4GFQA

2.65 angstrom resolution crystal structure of ribosome recycling factor (frr) from bacillus anthracis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
186
structure length
186
Chain Sequence
AMGQQVLKFSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPYDKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLVKVVKKYAEEAKVAVRNVRRDGNDDLKKLEKAGEITEDDLRGYTEDIQKETDKYIAKVDEIAKNKEKEIMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Ribosome-recycling factor
publication title 2.65 Angstrom Resolution Crystal Structure of Ribosome Recycling Factor (frr) from Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 70
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4gfqA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gfqA02
2Y3PA 1Y698 2ZFZA 3MMLB 1DD5A 4GFQA 3V4GA 1BJTA 3L4KA 3VA7A 4KDDA 1WQFA 1WIHA 1IS1A 5JSNB 4G0WA 5JSBB 1EH1A 1EK8A 4KAWX 3OEPA 4KC6A 3L4JA 4G0UA 3ERED 3QX3A 1BGWA 2KWAA 4G0VA 1XXCA 3LAJA 1ISEA 3LAPA 4KB4A 2RGRA 4L8IA 1XXAA 4KB2A 5CJ9A 3FOEA 3OPFA 3OREA 4DDQA 3LPXA 2PHCB 4JLRC 2P5MA 4FM9A 2XCRB 2XCOA 4J3NA 1F9NA 5JVOA 1GE9A 1AB4A 1XXBA 1ZVUA 3FHZA 2XCQA 1WQHA 1B4AA 3LHPS 3NUHA 4OYDB 1B4BA 5MLC9 1WQGA 3CAGA 3FOFA 3LF9A 3BUEA
chains in the Genus database with same CATH superfamily
3S1QC 1V9MA 4QIWL 3K5OA 4AYBA 1TGOA 1R9TK 4P5BA 2R7ZK 2E2HK 3QX3A 3I4NC 3AQOA 2PA8L 3M3YC 4OINA 3K7AK 1K83C 5EGHA 5FLMC 1AB4A 5C44C 4PABA 3HKZL 1IL2A 2R93C 3DU5A 3FKIA 2PMZD 1WOPA 3GEHA 3MMLB 1DD5A 5C4JC 3S14C 4G0WA 3RZDK 4KAWX 1ZBSA 4A3DK 4G0UA 1A35A 4GTLA 3RZOC 3LAJA 4A3BK 1TWHA 4LK1A 3GTJA 3AH5A 2O5IA 1TWAA 1YNJD 4NOLA 1F9NA 1Y1WK 3S16C 4C2MK 3A8KA 1L0WA 3MAQA 4BBRC 3S1NK 5IP7C 4AYBL 3S17K 4C3HC 3K5NA 1SFOK 3S1RK 3S2DC 3K5LA 4PAAA 4OIOA 1J6VA 4BXXC 3GTPA 4A3JC 2F4QA 2YU9C 4BY1C 1TWHC 4Q5GA 1TWFA 3OPFA 1ZQ1C 4YFXA 1I6HK 5C4XK 3K58A 4J3NA 4KMHA 2E2IA 4QJVB 3S1MK 1TWGA 4ILDA 4QIWD 2JA6C 3G4CA 5IYCC 3S0XA 3M4OK 1J6XA 1C0AA 4FZBA 1WQFA 3H3VD 3GTLA 5JSBB 1EH1A 4GTEA 1BGWA 4KB4A 3HOZC 3GTPC 4Y52K 3DXJA 4BBSC 4A93K 1TWFC 3DU6A 1Y1VA 5E68A 2NVQC 5TJ3A 2XCOA 3GTQK 1INNA 4GTDA 4C3JC 2ZUEA 4A3IC 2E2IC 3HOYK 1WSRA 3JSTA 1TWGC 1K4SA 2FQTA 4LMOA 4KDDA 5M3FK 2NVTC 2E2JC 3ADAC 4A3CK 2NVXK 3GTLC 1EK8A 2A69A 1EQRA 3HOUK 1TL8A 2JA5A 1R9TA 4A3EK 4C3IK 1JQWA 5C3EC 3LAPA 2JA7K 2E2HA 5D4DA 3AD9C 5CJ9A 1R49A 1WORA 4GTAA 1Y1VC 4A3MK 1HQMD 4Y7NK 3PO3K 1XXBA 2JH3A 3FHZA 2VUMK 3GTOK 3GTKK 3H0GK 5MLC9 1MIUA 4G7OA 1R5ZA 1HQMA 2ZFZA 1SC7A 4LJZA 3L4KA 1BJTA 1IE0A 5IYDK 4O2DA 3BP8C 3HOXC 2EBBA 4A3LK 5IYBC 4QCLA 3GTGK 4YG2A 2JA5C 1R9TC 2E2HC 3GTMK 3H3VL 2CW0D 4GTBA 2P5MA 1X31C 1F93A 3CQZA 2O5JD 1HI9A 1O27A 1Y1WA 3N0BA 4OYDB 5M5YK 4NOKA 2CW0A 1WQGA 3BUEA 1XZPB 4YFNA 3I4NK 4D3YA 3M4AA 2O5JA 3M3YK 3TTGA 4FXDA 4LLGA 1K83K 1I3QA 1ISEA 1SFOA 5FLMK 5C44K 4AHCA 2R93K 4KB2A 4A3BC 3WVOA 1VRQC 4Q5SA 3CQZC 4QJVA 5C4JK 4A3KK 4FYDA 3S14K 1WOOA 1Y1WC 4KASA 4XSXA 3K5MA 1VH2A 2R92A 3FKIC 3RZOK 1RR8C 4OIQA 2WAQD 3L4JA 1IQ0A 2A6ED 1A31A 1JOEA 3T01A 1O29A 1XXCA 1I3QC 2V6SA 2JA8C 3S16K 4L8IA 4AH6A 4KM8A 4LR2A 4A3FC 3IAYA 2WAQA 3GTJC 2GSNA 1J98A 2A6EA 1TWAC 4BBRK 1I50A 4KMAA 5IP7K 1RU0A 5EGEA 2ZUFA 2B63A 3FOFA 4MEXA 3S2DK 4LOWA 4EJ3A 1V5VA 4IP8A 2NVYA 2R92C 4OIPA 4BXXK 4NOIA 3A8IA 4A3JK 2YU9K 4BY1K 1TWHK 1WOSA 2Y0SD 3M4OC 4LK0A 3S2HC 5M5XK 3OEPA 3I4MC 2KWAA 1I6VD 1XPPA 3S15C 2NVXA 3T02A 5IP9K 3WODA 2Y0SA 2JA7A 5IORA 3LPXA 2JA6K 4JLRC 2A68D 1O24A 1PJ7A 4MQ9A 4Y52C 1BDFA 1I6VA 3HOVC 1I50C 3PO2C 1B4AA 4X6AK 1PJ6A 1WCMA 1KQ4A 2P8TA 4WILA 1VGXA 2A69D 2B63C 3H0GA 2A68A 1T8IA 3V4GA 2NVYC 3HOZK 1WIHA 3GTPK 4BBSK 1USOA 4A3GK 1TWFK 3ERED 3HOWC 1O28A 3GTGA 2R7ZA 3GEIA 4C3JK 4A3IK 2NVXC 2FQOA 2E2IK 1ZYRD 1F7UA 2WAQL 4WJ4A 1O2FB 1TWGK 1LPQA 4RMFA 5C9HA 2NVTK 4AN8A 2E2JK 4A3MC 1B4BA 1WCMC 4JK1A 1ZYRA 4KARA 4WJ3M 3GTLK 1XZPA 1DCPA 1JVIA 4KN7A 3H0GC 5C3EK 2CFAB 2W7VA 4GTFA 4BY7C 3AD8C 1Y1VK 1TWCK 4KN4A 1XXAA 1K83A 1G51A 4H3TA 2R7ZC 3GTGC 2Y0SL 4GZYA 2RH6A 4KATA 4BLAA 2R93A 4XSZA 4P5AA 4FGUA 2XCQA 5IOTA 3K7AC 1O2BA 3SZZA 3HOXK 3S1QK 4G7ZA 3LF9A 4BLBA 5IYBK 4C2MA 3FOEA 2WB1D 4D3ZA 2JA5K 1XZQB 5JSNB 4ZH4A 2D6FC 3TFJA 4G0VA 2WB1A 3RZDC 3A8JA 4A3DC 4OIRA 5TMFA 3TFHA 3SJRA 1DCOA 3K57A 4BKWA 4P9SA 1YX2A 4C2MC 2Y3PA 4A3KC 4Q5VA 3GIRA 4LQYA 1IS1A 2PMZA 1SEUA 3S1NC 2YU9A 2GAGC 5TMCA 3KYLA 3S17C 3P9AA 3CQZK 3S1RC 2B9SB 1SFOC 1RRJA 1O25A 1WSVA 2BE5D 5IOSA 5IOQA 1GE9A 2V6UA 4M1XA 3FKIK 2JA6A 2PPBA 1VJEA 3G4AA 1K4TA 1VLOA 3GTQA 1I6HC 1YNJA 5HL8A 5C4XC 4C3HK 1PJ5A 2BE5A 4KM9A 4XLNA 3BP3A 1I3QK 2JA8K 3S1MC 4XLPA 2A6HD 3EQLA 4A3FK 4G7HA 1EI6A 3GTJK 2WB1L 3N0CA 5CHPA 1TWAK 3IPJA 2RGRA 4KMUA 5JFEA 3TFIA 4DDQA 2A6HA 4FM9A 5IYCK 2V6TA 1ZVUA 5IP9C 1WQHA 2R92K 4A93C 1YNND 1IW7D 1BS2A 3GTQC 3S2HK 2PHCB 2XCRB 5M5WK 3I4MK 1EJ9A 4X6AC 2VUMA 3K59A 3GTOA 3GTKA 3HOYC 3HXAA 3S15K 3VA7A 2CFAA 2PA8D 3SZYA 4QIWA 4GT9A 4F3EA 1O26A 1YNNA 4IP9A 2PMZL 1IW7A 4O26A 2NVQK 3GSIA 3HKZD 3GDZA 3HOVK 1I50K 3PO2K 4A3CC 4A3GC 1UV7A 1TWCA 3HOUC 3AD7C 4Q4ZA 4A3EC 4C3IC 5JVOA 2JA7C 1YCLA 2B63K 3GTMA 4XCHA 1J6WA 3HKZA 5CQGA 2NVYK 1Q8IA 1ZXOA 3CAGA 1NH3A 1IBAA 4Y7NC 4KMDA 3PO3C 5L46A 3HOWK 1Y698 1EFWA 2VUMC 1SMYD 4GFQA 5M3MK 3GTOC 3GTKC 4YFKA 1XZQA 5FJ8K 4MEYA 1USMA 1DCHA 2GAHC 4KC6A 3AQPA 3GEEA 1O2AA 5IYDC 1SMYA 3Q3QA 4A3LC 3OREA 1TWCC 1WCMK 4C45A 1F7VA 3N3YA 1A36A 2R4GA 3GTMC 4AYBD 3LHPS 3NUHA 4BY7K 3T00A 2GSOA 4GTCA 4NOMA 2GSUA
chains in the Genus database with same CATH topology
4IP8A 4C2MC 2Y3PA 2NVYA 4Q5VA 1V9MA 4KDDA 4LQYA 1IS1A 3K5OA 1TGOA 4AYBA 4P5BA 1EK8A 3OEPA 2PMZA 3QX3A 1SEUA 1TL8A 2JA5A 2YU9A 1I6VD 1R9TA 2KWAA 3AQOA 2NVXA 3LAPA 3KYLA 2E2HA 3P9AA 2B9SB 5CJ9A 1R49A 1RRJA 2Y0SA 2JA7A 1O25A 3LPXA 5EGHA 2BE5D 4JLRC 4GTAA 5IORA 5IOSA 5IOQA 1HQMD 2A68D 1O24A 1GE9A 1AB4A 4M1XA 1XXBA 2JH3A 3FHZA 2JA6A 1B4AA 3G4AA 1K4TA 1WCMA 3DU5A 3GTQA 1KQ4A 5MLC9 3FKIA 2A69D 1MIUA 4KM9A 1R5ZA 3H0GA 2ZFZA 1SC7A 1DD5A 1T8IA 3MMLB 1BJTA 3V4GA 3L4KA 1WIHA 4G0WA 2A6HD 4KAWX 4QCLA 1ZBSA 4G0UA 3ERED 1A35A 4GTLA 3LAJA 1O28A 3N0CA 5CHPA 1TWHA 2RGRA 3GTGA 2R7ZA 5JFEA 3GTJA 2CW0D 1ZYRD 3AH5A 1TWAA 4GTBA 4DDQA 1YNJD 2P5MA 4FM9A 4NOLA 1F9NA 1LPQA 3CQZA 1ZVUA 2O5JD 1WQHA 1O27A 5C9HA 1Y1WA 1YNND 4OYDB 4AN8A 3MAQA 3N0BA 1B4BA 4NOKA 1IW7D 1WQGA 4KARA 2PHCB 3BUEA 2XCRB 1EJ9A 2VUMA 3K59A 4D3YA 3GTOA 3GTKA 3M4AA 2CFAB 2CFAA 4GTFA 3VA7A 4C3HC 4QIWA 4GT9A 4F3EA 3K5NA 1O26A 4IP9A 3K5LA 4FXDA 1I3QA 4O26A 1ISEA 1SFOA 3GTPA 2F4QA 1XXAA 4Q5GA 1K83A 4AHCA 4H3TA 1TWFA 4KB2A 1TWCA 3OPFA 2RH6A 4KATA 3K58A 4BLAA 2R93A 4KMHA 4J3NA 4C3IC 5JVOA 3WVOA 4P5AA 3GTMA 2E2IA 4FGUA 2XCQA 3HKZA 5IOTA 5CQGA 4FYDA 1TWGA 1O2BA 4ILDA 1Q8IA 1ZXOA 3CAGA 1NH3A 3LF9A 3G4CA 4KASA 4C2MA 4KMDA 4BLBA 3S0XA 3FOEA 3K5MA 2R92A 1Y698 4FZBA 1SMYD 4GFQA 4D3ZA 1RR8C 1WQFA 5JSNB 3GTLA 5JSBB 1EH1A 4GTEA 4KC6A 3L4JA 2A6ED 1A31A 3AQPA 1BGWA 1O2AA 4G0VA 1O29A 1XXCA 2WB1A 4KB4A 4L8IA 3Q3QA 4KM8A 4LR2A 3IAYA 3DU6A 3OREA 1Y1VA 2WAQA 2GSNA 5TJ3A 3SJRA 2XCOA 3N3YA 1I50A 4GTDA 1A36A 4C3JC 3K57A 2R4GA 4KMAA 4BKWA 3LHPS 3NUHA 5EGEA 2GSOA 4GTCA 1K4SA 2B63A 3FOFA 4NOMA 2GSUA 4EJ3A 4LMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3P A;  1Y69 8;  2ZFZ A;  3MML B;  1DD5 A;  4GFQ A;  3V4G A;  1BJT A;  3L4K A;  3VA7 A;  4KDD A;  1WQF A;  1WIH A;  1IS1 A;  5JSN B;  4G0W A;  5JSB B;  1EH1 A;  1EK8 A;  4KAW X;  3OEP A;  4KC6 A;  3L4J A;  4G0U A;  3ERE D;  3QX3 A;  1BGW A;  2KWA A;  4G0V A;  1XXC A;  3LAJ A;  1ISE A;  3LAP A;  4KB4 A;  2RGR A;  4L8I A;  1XXA A;  4KB2 A;  5CJ9 A;  3FOE A;  3OPF A;  3ORE A;  4DDQ A;  3LPX A;  2PHC B;  4JLR C;  2P5M A;  4FM9 A;  2XCR B;  2XCO A;  4J3N A;  1F9N A;  5JVO A;  1GE9 A;  1AB4 A;  1XXB A;  1ZVU A;  3FHZ A;  2XCQ A;  1WQH A;  1B4A A;  3LHP S;  3NUH A;  4OYD B;  1B4B A;  5MLC 9;  1WQG A;  3CAG A;  3FOF A;  3LF9 A;  3BUE A; 
#chains in the Genus database with same CATH topology
 3S1Q C;  1V9M A;  4QIW L;  3K5O A;  4AYB A;  1TGO A;  1R9T K;  4P5B A;  2R7Z K;  2E2H K;  3QX3 A;  3I4N C;  3AQO A;  2PA8 L;  3M3Y C;  4OIN A;  3K7A K;  1K83 C;  5EGH A;  5FLM C;  1AB4 A;  5C44 C;  4PAB A;  3HKZ L;  1IL2 A;  2R93 C;  3DU5 A;  3FKI A;  2PMZ D;  1WOP A;  3GEH A;  3MML B;  1DD5 A;  5C4J C;  3S14 C;  4G0W A;  3RZD K;  4KAW X;  1ZBS A;  4A3D K;  4G0U A;  1A35 A;  4GTL A;  3RZO C;  3LAJ A;  4A3B K;  1TWH A;  4LK1 A;  3GTJ A;  3AH5 A;  2O5I A;  1TWA A;  1YNJ D;  4NOL A;  1F9N A;  1Y1W K;  3S16 C;  4C2M K;  3A8K A;  1L0W A;  3MAQ A;  4BBR C;  3S1N K;  5IP7 C;  4AYB L;  3S17 K;  4C3H C;  3K5N A;  1SFO K;  3S1R K;  3S2D C;  3K5L A;  4PAA A;  4OIO A;  1J6V A;  4BXX C;  3GTP A;  4A3J C;  2F4Q A;  2YU9 C;  4BY1 C;  1TWH C;  4Q5G A;  1TWF A;  3OPF A;  1ZQ1 C;  4YFX A;  1I6H K;  5C4X K;  3K58 A;  4J3N A;  4KMH A;  2E2I A;  4QJV B;  3S1M K;  1TWG A;  4ILD A;  4QIW D;  2JA6 C;  3G4C A;  5IYC C;  3S0X A;  3M4O K;  1J6X A;  1C0A A;  4FZB A;  1WQF A;  3H3V D;  3GTL A;  5JSB B;  1EH1 A;  4GTE A;  1BGW A;  4KB4 A;  3HOZ C;  3GTP C;  4Y52 K;  3DXJ A;  4BBS C;  4A93 K;  1TWF C;  3DU6 A;  1Y1V A;  5E68 A;  2NVQ C;  5TJ3 A;  2XCO A;  3GTQ K;  1INN A;  4GTD A;  4C3J C;  2ZUE A;  4A3I C;  2E2I C;  3HOY K;  1WSR A;  3JST A;  1TWG C;  1K4S A;  2FQT A;  4LMO A;  4KDD A;  5M3F K;  2NVT C;  2E2J C;  3ADA C;  4A3C K;  2NVX K;  3GTL C;  1EK8 A;  2A69 A;  1EQR A;  3HOU K;  1TL8 A;  2JA5 A;  1R9T A;  4A3E K;  4C3I K;  1JQW A;  5C3E C;  3LAP A;  2JA7 K;  2E2H A;  5D4D A;  3AD9 C;  5CJ9 A;  1R49 A;  1WOR A;  4GTA A;  1Y1V C;  4A3M K;  1HQM D;  4Y7N K;  3PO3 K;  1XXB A;  2JH3 A;  3FHZ A;  2VUM K;  3GTO K;  3GTK K;  3H0G K;  5MLC 9;  1MIU A;  4G7O A;  1R5Z A;  1HQM A;  2ZFZ A;  1SC7 A;  4LJZ A;  3L4K A;  1BJT A;  1IE0 A;  5IYD K;  4O2D A;  3BP8 C;  3HOX C;  2EBB A;  4A3L K;  5IYB C;  4QCL A;  3GTG K;  4YG2 A;  2JA5 C;  1R9T C;  2E2H C;  3GTM K;  3H3V L;  2CW0 D;  4GTB A;  2P5M A;  1X31 C;  1F93 A;  3CQZ A;  2O5J D;  1HI9 A;  1O27 A;  1Y1W A;  3N0B A;  4OYD B;  5M5Y K;  4NOK A;  2CW0 A;  1WQG A;  3BUE A;  1XZP B;  4YFN A;  3I4N K;  4D3Y A;  3M4A A;  2O5J A;  3M3Y K;  3TTG A;  4FXD A;  4LLG A;  1K83 K;  1I3Q A;  1ISE A;  1SFO A;  5FLM K;  5C44 K;  4AHC A;  2R93 K;  4KB2 A;  4A3B C;  3WVO A;  1VRQ C;  4Q5S A;  3CQZ C;  4QJV A;  5C4J K;  4A3K K;  4FYD A;  3S14 K;  1WOO A;  1Y1W C;  4KAS A;  4XSX A;  3K5M A;  1VH2 A;  2R92 A;  3FKI C;  3RZO K;  1RR8 C;  4OIQ A;  2WAQ D;  3L4J A;  1IQ0 A;  2A6E D;  1A31 A;  1JOE A;  3T01 A;  1O29 A;  1XXC A;  1I3Q C;  2V6S A;  2JA8 C;  3S16 K;  4L8I A;  4AH6 A;  4KM8 A;  4LR2 A;  4A3F C;  3IAY A;  2WAQ A;  3GTJ C;  2GSN A;  1J98 A;  2A6E A;  1TWA C;  4BBR K;  1I50 A;  4KMA A;  5IP7 K;  1RU0 A;  5EGE A;  2ZUF A;  2B63 A;  3FOF A;  4MEX A;  3S2D K;  4LOW A;  4EJ3 A;  1V5V A;  4IP8 A;  2NVY A;  2R92 C;  4OIP A;  4BXX K;  4NOI A;  3A8I A;  4A3J K;  2YU9 K;  4BY1 K;  1TWH K;  1WOS A;  2Y0S D;  3M4O C;  4LK0 A;  3S2H C;  5M5X K;  3OEP A;  3I4M C;  2KWA A;  1I6V D;  1XPP A;  3S15 C;  2NVX A;  3T02 A;  5IP9 K;  3WOD A;  2Y0S A;  2JA7 A;  5IOR A;  3LPX A;  2JA6 K;  4JLR C;  2A68 D;  1O24 A;  1PJ7 A;  4MQ9 A;  4Y52 C;  1BDF A;  1I6V A;  3HOV C;  1I50 C;  3PO2 C;  1B4A A;  4X6A K;  1PJ6 A;  1WCM A;  1KQ4 A;  2P8T A;  4WIL A;  1VGX A;  2A69 D;  2B63 C;  3H0G A;  2A68 A;  1T8I A;  3V4G A;  2NVY C;  3HOZ K;  1WIH A;  3GTP K;  4BBS K;  1USO A;  4A3G K;  1TWF K;  3ERE D;  3HOW C;  1O28 A;  3GTG A;  2R7Z A;  3GEI A;  4C3J K;  4A3I K;  2NVX C;  2FQO A;  2E2I K;  1ZYR D;  1F7U A;  2WAQ L;  4WJ4 A;  1O2F B;  1TWG K;  1LPQ A;  4RMF A;  5C9H A;  2NVT K;  4AN8 A;  2E2J K;  4A3M C;  1B4B A;  1WCM C;  4JK1 A;  1ZYR A;  4KAR A;  4WJ3 M;  3GTL K;  1XZP A;  1DCP A;  1JVI A;  4KN7 A;  3H0G C;  5C3E K;  2CFA B;  2W7V A;  4GTF A;  4BY7 C;  3AD8 C;  1Y1V K;  1TWC K;  4KN4 A;  1XXA A;  1K83 A;  1G51 A;  4H3T A;  2R7Z C;  3GTG C;  2Y0S L;  4GZY A;  2RH6 A;  4KAT A;  4BLA A;  2R93 A;  4XSZ A;  4P5A A;  4FGU A;  2XCQ A;  5IOT A;  3K7A C;  1O2B A;  3SZZ A;  3HOX K;  3S1Q K;  4G7Z A;  3LF9 A;  4BLB A;  5IYB K;  4C2M A;  3FOE A;  2WB1 D;  4D3Z A;  2JA5 K;  1XZQ B;  5JSN B;  4ZH4 A;  2D6F C;  3TFJ A;  4G0V A;  2WB1 A;  3RZD C;  3A8J A;  4A3D C;  4OIR A;  5TMF A;  3TFH A;  3SJR A;  1DCO A;  3K57 A;  4BKW A;  4P9S A;  1YX2 A;  4C2M C;  2Y3P A;  4A3K C;  4Q5V A;  3GIR A;  4LQY A;  1IS1 A;  2PMZ A;  1SEU A;  3S1N C;  2YU9 A;  2GAG C;  5TMC A;  3KYL A;  3S17 C;  3P9A A;  3CQZ K;  3S1R C;  2B9S B;  1SFO C;  1RRJ A;  1O25 A;  1WSV A;  2BE5 D;  5IOS A;  5IOQ A;  1GE9 A;  2V6U A;  4M1X A;  3FKI K;  2JA6 A;  2PPB A;  1VJE A;  3G4A A;  1K4T A;  1VLO A;  3GTQ A;  1I6H C;  1YNJ A;  5HL8 A;  5C4X C;  4C3H K;  1PJ5 A;  2BE5 A;  4KM9 A;  4XLN A;  3BP3 A;  1I3Q K;  2JA8 K;  3S1M C;  4XLP A;  2A6H D;  3EQL A;  4A3F K;  4G7H A;  1EI6 A;  3GTJ K;  2WB1 L;  3N0C A;  5CHP A;  1TWA K;  3IPJ A;  2RGR A;  4KMU A;  5JFE A;  3TFI A;  4DDQ A;  2A6H A;  4FM9 A;  5IYC K;  2V6T A;  1ZVU A;  5IP9 C;  1WQH A;  2R92 K;  4A93 C;  1YNN D;  1IW7 D;  1BS2 A;  3GTQ C;  3S2H K;  2PHC B;  2XCR B;  5M5W K;  3I4M K;  1EJ9 A;  4X6A C;  2VUM A;  3K59 A;  3GTO A;  3GTK A;  3HOY C;  3HXA A;  3S15 K;  3VA7 A;  2CFA A;  2PA8 D;  3SZY A;  4QIW A;  4GT9 A;  4F3E A;  1O26 A;  1YNN A;  4IP9 A;  2PMZ L;  1IW7 A;  4O26 A;  2NVQ K;  3GSI A;  3HKZ D;  3GDZ A;  3HOV K;  1I50 K;  3PO2 K;  4A3C C;  4A3G C;  1UV7 A;  1TWC A;  3HOU C;  3AD7 C;  4Q4Z A;  4A3E C;  4C3I C;  5JVO A;  2JA7 C;  1YCL A;  2B63 K;  3GTM A;  4XCH A;  1J6W A;  3HKZ A;  5CQG A;  2NVY K;  1Q8I A;  1ZXO A;  3CAG A;  1NH3 A;  1IBA A;  4Y7N C;  4KMD A;  3PO3 C;  5L46 A;  3HOW K;  1Y69 8;  1EFW A;  2VUM C;  1SMY D;  4GFQ A;  5M3M K;  3GTO C;  3GTK C;  4YFK A;  1XZQ A;  5FJ8 K;  4MEY A;  1USM A;  1DCH A;  2GAH C;  4KC6 A;  3AQP A;  3GEE A;  1O2A A;  5IYD C;  1SMY A;  3Q3Q A;  4A3L C;  3ORE A;  1TWC C;  1WCM K;  4C45 A;  1F7V A;  3N3Y A;  1A36 A;  2R4G A;  3GTM C;  4AYB D;  3LHP S;  3NUH A;  4BY7 K;  3T00 A;  2GSO A;  4GTC A;  4NOM A;  2GSU A; 
#chains in the Genus database with same CATH homology
 4IP8 A;  4C2M C;  2Y3P A;  2NVY A;  4Q5V A;  1V9M A;  4KDD A;  4LQY A;  1IS1 A;  3K5O A;  1TGO A;  4AYB A;  4P5B A;  1EK8 A;  3OEP A;  2PMZ A;  3QX3 A;  1SEU A;  1TL8 A;  2JA5 A;  2YU9 A;  1I6V D;  1R9T A;  2KWA A;  3AQO A;  2NVX A;  3LAP A;  3KYL A;  2E2H A;  3P9A A;  2B9S B;  5CJ9 A;  1R49 A;  1RRJ A;  2Y0S A;  2JA7 A;  1O25 A;  3LPX A;  5EGH A;  2BE5 D;  4JLR C;  4GTA A;  5IOR A;  5IOS A;  5IOQ A;  1HQM D;  2A68 D;  1O24 A;  1GE9 A;  1AB4 A;  4M1X A;  1XXB A;  2JH3 A;  3FHZ A;  2JA6 A;  1B4A A;  3G4A A;  1K4T A;  1WCM A;  3DU5 A;  3GTQ A;  1KQ4 A;  5MLC 9;  3FKI A;  2A69 D;  1MIU A;  4KM9 A;  1R5Z A;  3H0G A;  2ZFZ A;  1SC7 A;  1DD5 A;  1T8I A;  3MML B;  1BJT A;  3V4G A;  3L4K A;  1WIH A;  4G0W A;  2A6H D;  4KAW X;  4QCL A;  1ZBS A;  4G0U A;  3ERE D;  1A35 A;  4GTL A;  3LAJ A;  1O28 A;  3N0C A;  5CHP A;  1TWH A;  2RGR A;  3GTG A;  2R7Z A;  5JFE A;  3GTJ A;  2CW0 D;  1ZYR D;  3AH5 A;  1TWA A;  4GTB A;  4DDQ A;  1YNJ D;  2P5M A;  4FM9 A;  4NOL A;  1F9N A;  1LPQ A;  3CQZ A;  1ZVU A;  2O5J D;  1WQH A;  1O27 A;  5C9H A;  1Y1W A;  1YNN D;  4OYD B;  4AN8 A;  3MAQ A;  3N0B A;  1B4B A;  4NOK A;  1IW7 D;  1WQG A;  4KAR A;  2PHC B;  3BUE A;  2XCR B;  1EJ9 A;  2VUM A;  3K59 A;  4D3Y A;  3GTO A;  3GTK A;  3M4A A;  2CFA B;  2CFA A;  4GTF A;  3VA7 A;  4C3H C;  4QIW A;  4GT9 A;  4F3E A;  3K5N A;  1O26 A;  4IP9 A;  3K5L A;  4FXD A;  1I3Q A;  4O26 A;  1ISE A;  1SFO A;  3GTP A;  2F4Q A;  1XXA A;  4Q5G A;  1K83 A;  4AHC A;  4H3T A;  1TWF A;  4KB2 A;  1TWC A;  3OPF A;  2RH6 A;  4KAT A;  3K58 A;  4BLA A;  2R93 A;  4KMH A;  4J3N A;  4C3I C;  5JVO A;  3WVO A;  4P5A A;  3GTM A;  2E2I A;  4FGU A;  2XCQ A;  3HKZ A;  5IOT A;  5CQG A;  4FYD A;  1TWG A;  1O2B A;  4ILD A;  1Q8I A;  1ZXO A;  3CAG A;  1NH3 A;  3LF9 A;  3G4C A;  4KAS A;  4C2M A;  4KMD A;  4BLB A;  3S0X A;  3FOE A;  3K5M A;  2R92 A;  1Y69 8;  4FZB A;  1SMY D;  4GFQ A;  4D3Z A;  1RR8 C;  1WQF A;  5JSN B;  3GTL A;  5JSB B;  1EH1 A;  4GTE A;  4KC6 A;  3L4J A;  2A6E D;  1A31 A;  3AQP A;  1BGW A;  1O2A A;  4G0V A;  1O29 A;  1XXC A;  2WB1 A;  4KB4 A;  4L8I A;  3Q3Q A;  4KM8 A;  4LR2 A;  3IAY A;  3DU6 A;  3ORE A;  1Y1V A;  2WAQ A;  2GSN A;  5TJ3 A;  3SJR A;  2XCO A;  3N3Y A;  1I50 A;  4GTD A;  1A36 A;  4C3J C;  3K57 A;  2R4G A;  4KMA A;  4BKW A;  3LHP S;  3NUH A;  5EGE A;  2GSO A;  4GTC A;  1K4S A;  2B63 A;  3FOF A;  4NOM A;  2GSU A;  4EJ3 A;  4LMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...