4GFQA

2.65 angstrom resolution crystal structure of ribosome recycling factor (frr) from bacillus anthracis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
186
structure length
186
Chain Sequence
AMGQQVLKFSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPYDKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLVKVVKKYAEEAKVAVRNVRRDGNDDLKKLEKAGEITEDDLRGYTEDIQKETDKYIAKVDEIAKNKEKEIMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title 2.65 Angstrom Resolution Crystal Structure of Ribosome Recycling Factor (frr) from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Translation
total genus 70
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4gfqA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gfqA02
1DD5A 4GFQA 1XXBA 1WIHA 2PHCB 4KDDA 3LAPA 1BGWA 4J3NA 1IS1A 1Y698 3LF9A 3ERED 4JLRC 3VA7A 4KC6A 5JVOA 3FOFA 1ZVUA 3FOEA 1ISEA 4L8IA 3FHZA 2RGRA 1EK8A 1B4AA 1B4BA 2Y3PA 3L4KA 2KWAA 5MLC9 2XCQA 4DDQA 2XCOA 2P5MA 3QX3A 3V4GA 1AB4A 4KAWX 3CAGA 4FM9A 2XCRB 4G0WA 1XXCA 4G0VA 5JSBB 2ZFZA 3LAJA 4G0UA 5CJ9A 1WQGA 3OEPA 1EH1A 4KB4A 3BUEA 3L4JA 4OYDB 1BJTA 1WQHA 3MMLB 3LPXA 3OPFA 3OREA 1GE9A 1WQFA 5JSNB 1XXAA 1F9NA 4KB2A 3NUHA 3LHPS
chains in the Genus database with same CATH superfamily
3T02A 5M5WK 2JA7C 4WJ3M 1EJ9A 1IS1A 1WOOA 3GTJC 4LLGA 1WCMC 3GTGC 1F7UA 3G4CA 4L8IA 2WB1D 2E2JK 2Y3PA 1I50K 2A69D 3WODA 2R7ZA 3WVOA 4NOLA 1TWCA 5IYDC 3DXJA 1A35A 4BY7K 1WSVA 3HKZD 3S15K 3G4AA 1PJ7A 2WB1A 4WJ4A 5JFEA 1Y1VA 4C45A 2A69A 1DD5A 1WIHA 3S1NK 4MEYA 4A3LK 1V9MA 2GAHC 1TWAA 3HXAA 3FHZA 2NVYA 2F4QA 5C4XK 3HKZA 4Q5GA 3K57A 4C3JC 3A8KA 4O26A 1R9TK 1AB4A 3CQZC 4AH6A 3SZZA 4FM9A 1TWGA 1XXCA 1V5VA 3GTQC 1TWHC 3OEPA 2NVTC 4KB4A 4X6AK 1I50A 1I3QK 1SFOA 1LPQA 5D4DA 2A6HD 4D3ZA 2PHCB 2R7ZC 1O26A 1XZQB 4D3YA 4A93C 1TWCC 4YG2A 4P5AA 4FYDA 3S14K 4A3CC 1XPPA 2WB1L 4KMDA 5FJ8K 4OIPA 3HOWC 3K5NA 2JH3A 5EGHA 3HOYC 1SEUA 1WOSA 1Y1VC 4IP9A 4BBSK 1I6VD 3L4JA 4OYDB 1IE0A 3HKZL 3EQLA 1X31C 1TWAC 4Y52K 1R9TA 2NVYC 3K58A 1BS2A 2ZUEA 5IORA 3BP3A 3GEEA 4YFNA 4GTDA 5IYCK 1TWGC 2VUMK 1I6VA 1I3QA 2GSUA 2E2JC 2CFAA 1VJEA 1DCHA 1O25A 4RMFA 1ZYRD 1XZPA 3GTPC 1YCLA 2FQTA 4GTEA 4BY7C 1RR8C 1DCOA 2D6FC 2B63K 4OIOA 3HOVK 3S15C 5C4JK 2A68D 1BGWA 3GEHA 1VH2A 4G7HA 1K83A 1NH3A 1ZYRA 1J6WA 5IYBK 4F3EA 3S1NC 4LJZA 4A3LC 4XSXA 4KAWX 4AN8A 5C4XC 1JOEA 1WORA 4XLPA 1R9TC 3K7AK 1EH1A 3Q3QA 2A68A 4P5BA 3DU5A 2JA6K 1JQWA 4KN4A 3HOZC 4BLBA 1J6XA 4QIWL 4MEXA 4X6AC 3LHPS 1I3QC 4FZBA 3LAPA 2P8TA 1Y698 4J3NA 4GTAA 4XSZA 4Q4ZA 4A3JK 2V6TA 4OINA 1B4AA 1IW7D 3HOXK 3S1RK 2R92A 2PA8L 5EGEA 3I4NK 2B63A 1SFOK 3S14C 3S2DK 2NVXK 5JSBB 2ZFZA 3RZOK 3S17K 4LK0A 4C3IK 1Y1WC 5IOTA 1TGOA 2FQOA 1HQMD 4BBSC 1RU0A 1IW7A 3GTMK 3SJRA 4LK1A 1O2BA 3IPJA 4KDDA 4GTBA 4Y52C 3ERED 2JA5A 5TJ3A 1ZVUA 4KMUA 3FOEA 3AQOA 1B4BA 3KYLA 2JA6A 2XCQA 5IYCC 4GZYA 2R4GA 3AH5A 3GTKK 1HQMA 2VUMC 4QJVB 4OIQA 3GTOK 1SC7A 2V6UA 1YNJD 3TFIA 3OREA 1WQFA 1A31A 1XXAA 4A3GK 4A3BK 4LOWA 1J98A 2NVXA 3GDZA 4A3DK 3T01A 1TL8A 2B63C 3PO2K 3K5LA 4KM9A 4LR2A 5M3FK 4A3MK 3HOVC 5C4JC 3GTLK 2E2HA 5C44K 4BXXK 5HL8A 1EQRA 3S2HK 3QX3A 1YNJA 3S1MK 5IYBC 3GTMA 2XCRB 4KATA 4G0WA 3S16K 1O2FB 1K83K 1BDFA 4QIWD 2JA7K 3OPFA 5IP7K 3K7AC 1GE9A 4KMHA 3GTKA 3AD8C 2PMZD 2JA6C 1PJ6A 1XZQA 3GTOA 4KC6A 3H0GK 1ISEA 2JA8K 5IYDK 2PA8D 5IOSA 2PPBA 2NVQK 4A3JC 4XCHA 4GTCA 4QIWA 1I50C 3HOXC 3S1RC 5FLMK 3I4MK 2PMZA 3I4NC 4OIRA 3IAYA 3K5OA 4MQ9A 1SFOC 3S2DC 2NVXC 3GTLA 3RZOC 4C3IC 2R92K 1PJ5A 3GEIA 4KN7A 3N0BA 3LF9A 4JLRC 1VGXA 4GT9A 3A8JA 3GTMC 2RH6A 1SMYD 1TWFA 5C3EK 2O5JD 2JA7A 2XCOA 5CQGA 1YNND 3GTJA 2P5MA 5IP9K 3SZYA 4P9SA 4WILA 2ZUFA 4C2MK 3S1QK 2BE5D 4Y7NK 4G0UA 2JA5K 3GTKC 4QCLA 4BY1K 3H0GA 4KMAA 1BJTA 2CW0D 1KQ4A 1A36A 3FKIK 4A3EK 3GTOC 1SMYA 2V6SA 2O5JA 2GSOA 1YNNA 2PMZL 2R93K 1RRJA 4A3GC 4A3BC 2BE5A 1ZXOA 4A3DC 2KWAA 4BLAA 4DDQA 2CW0A 3GSIA 4A3MC 3PO2C 1UV7A 4AHCA 4JK1A 4BBRK 3MAQA 3GTLC 4BXXC 1O24A 3S2HC 2WAQA 4NOKA 4GTFA 4A3FK 1WQGA 3S1MC 4KASA 3S16C 1USOA 1J6VA 1I6HK 2E2HK 3GTQA 1K83C 1DCPA 1F93A 4NOIA 4KM8A 4KB2A 2GSNA 1YX2A 4YFKA 4A3KK 4C2MA 3BP8C 5IP7C 1C0AA 4XLNA 2YU9K 3VA7A 2EBBA 1WSRA 1EK8A 4A3IK 3FKIA 4ZH4A 3M4OK 3H0GC 3GTPK 2JA8C 1VLOA 2NVQC 4G0VA 4NOMA 2R93A 4YFXA 3TFJA 2E2IK 4O2DA 5FLMC 3I4MC 1F7VA 4IP8A 3M4AA 4LQYA 5M5YK 3AQPA 3H3VL 1USMA 1G51A 1INNA 3M3YK 2A6ED 2WAQL 5TMFA 3HOUK 2R92C 4C3HK 3FOFA 4ILDA 3AD9C 3AD7C 3L4KA 5MLC9 3N0CA 3PO3K 5C3EC 4Q5SA 3TTGA 4QJVA 3HOZK 3LAJA 1EI6A 5CJ9A 2YU9A 5IP9C 5E68A 3RZDK 5M3MK 2A6EA 3GIRA 4C2MC 1TWFK 1IQ0A 5L46A 3S1QC 1ZQ1C 4Y7NC 4H3TA 2JA5C 1R5ZA 4BY1C 3GTPA 1ZBSA 3GTJK 1EFWA 5C9HA 1WCMK 1VRQC 3GTGK 4GFQA 1XXBA 3FKIC 4A3EC 1K4TA 4AYBD 1IL2A 2Y0SD 5JVOA 2E2IA 5TMCA 4KARA 4LMOA 4BKWA 2R93C 1O29A 1Y1WK 2CFAB 2A6HA 4BBRC 1XZPB 4FXDA 4AYBA 3JSTA 4PAAA 2Y0SA 3S0XA 1K4SA 4A3FC 3S17C 5JSNB 1MIUA 4EJ3A 1F9NA 3N3YA 4FGUA 3K59A 1I6HC 2E2HC 4C3JK 1T8IA 4A3KC 3A8IA 3CQZK 2RGRA 4Q5VA 2YU9C 1L0WA 3GTQK 1TWHK 3CAGA 3T00A 1WCMA 4A3IC 3GTGA 2NVTK 1IBAA 3M4OC 3TFHA 1R49A 1WQHA 3P9AA 3K5MA 2W7VA 3ADAC 3LPXA 5CHPA 2R7ZK 4M1XA 1WOPA 4GTLA 2E2IC 1Q8IA 3H3VD 3NUHA 1Y1WA 4A93K 2WAQD 1TWCK 2O5IA 4A3CK 4PABA 4G7OA 1O28A 3HOWK 4AYBL 1HI9A 2Y0SL 3HOUC 3HOYK 3M3YC 4C3HC 1Y1VK 3V4GA 4G7ZA 2B9SB 1O27A 5C44C 1JVIA 3PO3C 1TWAK 2NVYK 3BUEA 3CQZA 3DU6A 1O2AA 3MMLB 2VUMA 5IOQA 5M5XK 3RZDC 2GAGC 1TWHA 1TWFC 1TWGK
chains in the Genus database with same CATH topology
3AQPA 2A68D 2A6ED 1EJ9A 1IS1A 1BGWA 3GTKA 3GTOA 1K83A 1NH3A 4KC6A 3FOFA 4ILDA 1ISEA 4L8IA 3G4CA 4F3EA 2Y3PA 3L4KA 5IOSA 5MLC9 2A69D 3N0CA 2R7ZA 4GTCA 4QIWA 4KAWX 4AN8A 3WVOA 4NOLA 1TWCA 3LAJA 2PMZA 5CJ9A 2YU9A 1A35A 3IAYA 1EH1A 3K5OA 3Q3QA 4P5BA 4C2MC 3GTLA 3DU5A 3G4AA 4H3TA 2WB1A 4BLBA 1R5ZA 4C3IC 5JFEA 3GTPA 1Y1VA 1ZBSA 5C9HA 3LHPS 1DD5A 3N0BA 4GFQA 1XXBA 1WIHA 4FZBA 1V9MA 3LAPA 1K4TA 1Y698 4J3NA 3LF9A 4JLRC 4GT9A 4GTAA 1TWAA 5JVOA 2RH6A 1SMYD 1TWFA 3FHZA 2NVYA 2E2IA 4KARA 1B4AA 2F4QA 2O5JD 3HKZA 4Q5GA 4LMOA 3K57A 1IW7D 2JA7A 2XCOA 4BKWA 4C3JC 2R92A 1YNND 3GTJA 4O26A 2P5MA 1O29A 5EGEA 1AB4A 2B63A 4FM9A 1TWGA 2CFAB 1XXCA 2BE5D 5JSBB 2ZFZA 4G0UA 3OEPA 4QCLA 3H0GA 4KB4A 4FXDA 4KMAA 1BJTA 2CW0D 4AYBA 1KQ4A 5IOTA 2Y0SA 1TGOA 1A36A 1I50A 3S0XA 1K4SA 1HQMD 5JSNB 1MIUA 4EJ3A 1F9NA 3N3YA 1SFOA 1LPQA 4FGUA 3K59A 2GSOA 2A6HD 3SJRA 4D3ZA 1O2BA 2PHCB 4KDDA 1O26A 4GTBA 3ERED 2JA5A 1T8IA 1RRJA 5TJ3A 4D3YA 1ZXOA 1ZVUA 3FOEA 2RGRA 3AQOA 4P5AA 4FYDA 1B4BA 3KYLA 4Q5VA 2JA6A 2KWAA 2XCQA 4BLAA 4DDQA 2R4GA 3AH5A 4KMDA 4AHCA 3MAQA 3CAGA 3K5NA 2JH3A 1WCMA 3GTGA 5EGHA 1O24A 1SEUA 2WAQA 4NOKA 4GTFA 4IP9A 1WQGA 1SC7A 4KASA 1R49A 1I6VD 3L4JA 4OYDB 1WQHA 3P9AA 3K5MA 3LPXA 1YNJD 3GTQA 3OREA 5CHPA 1WQFA 4M1XA 1A31A 1R9TA 1XXAA 4GTLA 4KB2A 1Q8IA 3K58A 2GSNA 3NUHA 1Y1WA 4KM8A 5IORA 4C2MA 2NVXA 4GTDA 1TL8A 3VA7A 3K5LA 4KM9A 4LR2A 1O28A 1EK8A 2E2HA 3FKIA 1I3QA 4C3HC 2GSUA 3QX3A 3V4GA 3GTMA 2CFAA 2B9SB 1O27A 2XCRB 4KATA 4G0WA 1O25A 1ZYRD 4NOMA 4G0VA 2R93A 3BUEA 3CQZA 3DU6A 1O2AA 3MMLB 2VUMA 5IOQA 3OPFA 1GE9A 4GTEA 1RR8C 4IP8A 3M4AA 4KMHA 4LQYA 1TWHA 5CQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DD5 A;  4GFQ A;  1XXB A;  1WIH A;  2PHC B;  4KDD A;  3LAP A;  1BGW A;  4J3N A;  1IS1 A;  1Y69 8;  3LF9 A;  3ERE D;  4JLR C;  3VA7 A;  4KC6 A;  5JVO A;  3FOF A;  1ZVU A;  3FOE A;  1ISE A;  4L8I A;  3FHZ A;  2RGR A;  1EK8 A;  1B4A A;  1B4B A;  2Y3P A;  3L4K A;  2KWA A;  5MLC 9;  2XCQ A;  4DDQ A;  2XCO A;  2P5M A;  3QX3 A;  3V4G A;  1AB4 A;  4KAW X;  3CAG A;  4FM9 A;  2XCR B;  4G0W A;  1XXC A;  4G0V A;  5JSB B;  2ZFZ A;  3LAJ A;  4G0U A;  5CJ9 A;  1WQG A;  3OEP A;  1EH1 A;  4KB4 A;  3BUE A;  3L4J A;  4OYD B;  1BJT A;  1WQH A;  3MML B;  3LPX A;  3OPF A;  3ORE A;  1GE9 A;  1WQF A;  5JSN B;  1XXA A;  1F9N A;  4KB2 A;  3NUH A;  3LHP S; 
#chains in the Genus database with same CATH topology
 3T02 A;  5M5W K;  2JA7 C;  4WJ3 M;  1EJ9 A;  1IS1 A;  1WOO A;  3GTJ C;  4LLG A;  1WCM C;  3GTG C;  1F7U A;  3G4C A;  4L8I A;  2WB1 D;  2E2J K;  2Y3P A;  1I50 K;  2A69 D;  3WOD A;  2R7Z A;  3WVO A;  4NOL A;  1TWC A;  5IYD C;  3DXJ A;  1A35 A;  4BY7 K;  1WSV A;  3HKZ D;  3S15 K;  3G4A A;  1PJ7 A;  2WB1 A;  4WJ4 A;  5JFE A;  1Y1V A;  4C45 A;  2A69 A;  1DD5 A;  1WIH A;  3S1N K;  4MEY A;  4A3L K;  1V9M A;  2GAH C;  1TWA A;  3HXA A;  3FHZ A;  2NVY A;  2F4Q A;  5C4X K;  3HKZ A;  4Q5G A;  3K57 A;  4C3J C;  3A8K A;  4O26 A;  1R9T K;  1AB4 A;  3CQZ C;  4AH6 A;  3SZZ A;  4FM9 A;  1TWG A;  1XXC A;  1V5V A;  3GTQ C;  1TWH C;  3OEP A;  2NVT C;  4KB4 A;  4X6A K;  1I50 A;  1I3Q K;  1SFO A;  1LPQ A;  5D4D A;  2A6H D;  4D3Z A;  2PHC B;  2R7Z C;  1O26 A;  1XZQ B;  4D3Y A;  4A93 C;  1TWC C;  4YG2 A;  4P5A A;  4FYD A;  3S14 K;  4A3C C;  1XPP A;  2WB1 L;  4KMD A;  5FJ8 K;  4OIP A;  3HOW C;  3K5N A;  2JH3 A;  5EGH A;  3HOY C;  1SEU A;  1WOS A;  1Y1V C;  4IP9 A;  4BBS K;  1I6V D;  3L4J A;  4OYD B;  1IE0 A;  3HKZ L;  3EQL A;  1X31 C;  1TWA C;  4Y52 K;  1R9T A;  2NVY C;  3K58 A;  1BS2 A;  2ZUE A;  5IOR A;  3BP3 A;  3GEE A;  4YFN A;  4GTD A;  5IYC K;  1TWG C;  2VUM K;  1I6V A;  1I3Q A;  2GSU A;  2E2J C;  2CFA A;  1VJE A;  1DCH A;  1O25 A;  4RMF A;  1ZYR D;  1XZP A;  3GTP C;  1YCL A;  2FQT A;  4GTE A;  4BY7 C;  1RR8 C;  1DCO A;  2D6F C;  2B63 K;  4OIO A;  3HOV K;  3S15 C;  5C4J K;  2A68 D;  1BGW A;  3GEH A;  1VH2 A;  4G7H A;  1K83 A;  1NH3 A;  1ZYR A;  1J6W A;  5IYB K;  4F3E A;  3S1N C;  4LJZ A;  4A3L C;  4XSX A;  4KAW X;  4AN8 A;  5C4X C;  1JOE A;  1WOR A;  4XLP A;  1R9T C;  3K7A K;  1EH1 A;  3Q3Q A;  2A68 A;  4P5B A;  3DU5 A;  2JA6 K;  1JQW A;  4KN4 A;  3HOZ C;  4BLB A;  1J6X A;  4QIW L;  4MEX A;  4X6A C;  3LHP S;  1I3Q C;  4FZB A;  3LAP A;  2P8T A;  1Y69 8;  4J3N A;  4GTA A;  4XSZ A;  4Q4Z A;  4A3J K;  2V6T A;  4OIN A;  1B4A A;  1IW7 D;  3HOX K;  3S1R K;  2R92 A;  2PA8 L;  5EGE A;  3I4N K;  2B63 A;  1SFO K;  3S14 C;  3S2D K;  2NVX K;  5JSB B;  2ZFZ A;  3RZO K;  3S17 K;  4LK0 A;  4C3I K;  1Y1W C;  5IOT A;  1TGO A;  2FQO A;  1HQM D;  4BBS C;  1RU0 A;  1IW7 A;  3GTM K;  3SJR A;  4LK1 A;  1O2B A;  3IPJ A;  4KDD A;  4GTB A;  4Y52 C;  3ERE D;  2JA5 A;  5TJ3 A;  1ZVU A;  4KMU A;  3FOE A;  3AQO A;  1B4B A;  3KYL A;  2JA6 A;  2XCQ A;  5IYC C;  4GZY A;  2R4G A;  3AH5 A;  3GTK K;  1HQM A;  2VUM C;  4QJV B;  4OIQ A;  3GTO K;  1SC7 A;  2V6U A;  1YNJ D;  3TFI A;  3ORE A;  1WQF A;  1A31 A;  1XXA A;  4A3G K;  4A3B K;  4LOW A;  1J98 A;  2NVX A;  3GDZ A;  4A3D K;  3T01 A;  1TL8 A;  2B63 C;  3PO2 K;  3K5L A;  4KM9 A;  4LR2 A;  5M3F K;  4A3M K;  3HOV C;  5C4J C;  3GTL K;  2E2H A;  5C44 K;  4BXX K;  5HL8 A;  1EQR A;  3S2H K;  3QX3 A;  1YNJ A;  3S1M K;  5IYB C;  3GTM A;  2XCR B;  4KAT A;  4G0W A;  3S16 K;  1O2F B;  1K83 K;  1BDF A;  4QIW D;  2JA7 K;  3OPF A;  5IP7 K;  3K7A C;  1GE9 A;  4KMH A;  3GTK A;  3AD8 C;  2PMZ D;  2JA6 C;  1PJ6 A;  1XZQ A;  3GTO A;  4KC6 A;  3H0G K;  1ISE A;  2JA8 K;  5IYD K;  2PA8 D;  5IOS A;  2PPB A;  2NVQ K;  4A3J C;  4XCH A;  4GTC A;  4QIW A;  1I50 C;  3HOX C;  3S1R C;  5FLM K;  3I4M K;  2PMZ A;  3I4N C;  4OIR A;  3IAY A;  3K5O A;  4MQ9 A;  1SFO C;  3S2D C;  2NVX C;  3GTL A;  3RZO C;  4C3I C;  2R92 K;  1PJ5 A;  3GEI A;  4KN7 A;  3N0B A;  3LF9 A;  4JLR C;  1VGX A;  4GT9 A;  3A8J A;  3GTM C;  2RH6 A;  1SMY D;  1TWF A;  5C3E K;  2O5J D;  2JA7 A;  2XCO A;  5CQG A;  1YNN D;  3GTJ A;  2P5M A;  5IP9 K;  3SZY A;  4P9S A;  4WIL A;  2ZUF A;  4C2M K;  3S1Q K;  2BE5 D;  4Y7N K;  4G0U A;  2JA5 K;  3GTK C;  4QCL A;  4BY1 K;  3H0G A;  4KMA A;  1BJT A;  2CW0 D;  1KQ4 A;  1A36 A;  3FKI K;  4A3E K;  3GTO C;  1SMY A;  2V6S A;  2O5J A;  2GSO A;  1YNN A;  2PMZ L;  2R93 K;  1RRJ A;  4A3G C;  4A3B C;  2BE5 A;  1ZXO A;  4A3D C;  2KWA A;  4BLA A;  4DDQ A;  2CW0 A;  3GSI A;  4A3M C;  3PO2 C;  1UV7 A;  4AHC A;  4JK1 A;  4BBR K;  3MAQ A;  3GTL C;  4BXX C;  1O24 A;  3S2H C;  2WAQ A;  4NOK A;  4GTF A;  4A3F K;  1WQG A;  3S1M C;  4KAS A;  3S16 C;  1USO A;  1J6V A;  1I6H K;  2E2H K;  3GTQ A;  1K83 C;  1DCP A;  1F93 A;  4NOI A;  4KM8 A;  4KB2 A;  2GSN A;  1YX2 A;  4YFK A;  4A3K K;  4C2M A;  3BP8 C;  5IP7 C;  1C0A A;  4XLN A;  2YU9 K;  3VA7 A;  2EBB A;  1WSR A;  1EK8 A;  4A3I K;  3FKI A;  4ZH4 A;  3M4O K;  3H0G C;  3GTP K;  2JA8 C;  1VLO A;  2NVQ C;  4G0V A;  4NOM A;  2R93 A;  4YFX A;  3TFJ A;  2E2I K;  4O2D A;  5FLM C;  3I4M C;  1F7V A;  4IP8 A;  3M4A A;  4LQY A;  5M5Y K;  3AQP A;  3H3V L;  1USM A;  1G51 A;  1INN A;  3M3Y K;  2A6E D;  2WAQ L;  5TMF A;  3HOU K;  2R92 C;  4C3H K;  3FOF A;  4ILD A;  3AD9 C;  3AD7 C;  3L4K A;  5MLC 9;  3N0C A;  3PO3 K;  5C3E C;  4Q5S A;  3TTG A;  4QJV A;  3HOZ K;  3LAJ A;  1EI6 A;  5CJ9 A;  2YU9 A;  5IP9 C;  5E68 A;  3RZD K;  5M3M K;  2A6E A;  3GIR A;  4C2M C;  1TWF K;  1IQ0 A;  5L46 A;  3S1Q C;  1ZQ1 C;  4Y7N C;  4H3T A;  2JA5 C;  1R5Z A;  4BY1 C;  3GTP A;  1ZBS A;  3GTJ K;  1EFW A;  5C9H A;  1WCM K;  1VRQ C;  3GTG K;  4GFQ A;  1XXB A;  3FKI C;  4A3E C;  1K4T A;  4AYB D;  1IL2 A;  2Y0S D;  5JVO A;  2E2I A;  5TMC A;  4KAR A;  4LMO A;  4BKW A;  2R93 C;  1O29 A;  1Y1W K;  2CFA B;  2A6H A;  4BBR C;  1XZP B;  4FXD A;  4AYB A;  3JST A;  4PAA A;  2Y0S A;  3S0X A;  1K4S A;  4A3F C;  3S17 C;  5JSN B;  1MIU A;  4EJ3 A;  1F9N A;  3N3Y A;  4FGU A;  3K59 A;  1I6H C;  2E2H C;  4C3J K;  1T8I A;  4A3K C;  3A8I A;  3CQZ K;  2RGR A;  4Q5V A;  2YU9 C;  1L0W A;  3GTQ K;  1TWH K;  3CAG A;  3T00 A;  1WCM A;  4A3I C;  3GTG A;  2NVT K;  1IBA A;  3M4O C;  3TFH A;  1R49 A;  1WQH A;  3P9A A;  3K5M A;  2W7V A;  3ADA C;  3LPX A;  5CHP A;  2R7Z K;  4M1X A;  1WOP A;  4GTL A;  2E2I C;  1Q8I A;  3H3V D;  3NUH A;  1Y1W A;  4A93 K;  2WAQ D;  1TWC K;  2O5I A;  4A3C K;  4PAB A;  4G7O A;  1O28 A;  3HOW K;  4AYB L;  1HI9 A;  2Y0S L;  3HOU C;  3HOY K;  3M3Y C;  4C3H C;  1Y1V K;  3V4G A;  4G7Z A;  2B9S B;  1O27 A;  5C44 C;  1JVI A;  3PO3 C;  1TWA K;  2NVY K;  3BUE A;  3CQZ A;  3DU6 A;  1O2A A;  3MML B;  2VUM A;  5IOQ A;  5M5X K;  3RZD C;  2GAG C;  1TWH A;  1TWF C;  1TWG K; 
#chains in the Genus database with same CATH homology
 3AQP A;  2A68 D;  2A6E D;  1EJ9 A;  1IS1 A;  1BGW A;  3GTK A;  3GTO A;  1K83 A;  1NH3 A;  4KC6 A;  3FOF A;  4ILD A;  1ISE A;  4L8I A;  3G4C A;  4F3E A;  2Y3P A;  3L4K A;  5IOS A;  5MLC 9;  2A69 D;  3N0C A;  2R7Z A;  4GTC A;  4QIW A;  4KAW X;  4AN8 A;  3WVO A;  4NOL A;  1TWC A;  3LAJ A;  2PMZ A;  5CJ9 A;  2YU9 A;  1A35 A;  3IAY A;  1EH1 A;  3K5O A;  3Q3Q A;  4P5B A;  4C2M C;  3GTL A;  3DU5 A;  3G4A A;  4H3T A;  2WB1 A;  4BLB A;  1R5Z A;  4C3I C;  5JFE A;  3GTP A;  1Y1V A;  1ZBS A;  5C9H A;  3LHP S;  1DD5 A;  3N0B A;  4GFQ A;  1XXB A;  1WIH A;  4FZB A;  1V9M A;  3LAP A;  1K4T A;  1Y69 8;  4J3N A;  3LF9 A;  4JLR C;  4GT9 A;  4GTA A;  1TWA A;  5JVO A;  2RH6 A;  1SMY D;  1TWF A;  3FHZ A;  2NVY A;  2E2I A;  4KAR A;  1B4A A;  2F4Q A;  2O5J D;  3HKZ A;  4Q5G A;  4LMO A;  3K57 A;  1IW7 D;  2JA7 A;  2XCO A;  4BKW A;  4C3J C;  2R92 A;  1YNN D;  3GTJ A;  4O26 A;  2P5M A;  1O29 A;  5EGE A;  1AB4 A;  2B63 A;  4FM9 A;  1TWG A;  2CFA B;  1XXC A;  2BE5 D;  5JSB B;  2ZFZ A;  4G0U A;  3OEP A;  4QCL A;  3H0G A;  4KB4 A;  4FXD A;  4KMA A;  1BJT A;  2CW0 D;  4AYB A;  1KQ4 A;  5IOT A;  2Y0S A;  1TGO A;  1A36 A;  1I50 A;  3S0X A;  1K4S A;  1HQM D;  5JSN B;  1MIU A;  4EJ3 A;  1F9N A;  3N3Y A;  1SFO A;  1LPQ A;  4FGU A;  3K59 A;  2GSO A;  2A6H D;  3SJR A;  4D3Z A;  1O2B A;  2PHC B;  4KDD A;  1O26 A;  4GTB A;  3ERE D;  2JA5 A;  1T8I A;  1RRJ A;  5TJ3 A;  4D3Y A;  1ZXO A;  1ZVU A;  3FOE A;  2RGR A;  3AQO A;  4P5A A;  4FYD A;  1B4B A;  3KYL A;  4Q5V A;  2JA6 A;  2KWA A;  2XCQ A;  4BLA A;  4DDQ A;  2R4G A;  3AH5 A;  4KMD A;  4AHC A;  3MAQ A;  3CAG A;  3K5N A;  2JH3 A;  1WCM A;  3GTG A;  5EGH A;  1O24 A;  1SEU A;  2WAQ A;  4NOK A;  4GTF A;  4IP9 A;  1WQG A;  1SC7 A;  4KAS A;  1R49 A;  1I6V D;  3L4J A;  4OYD B;  1WQH A;  3P9A A;  3K5M A;  3LPX A;  1YNJ D;  3GTQ A;  3ORE A;  5CHP A;  1WQF A;  4M1X A;  1A31 A;  1R9T A;  1XXA A;  4GTL A;  4KB2 A;  1Q8I A;  3K58 A;  2GSN A;  3NUH A;  1Y1W A;  4KM8 A;  5IOR A;  4C2M A;  2NVX A;  4GTD A;  1TL8 A;  3VA7 A;  3K5L A;  4KM9 A;  4LR2 A;  1O28 A;  1EK8 A;  2E2H A;  3FKI A;  1I3Q A;  4C3H C;  2GSU A;  3QX3 A;  3V4G A;  3GTM A;  2CFA A;  2B9S B;  1O27 A;  2XCR B;  4KAT A;  4G0W A;  1O25 A;  1ZYR D;  4NOM A;  4G0V A;  2R93 A;  3BUE A;  3CQZ A;  3DU6 A;  1O2A A;  3MML B;  2VUM A;  5IOQ A;  3OPF A;  1GE9 A;  4GTE A;  1RR8 C;  4IP8 A;  3M4A A;  4KMH A;  4LQY A;  1TWH A;  5CQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...