4GFQA

2.65 angstrom resolution crystal structure of ribosome recycling factor (frr) from bacillus anthracis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
186
structure length
186
Chain Sequence
AMGQQVLKFSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPYDKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLVKVVKKYAEEAKVAVRNVRRDGNDDLKKLEKAGEITEDDLRGYTEDIQKETDKYIAKVDEIAKNKEKEIMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title 2.65 Angstrom Resolution Crystal Structure of Ribosome Recycling Factor (frr) from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Translation
total genus 70
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4gfqA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gfqA02
3NUHA 3FOFA 1B4BA 1BJTA 3QX3A 3VA7A 3LF9A 5JVOA 1XXBA 3LPXA 3LAJA 3OREA 3ERED 5MLC9 4DDQA 1EH1A 4L8IA 2ZFZA 3L4KA 1WQHA 2KWAA 4G0UA 4KB4A 1EK8A 3V4GA 3BUEA 4KDDA 3LAPA 2XCQA 4KC6A 1ISEA 1WIHA 2PHCB 1IS1A 4KB2A 3LHPS 4J3NA 4GFQA 2XCRB 2P5MA 3FOEA 5JSNB 3FHZA 3L4JA 4G0WA 1BGWA 1WQGA 3CAGA 3OPFA 4KAWX 2Y3PA 3MMLB 5CJ9A 4JLRC 1F9NA 1XXCA 1WQFA 1ZVUA 4FM9A 4OYDB 4G0VA 1Y698 1GE9A 1B4AA 1XXAA 5JSBB 1AB4A 2XCOA 3OEPA 1DD5A 2RGRA
chains in the Genus database with same CATH superfamily
1O26A 1B4BA 1SFOK 4KMUA 3QX3A 3VA7A 3GTOA 2R92A 3K5NA 4FZBA 4A3DK 5IOTA 4L8IA 2WB1L 1WQHA 4GTAA 4A93C 4C3HK 4QJVB 1I3QK 3Q3QA 1JQWA 1USMA 5IYBC 3S1NC 5E68A 5C3EK 1F9NA 1ZQ1C 3G4AA 4A3GK 4OYDB 1O25A 5JSBB 1I6VA 3GTKA 4M1XA 4XSXA 3TTGA 2JA5K 3KYLA 5JVOA 2A68A 1XXBA 4C45A 2JA6K 3HOZK 1YX2A 1TWHC 3BUEA 4C3JC 2JH3A 4X6AC 3RZDC 3S0XA 1Y1VK 4BY7C 1WOPA 1IQ0A 4J3NA 3A8IA 3GTKK 3IAYA 3OPFA 2Y3PA 3GTPA 5IP9K 3S1MC 3GTJA 1XZQA 1ZYRA 2NVQC 4FM9A 2R93K 5M5WK 1Y698 1B4AA 4A93K 1IW7A 1UV7A 2A6EA 3DU5A 4GTBA 5IYBK 3S1NK 3OREA 2RH6A 3AQOA 4LMOA 4Y52C 3V4GA 1X31C 2E2IC 2CFAA 1ISEA 2NVYC 3GTGC 1I50K 2A6HA 1WOOA 4GT9A 4KASA 2A69D 5TMCA 1RU0A 4G7HA 4LR2A 3I4NK 3GTQA 1Y1WC 3GDZA 1TWCC 1TWHK 4NOIA 2O5JA 2YU9C 3CQZA 4O26A 3RZDK 4BY7K 4GZYA 1Q8IA 3P9AA 4H3TA 2E2HA 1JOEA 1SMYA 4FGUA 3WVOA 1K4SA 4KB4A 4YG2A 4OIOA 3S1MK 5HL8A 3N3YA 1INNA 2JA8K 3LHPS 3AD8C 1RR8C 5CQGA 4C2MK 4BXXC 2CW0A 3M4AA 1YNJD 4KARA 5C4JC 4BLAA 1VH2A 4Y52K 5EGHA 5FLMC 2GAHC 2V6UA 2GAGC 2ZUEA 2VUMK 1K83A 1DCPA 1TWGC 5C44K 1O29A 3M4OC 3H0GC 3GTGK 1EJ9A 3GEEA 3FKIA 3HXAA 1EK8A 1PJ7A 1BS2A 5L46A 4BBRC 4A3MC 3HOVK 4KB2A 3MAQA 3I4MC 3PO2K 5M5XK 2YU9K 3FOEA 1SFOA 1WCMK 3HKZD 3S16K 4O2DA 4YFNA 3K7AK 3GSIA 1ZXOA 5IOQA 2B63C 3GTMK 3AQPA 4G0VA 4A3CC 1VJEA 3OEPA 3GTOC 2XCOA 4KM9A 3FOFA 4FXDA 4BLBA 1I3QA 2R7ZC 4WJ3M 3M3YC 3GEHA 4ILDA 1J98A 4BXXK 3TFJA 4A3JC 1XZQB 3HOUC 4KN4A 5C4JK 2Y0SD 4Q5VA 4Y7NC 4KATA 4RMFA 2NVTK 1LPQA 2EBBA 2JA5A 1TWGK 2JA6A 3K5MA 3H0GK 4XCHA 5D4DA 4BY1K 1TWAK 4OIQA 2CFAB 4A3EC 3AH5A 2WB1A 1HI9A 1Y1VA 2GSOA 1I6HC 3GTLC 4A3MK 4EJ3A 4C3IK 4A3BK 4OIRA 3K57A 4BBSC 4A3FK 4NOMA 3T01A 3HOXC 3S14C 4QIWD 3S2HC 2R93A 1J6XA 2PHCB 4A3CK 3BP8C 5C4XC 3GTPC 5JSNB 2WAQD 1EQRA 2R7ZK 3S1QC 4LK1A 1ZVUA 3HOUK 4MEYA 2A69A 2RGRA 4LK0A 3NUHA 5CHPA 1I50A 3LF9A 5M5YK 1G51A 4AH6A 3S1RC 3S17C 5IP7C 4MEXA 3EQLA 4MQ9A 2FQOA 2XCQA 3A8JA 1TWHA 2FQTA 1HQMD 3K5LA 4KN7A 3H3VL 3AD7C 2P8TA 3FHZA 3GTLK 1A31A 3HOYC 5JFEA 4A3KC 4LQYA 1SC7A 4BBSK 3CQZC 4Q4ZA 1YNJA 1GE9A 2B9SB 4GTEA 1DD5A 3TFIA 4C3JK 2E2HC 3S2HK 4X6AK 1YNNA 4C2MA 2JA7C 5IYCC 4ZH4A 3HKZL 2PA8D 2ZUFA 2PMZL 3RZOC 4A3IC 4FYDA 3IPJA 2NVQK 2VUMA 3GTGA 4LOWA 2NVXC 2BE5D 4NOKA 3HKZA 1K83C 5IP7K 4WILA 4AHCA 5TMFA 3H3VD 3N0BA 2Y0SL 1TWCA 2E2IK 1VLOA 2PPBA 2YU9A 2NVYK 1O27A 4WJ4A 1WCMA 3SZYA 2W7VA 4KM8A 3WODA 2V6SA 4A3KK 3GTMA 4AN8A 3S2DC 1WIHA 1R9TC 4GFQA 1Y1WK 1TWCK 2Y0SA 1IE0A 1R49A 1O24A 1EFWA 2JA7K 5IYCK 1O2FB 1TWFC 1V5VA 4IP9A 2V6TA 2PMZD 3JSTA 1XZPA 4XLNA 4P5AA 1XXAA 1O2AA 4QIWL 2R92C 3RZOK 3GIRA 1L0WA 4A3IK 1F7VA 4AYBL 3DXJA 3K59A 5C3EC 1TWGA 2WAQL 3H0GA 4PABA 1O28A 4KMHA 2KWAA 2NVXK 4G0UA 3A8KA 2D6FC 2E2JC 1TWAA 4KDDA 3TFHA 3LAPA 4KC6A 5IORA 2CW0D 3SJRA 2XCRB 3HOZC 4QIWA 5EGEA 1VRQC 5FLMK 3K58A 4G7OA 4BKWA 3CAGA 1TGOA 3M4OK 2WAQA 1PJ5A 4JLRC 4P5BA 3ADAC 3GTKC 1PJ6A 1AB4A 4A3LC 1BDFA 5M3FK 2O5IA 3S2DK 4BBRK 1R9TK 4G7ZA 5IYDC 3N0CA 5IP9C 3I4MK 3ERED 2R93C 2R7ZA 1F7UA 4LLGA 1A35A 1NH3A 1TWFK 3GEIA 2B63K 1IS1A 1WOSA 1XPPA 4IP8A 4AYBD 2R92K 3GTOK 1HQMA 3GTJC 5C9HA 1RRJA 3M3YK 4NOLA 2PA8L 4A3JK 1I50C 4F3EA 5IOSA 2E2JK 4D3ZA 4Y7NK 1BJTA 3GTLA 4GTDA 1DCHA 3I4NC 1DCOA 2ZFZA 4OIPA 1IL2A 1WORA 1K4TA 3S15C 1MIUA 4A3EK 4A3LK 1R5ZA 2P5MA 1C0AA 4Q5GA 4P9SA 3PO3C 1I6HK 1BGWA 1WQGA 2WB1D 4PAAA 5IYDK 3GTQC 1I6VD 1XXCA 4XSZA 2JA8C 1ZBSA 2BE5A 4C2MC 3HOXK 4Q5SA 2A68D 5FJ8K 3S14K 4QJVA 1YCLA 1A36A 3HOWC 5C4XK 5MLC9 3GTPK 1SEUA 1O2BA 1J6WA 3GTJK 1XZPB 3AD9C 2VUMC 3BP3A 5C44C 3S1QK 2E2IA 3L4JA 2NVYA 3T00A 1ZYRD 3T02A 1USOA 1EI6A 1IW7D 3HOVC 3PO2C 3S1RK 3S17K 2A6ED 1WCMC 1VGXA 3DU6A 3S16C 2PMZA 4OINA 3S15K 1Y1WA 4XLPA 1WSRA 3K7AC 3FKIC 4GTCA 3LAJA 3GTMC 3PO3K 4KMDA 2JA7A 4KMAA 3GTQK 4D3YA 3HOYK 2A6HD 3CQZK 3SZZA 1SFOC 1J6VA 3K5OA 4A3DC 3G4CA 2E2HK 2GSNA 4KAWX 3MMLB 4C3HC 2O5JD 3HOWK 1WSVA 1YNND 2NVXA 1TL8A 2NVTC 1KQ4A 1I3QC 1V9MA 1JVIA 1SMYD 4JK1A 1T8IA 5TJ3A 4BY1C 3LPXA 1TWAC 4YFXA 4DDQA 1EH1A 4A3GC 1F93A 4C3IC 2R4GA 4A3BC 1K83K 2JA5C 4GTLA 4A3FC 2JA6C 4GTFA 1R9TA 4LJZA 4G0WA 4AYBA 3FKIK 5M3MK 4YFKA 2F4QA 5CJ9A 1IBAA 1Y1VC 4QCLA 1WQFA 1TWFA 2GSUA 3L4KA 2B63A
chains in the Genus database with same CATH topology
4D3ZA 1O26A 1B4BA 1BJTA 1O29A 3VA7A 3GTOA 4C2MA 2R92A 3QX3A 3K5NA 1EJ9A 3GTLA 4FZBA 4GTDA 5IOTA 3FKIA 4L8IA 2ZFZA 4GTAA 1WQHA 1EK8A 1K4TA 4FYDA 1MIUA 4KB2A 3MAQA 2VUMA 1R5ZA 2P5MA 3Q3QA 3FOEA 4Q5GA 1SFOA 3GTGA 1BGWA 1WQGA 2BE5D 4NOKA 3HKZA 1I6VD 1F9NA 1XXCA 1ZXOA 3G4AA 5IOQA 4OYDB 4AHCA 1ZBSA 1O25A 3AQPA 4G0VA 3OEPA 5JSBB 4C2MC 2XCOA 2A68D 3N0BA 1TWCA 3GTKA 4FXDA 4KM9A 4M1XA 1I3QA 4BLBA 2YU9A 3FOFA 1A36A 3KYLA 1O27A 5JVOA 1WCMA 1XXBA 4ILDA 4KM8A 5MLC9 1SEUA 1O2BA 4C3JC 3BUEA 3GTMA 4AN8A 2JH3A 3S0XA 4Q5VA 1WIHA 4KATA 4J3NA 4GFQA 1LPQA 2E2IA 2Y0SA 1R49A 2JA5A 2NVYA 1O24A 1ZYRD 3L4JA 3IAYA 2JA6A 3K5MA 3OPFA 2Y3PA 3GTPA 1IW7D 4IP9A 3GTJA 4FM9A 2CFAB 3AH5A 2WB1A 1Y698 1B4AA 1XXAA 1Y1VA 2A6ED 4P5AA 1O2AA 2GSOA 3DU6A 2PMZA 4EJ3A 1Y1WA 3DU5A 3K59A 4GTBA 4GTCA 1TWGA 3K57A 3LAJA 3OREA 2RH6A 4KMDA 3AQOA 3H0GA 2JA7A 4NOMA 1O28A 4KMHA 4LMOA 2KWAA 4KMAA 3V4GA 4G0UA 4D3YA 1TWAA 4KDDA 2R93A 3LAPA 2A6HD 2CFAA 1ISEA 4KC6A 2PHCB 5IORA 2CW0D 3SJRA 2XCRB 4QIWA 5EGEA 3K5OA 5JSNB 3G4CA 3K58A 2GSNA 4BKWA 3CAGA 4GT9A 1TGOA 4KAWX 4KASA 2A69D 3MMLB 4C3HC 2O5JD 2WAQA 1YNND 4JLRC 2NVXA 1TL8A 1ZVUA 4LR2A 4P5BA 3GTQA 2RGRA 1KQ4A 1AB4A 1V9MA 3CQZA 4O26A 1SMYD 3NUHA 5CHPA 1Q8IA 1T8IA 3P9AA 5IOSA 1I50A 5TJ3A 3LF9A 4H3TA 2E2HA 3LPXA 3N0CA 3ERED 4FGUA 2R7ZA 3WVOA 1EH1A 4DDQA 1K4SA 4KB4A 1A35A 1NH3A 2XCQA 2R4GA 4C3IC 1TWHA 1HQMD 3K5LA 1IS1A 3N3YA 3LHPS 4GTLA 4IP8A 1RR8C 5CQGA 4GTFA 3FHZA 1R9TA 4G0WA 1A31A 4AYBA 3M4AA 1YNJD 5C9HA 5JFEA 1RRJA 1SC7A 2F4QA 4KARA 4LQYA 5CJ9A 4QCLA 1WQFA 4BLAA 1TWFA 4NOLA 5EGHA 1GE9A 4F3EA 2GSUA 2B9SB 4GTEA 3L4KA 1DD5A 2B63A 1K83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NUH A;  3FOF A;  1B4B A;  1BJT A;  3QX3 A;  3VA7 A;  3LF9 A;  5JVO A;  1XXB A;  3LPX A;  3LAJ A;  3ORE A;  3ERE D;  5MLC 9;  4DDQ A;  1EH1 A;  4L8I A;  2ZFZ A;  3L4K A;  1WQH A;  2KWA A;  4G0U A;  4KB4 A;  1EK8 A;  3V4G A;  3BUE A;  4KDD A;  3LAP A;  2XCQ A;  4KC6 A;  1ISE A;  1WIH A;  2PHC B;  1IS1 A;  4KB2 A;  3LHP S;  4J3N A;  4GFQ A;  2XCR B;  2P5M A;  3FOE A;  5JSN B;  3FHZ A;  3L4J A;  4G0W A;  1BGW A;  1WQG A;  3CAG A;  3OPF A;  4KAW X;  2Y3P A;  3MML B;  5CJ9 A;  4JLR C;  1F9N A;  1XXC A;  1WQF A;  1ZVU A;  4FM9 A;  4OYD B;  4G0V A;  1Y69 8;  1GE9 A;  1B4A A;  1XXA A;  5JSB B;  1AB4 A;  2XCO A;  3OEP A;  1DD5 A;  2RGR A; 
#chains in the Genus database with same CATH topology
 1O26 A;  1B4B A;  1SFO K;  4KMU A;  3QX3 A;  3VA7 A;  3GTO A;  2R92 A;  3K5N A;  4FZB A;  4A3D K;  5IOT A;  4L8I A;  2WB1 L;  1WQH A;  4GTA A;  4A93 C;  4C3H K;  4QJV B;  1I3Q K;  3Q3Q A;  1JQW A;  1USM A;  5IYB C;  3S1N C;  5E68 A;  5C3E K;  1F9N A;  1ZQ1 C;  3G4A A;  4A3G K;  4OYD B;  1O25 A;  5JSB B;  1I6V A;  3GTK A;  4M1X A;  4XSX A;  3TTG A;  2JA5 K;  3KYL A;  5JVO A;  2A68 A;  1XXB A;  4C45 A;  2JA6 K;  3HOZ K;  1YX2 A;  1TWH C;  3BUE A;  4C3J C;  2JH3 A;  4X6A C;  3RZD C;  3S0X A;  1Y1V K;  4BY7 C;  1WOP A;  1IQ0 A;  4J3N A;  3A8I A;  3GTK K;  3IAY A;  3OPF A;  2Y3P A;  3GTP A;  5IP9 K;  3S1M C;  3GTJ A;  1XZQ A;  1ZYR A;  2NVQ C;  4FM9 A;  2R93 K;  5M5W K;  1Y69 8;  1B4A A;  4A93 K;  1IW7 A;  1UV7 A;  2A6E A;  3DU5 A;  4GTB A;  5IYB K;  3S1N K;  3ORE A;  2RH6 A;  3AQO A;  4LMO A;  4Y52 C;  3V4G A;  1X31 C;  2E2I C;  2CFA A;  1ISE A;  2NVY C;  3GTG C;  1I50 K;  2A6H A;  1WOO A;  4GT9 A;  4KAS A;  2A69 D;  5TMC A;  1RU0 A;  4G7H A;  4LR2 A;  3I4N K;  3GTQ A;  1Y1W C;  3GDZ A;  1TWC C;  1TWH K;  4NOI A;  2O5J A;  2YU9 C;  3CQZ A;  4O26 A;  3RZD K;  4BY7 K;  4GZY A;  1Q8I A;  3P9A A;  4H3T A;  2E2H A;  1JOE A;  1SMY A;  4FGU A;  3WVO A;  1K4S A;  4KB4 A;  4YG2 A;  4OIO A;  3S1M K;  5HL8 A;  3N3Y A;  1INN A;  2JA8 K;  3LHP S;  3AD8 C;  1RR8 C;  5CQG A;  4C2M K;  4BXX C;  2CW0 A;  3M4A A;  1YNJ D;  4KAR A;  5C4J C;  4BLA A;  1VH2 A;  4Y52 K;  5EGH A;  5FLM C;  2GAH C;  2V6U A;  2GAG C;  2ZUE A;  2VUM K;  1K83 A;  1DCP A;  1TWG C;  5C44 K;  1O29 A;  3M4O C;  3H0G C;  3GTG K;  1EJ9 A;  3GEE A;  3FKI A;  3HXA A;  1EK8 A;  1PJ7 A;  1BS2 A;  5L46 A;  4BBR C;  4A3M C;  3HOV K;  4KB2 A;  3MAQ A;  3I4M C;  3PO2 K;  5M5X K;  2YU9 K;  3FOE A;  1SFO A;  1WCM K;  3HKZ D;  3S16 K;  4O2D A;  4YFN A;  3K7A K;  3GSI A;  1ZXO A;  5IOQ A;  2B63 C;  3GTM K;  3AQP A;  4G0V A;  4A3C C;  1VJE A;  3OEP A;  3GTO C;  2XCO A;  4KM9 A;  3FOF A;  4FXD A;  4BLB A;  1I3Q A;  2R7Z C;  4WJ3 M;  3M3Y C;  3GEH A;  4ILD A;  1J98 A;  4BXX K;  3TFJ A;  4A3J C;  1XZQ B;  3HOU C;  4KN4 A;  5C4J K;  2Y0S D;  4Q5V A;  4Y7N C;  4KAT A;  4RMF A;  2NVT K;  1LPQ A;  2EBB A;  2JA5 A;  1TWG K;  2JA6 A;  3K5M A;  3H0G K;  4XCH A;  5D4D A;  4BY1 K;  1TWA K;  4OIQ A;  2CFA B;  4A3E C;  3AH5 A;  2WB1 A;  1HI9 A;  1Y1V A;  2GSO A;  1I6H C;  3GTL C;  4A3M K;  4EJ3 A;  4C3I K;  4A3B K;  4OIR A;  3K57 A;  4BBS C;  4A3F K;  4NOM A;  3T01 A;  3HOX C;  3S14 C;  4QIW D;  3S2H C;  2R93 A;  1J6X A;  2PHC B;  4A3C K;  3BP8 C;  5C4X C;  3GTP C;  5JSN B;  2WAQ D;  1EQR A;  2R7Z K;  3S1Q C;  4LK1 A;  1ZVU A;  3HOU K;  4MEY A;  2A69 A;  2RGR A;  4LK0 A;  3NUH A;  5CHP A;  1I50 A;  3LF9 A;  5M5Y K;  1G51 A;  4AH6 A;  3S1R C;  3S17 C;  5IP7 C;  4MEX A;  3EQL A;  4MQ9 A;  2FQO A;  2XCQ A;  3A8J A;  1TWH A;  2FQT A;  1HQM D;  3K5L A;  4KN7 A;  3H3V L;  3AD7 C;  2P8T A;  3FHZ A;  3GTL K;  1A31 A;  3HOY C;  5JFE A;  4A3K C;  4LQY A;  1SC7 A;  4BBS K;  3CQZ C;  4Q4Z A;  1YNJ A;  1GE9 A;  2B9S B;  4GTE A;  1DD5 A;  3TFI A;  4C3J K;  2E2H C;  3S2H K;  4X6A K;  1YNN A;  4C2M A;  2JA7 C;  5IYC C;  4ZH4 A;  3HKZ L;  2PA8 D;  2ZUF A;  2PMZ L;  3RZO C;  4A3I C;  4FYD A;  3IPJ A;  2NVQ K;  2VUM A;  3GTG A;  4LOW A;  2NVX C;  2BE5 D;  4NOK A;  3HKZ A;  1K83 C;  5IP7 K;  4WIL A;  4AHC A;  5TMF A;  3H3V D;  3N0B A;  2Y0S L;  1TWC A;  2E2I K;  1VLO A;  2PPB A;  2YU9 A;  2NVY K;  1O27 A;  4WJ4 A;  1WCM A;  3SZY A;  2W7V A;  4KM8 A;  3WOD A;  2V6S A;  4A3K K;  3GTM A;  4AN8 A;  3S2D C;  1WIH A;  1R9T C;  4GFQ A;  1Y1W K;  1TWC K;  2Y0S A;  1IE0 A;  1R49 A;  1O24 A;  1EFW A;  2JA7 K;  5IYC K;  1O2F B;  1TWF C;  1V5V A;  4IP9 A;  2V6T A;  2PMZ D;  3JST A;  1XZP A;  4XLN A;  4P5A A;  1XXA A;  1O2A A;  4QIW L;  2R92 C;  3RZO K;  3GIR A;  1L0W A;  4A3I K;  1F7V A;  4AYB L;  3DXJ A;  3K59 A;  5C3E C;  1TWG A;  2WAQ L;  3H0G A;  4PAB A;  1O28 A;  4KMH A;  2KWA A;  2NVX K;  4G0U A;  3A8K A;  2D6F C;  2E2J C;  1TWA A;  4KDD A;  3TFH A;  3LAP A;  4KC6 A;  5IOR A;  2CW0 D;  3SJR A;  2XCR B;  3HOZ C;  4QIW A;  5EGE A;  1VRQ C;  5FLM K;  3K58 A;  4G7O A;  4BKW A;  3CAG A;  1TGO A;  3M4O K;  2WAQ A;  1PJ5 A;  4JLR C;  4P5B A;  3ADA C;  3GTK C;  1PJ6 A;  1AB4 A;  4A3L C;  1BDF A;  5M3F K;  2O5I A;  3S2D K;  4BBR K;  1R9T K;  4G7Z A;  5IYD C;  3N0C A;  5IP9 C;  3I4M K;  3ERE D;  2R93 C;  2R7Z A;  1F7U A;  4LLG A;  1A35 A;  1NH3 A;  1TWF K;  3GEI A;  2B63 K;  1IS1 A;  1WOS A;  1XPP A;  4IP8 A;  4AYB D;  2R92 K;  3GTO K;  1HQM A;  3GTJ C;  5C9H A;  1RRJ A;  3M3Y K;  4NOL A;  2PA8 L;  4A3J K;  1I50 C;  4F3E A;  5IOS A;  2E2J K;  4D3Z A;  4Y7N K;  1BJT A;  3GTL A;  4GTD A;  1DCH A;  3I4N C;  1DCO A;  2ZFZ A;  4OIP A;  1IL2 A;  1WOR A;  1K4T A;  3S15 C;  1MIU A;  4A3E K;  4A3L K;  1R5Z A;  2P5M A;  1C0A A;  4Q5G A;  4P9S A;  3PO3 C;  1I6H K;  1BGW A;  1WQG A;  2WB1 D;  4PAA A;  5IYD K;  3GTQ C;  1I6V D;  1XXC A;  4XSZ A;  2JA8 C;  1ZBS A;  2BE5 A;  4C2M C;  3HOX K;  4Q5S A;  2A68 D;  5FJ8 K;  3S14 K;  4QJV A;  1YCL A;  1A36 A;  3HOW C;  5C4X K;  5MLC 9;  3GTP K;  1SEU A;  1O2B A;  1J6W A;  3GTJ K;  1XZP B;  3AD9 C;  2VUM C;  3BP3 A;  5C44 C;  3S1Q K;  2E2I A;  3L4J A;  2NVY A;  3T00 A;  1ZYR D;  3T02 A;  1USO A;  1EI6 A;  1IW7 D;  3HOV C;  3PO2 C;  3S1R K;  3S17 K;  2A6E D;  1WCM C;  1VGX A;  3DU6 A;  3S16 C;  2PMZ A;  4OIN A;  3S15 K;  1Y1W A;  4XLP A;  1WSR A;  3K7A C;  3FKI C;  4GTC A;  3LAJ A;  3GTM C;  3PO3 K;  4KMD A;  2JA7 A;  4KMA A;  3GTQ K;  4D3Y A;  3HOY K;  2A6H D;  3CQZ K;  3SZZ A;  1SFO C;  1J6V A;  3K5O A;  4A3D C;  3G4C A;  2E2H K;  2GSN A;  4KAW X;  3MML B;  4C3H C;  2O5J D;  3HOW K;  1WSV A;  1YNN D;  2NVX A;  1TL8 A;  2NVT C;  1KQ4 A;  1I3Q C;  1V9M A;  1JVI A;  1SMY D;  4JK1 A;  1T8I A;  5TJ3 A;  4BY1 C;  3LPX A;  1TWA C;  4YFX A;  4DDQ A;  1EH1 A;  4A3G C;  1F93 A;  4C3I C;  2R4G A;  4A3B C;  1K83 K;  2JA5 C;  4GTL A;  4A3F C;  2JA6 C;  4GTF A;  1R9T A;  4LJZ A;  4G0W A;  4AYB A;  3FKI K;  5M3M K;  4YFK A;  2F4Q A;  5CJ9 A;  1IBA A;  1Y1V C;  4QCL A;  1WQF A;  1TWF A;  2GSU A;  3L4K A;  2B63 A; 
#chains in the Genus database with same CATH homology
 4D3Z A;  1O26 A;  1B4B A;  1BJT A;  1O29 A;  3VA7 A;  3GTO A;  4C2M A;  2R92 A;  3QX3 A;  3K5N A;  1EJ9 A;  3GTL A;  4FZB A;  4GTD A;  5IOT A;  3FKI A;  4L8I A;  2ZFZ A;  4GTA A;  1WQH A;  1EK8 A;  1K4T A;  4FYD A;  1MIU A;  4KB2 A;  3MAQ A;  2VUM A;  1R5Z A;  2P5M A;  3Q3Q A;  3FOE A;  4Q5G A;  1SFO A;  3GTG A;  1BGW A;  1WQG A;  2BE5 D;  4NOK A;  3HKZ A;  1I6V D;  1F9N A;  1XXC A;  1ZXO A;  3G4A A;  5IOQ A;  4OYD B;  4AHC A;  1ZBS A;  1O25 A;  3AQP A;  4G0V A;  3OEP A;  5JSB B;  4C2M C;  2XCO A;  2A68 D;  3N0B A;  1TWC A;  3GTK A;  4FXD A;  4KM9 A;  4M1X A;  1I3Q A;  4BLB A;  2YU9 A;  3FOF A;  1A36 A;  3KYL A;  1O27 A;  5JVO A;  1WCM A;  1XXB A;  4ILD A;  4KM8 A;  5MLC 9;  1SEU A;  1O2B A;  4C3J C;  3BUE A;  3GTM A;  4AN8 A;  2JH3 A;  3S0X A;  4Q5V A;  1WIH A;  4KAT A;  4J3N A;  4GFQ A;  1LPQ A;  2E2I A;  2Y0S A;  1R49 A;  2JA5 A;  2NVY A;  1O24 A;  1ZYR D;  3L4J A;  3IAY A;  2JA6 A;  3K5M A;  3OPF A;  2Y3P A;  3GTP A;  1IW7 D;  4IP9 A;  3GTJ A;  4FM9 A;  2CFA B;  3AH5 A;  2WB1 A;  1Y69 8;  1B4A A;  1XXA A;  1Y1V A;  2A6E D;  4P5A A;  1O2A A;  2GSO A;  3DU6 A;  2PMZ A;  4EJ3 A;  1Y1W A;  3DU5 A;  3K59 A;  4GTB A;  4GTC A;  1TWG A;  3K57 A;  3LAJ A;  3ORE A;  2RH6 A;  4KMD A;  3AQO A;  3H0G A;  2JA7 A;  4NOM A;  1O28 A;  4KMH A;  4LMO A;  2KWA A;  4KMA A;  3V4G A;  4G0U A;  4D3Y A;  1TWA A;  4KDD A;  2R93 A;  3LAP A;  2A6H D;  2CFA A;  1ISE A;  4KC6 A;  2PHC B;  5IOR A;  2CW0 D;  3SJR A;  2XCR B;  4QIW A;  5EGE A;  3K5O A;  5JSN B;  3G4C A;  3K58 A;  2GSN A;  4BKW A;  3CAG A;  4GT9 A;  1TGO A;  4KAW X;  4KAS A;  2A69 D;  3MML B;  4C3H C;  2O5J D;  2WAQ A;  1YNN D;  4JLR C;  2NVX A;  1TL8 A;  1ZVU A;  4LR2 A;  4P5B A;  3GTQ A;  2RGR A;  1KQ4 A;  1AB4 A;  1V9M A;  3CQZ A;  4O26 A;  1SMY D;  3NUH A;  5CHP A;  1Q8I A;  1T8I A;  3P9A A;  5IOS A;  1I50 A;  5TJ3 A;  3LF9 A;  4H3T A;  2E2H A;  3LPX A;  3N0C A;  3ERE D;  4FGU A;  2R7Z A;  3WVO A;  1EH1 A;  4DDQ A;  1K4S A;  4KB4 A;  1A35 A;  1NH3 A;  2XCQ A;  2R4G A;  4C3I C;  1TWH A;  1HQM D;  3K5L A;  1IS1 A;  3N3Y A;  3LHP S;  4GTL A;  4IP8 A;  1RR8 C;  5CQG A;  4GTF A;  3FHZ A;  1R9T A;  4G0W A;  1A31 A;  4AYB A;  3M4A A;  1YNJ D;  5C9H A;  5JFE A;  1RRJ A;  1SC7 A;  2F4Q A;  4KAR A;  4LQY A;  5CJ9 A;  4QCL A;  1WQF A;  4BLA A;  1TWF A;  4NOL A;  5EGH A;  1GE9 A;  4F3E A;  2GSU A;  2B9S B;  4GTE A;  3L4K A;  1DD5 A;  2B63 A;  1K83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...