;  5CJ9 A;  4KAW X;  5IOR A;  2E2I A;  1F9N A;  2B9S B;  4D3Y A;  4O26 A;  1I50 A;  3OEP A;  1TWC A;  4D3Z A;  4KAT A;  1B4A A;  3MML B;  4G0V A;  4GTE A;  1T8I A;  1TWH A;  3HKZ A;  1SC7 A;  5TJ3 A;  1TWA A;  5EGH A;  3K5M A;  5CQG A;  1BGW A;  1K83 A;  1RR8 C;  4KAS A;  3LAP A;  4FGU A;  3L4J A;  3GTL A;  4KAR A;  2BE5 D;  1XXA A;  5IOQ A;  2O5J D;  4LQY A;  1EH1 A;  4KC6 A;  2Y0S A;  4M1X A;  1Y69 8;  3P9A A;  4KB4 A;  4Q5V A;  1WQF A;  3K59 A;  2Y3P A;  3CAG A;  3LF9 A;  1A35 A;  4C3I C;  1K4S A;  2WAQ A;  3CQZ A;  2CFA B;  4OYD B;  2XCO A;  4KDD A;  3GTO A;  1TWG A;  1WIH A;  3LAJ A;  4C3H C;  1Y1W A;  1BJT A;  3V4G A;  2A69 D;  4C2M A;  1IW7 D;  3GTK A;  3GTM A;  2VUM A;  4GTL A;  3FOE A;  4AHC A;  5CHP A;  2B63 A;  1O27 A;  4JLR C;  1K4T A;  1R9T A;  3AQO A;  1XXB A;  4IP8 A;  3ORE A;  3L4K A;  1WCM A;  4FXD A;  1O2A A;  3GTQ A;  1I3Q A;  1TL8 A;  4EJ3 A;  1XXC A;  3GTJ A;  5IOS A;  3M4A A;  4G0W A;  1SMY D;  1GE9 A;  4BLB A;  3H0G A;  1A31 A;  4KM9 A;  4LR2 A;  2JH3 A;  4P5B A;  4DDQ A;  4GTB A;  2JA5 A;  5IOT A;  4ILD A;  3S0X A;  3G4C A;  3G4A A;  3K5O A;  3N0B A;  5JSN B;  3Q3Q A;  2A6E D;  1AB4 A;  2NVX A;  3DU5 A;  3OPF A;  3AQP A;  2R4G A;  3FHZ A;  1HQM D;  1ISE A;  1V9M A;  4NOM A;  1DD5 A;  4FZB A;  3NUH A;  2GSN A;  2WB1 A;  3WVO A;  4AN8 A;  2KWA A;  4GTC A;  1IS1 A;  4QCL A;  4NOL A;  3DU6 A;  3N0C A;  4FM9 A;  3KYL A;  1LPQ A;  4QIW A;  1ZYR D;  4KMD A;  1B4B A;  2PMZ A;  1ZBS A;  4LMO A;  3K57 A;  3GTP A;  1YNJ D;  3GTG A;  3ERE D;  1O2B A;  1TGO A;  1O29 A;  2PHC B;  4NOK A;  4BLA A;  2JA7 A;  4GTA A;  5JVO A;  5MLC 9;  1O25 A;  2CFA A;  3AH5 A;  3N3Y A;  3FOF A;  1KQ4 A;  5EGE A;  1A36 A;  4KMA A;  5JFE A;  4F3E A;  2ZFZ A;  4IP9 A;  2F4Q A;  4KB2 A;  2A68 D;  1SEU A;  3LHP S;  1EJ9 A;  2E2H A;  1ZXO A;  1SFO A;  2XCQ A;  4AYB A;  4J3N A;  4C2M C;  1O28 A;  1I6V D;  4H3T A;  1O24 A;  1WQH A;  4KM8 A;  4P5A A;  2RGR A;  3K58 A;  2RH6 A;  2CW0 D;  2NVY A;  1TWF A;  2A6H D;  4Q5G A;  3BUE A;  3LPX A;  1O26 A;  3QX3 A;  1R49 A;  4BKW A;  2XCR B;  2JA6 A;  3FKI A;  2GSO A;  4C3J C;  3SJR A;  2YU9 A;  1WQG A;  2R92 A;  5JSB B;  2P5M A;  3K5L A;  1Q8I A;  2R93 A;  3MAQ A;  4G0U A;  3VA7 A;  1EK8 A;  2GSU A;  1NH3 A;  4FYD A;  1RRJ A;  1YNN D;  1MIU A;  3K5N A;  3IAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...