4GFQA

2.65 angstrom resolution crystal structure of ribosome recycling factor (frr) from bacillus anthracis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
186
structure length
186
Chain Sequence
AMGQQVLKFSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPYDKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLVKVVKKYAEEAKVAVRNVRRDGNDDLKKLEKAGEITEDDLRGYTEDIQKETDKYIAKVDEIAKNKEKEIMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.65 Angstrom Resolution Crystal Structure of Ribosome Recycling Factor (frr) from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 70
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4gfqA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gfqA02
3LF9A 3QX3A 3NUHA 5MLC9 3L4KA 4G0VA 3OPFA 2P5MA 4J3NA 1WQGA 4KB2A 1XXAA 4JLRC 1EK8A 3FOFA 4FM9A 4GFQA 2KWAA 3V4GA 2XCRB 1B4AA 2ZFZA 3CAGA 5CJ9A 4G0WA 2XCQA 1ISEA 2Y3PA 1GE9A 5JSNB 3MMLB 3LHPS 2PHCB 1F9NA 4KDDA 1BJTA 3FOEA 4DDQA 3VA7A 1DD5A 1AB4A 1WQFA 1B4BA 3L4JA 1XXCA 4OYDB 2RGRA 5JVOA 2XCOA 3LAPA 4KC6A 3LPXA 1Y698 3OREA 1WIHA 1XXBA 3FHZA 3ERED 4G0UA 1BGWA 3OEPA 4KB4A 4KAWX 1ZVUA 3BUEA 1EH1A 4L8IA 3LAJA 5JSBB 1WQHA 1IS1A
chains in the Genus database with same CATH superfamily
3LF9A 3DU5A 4H3TA 5MLC9 2R92A 4Q4ZA 2WAQL 3GTJC 4A3FC 1JVIA 3GTLA 4PAAA 4A3MK 3A8JA 1NH3A 1UV7A 4QJVA 2JA7C 2O5JD 1ZYRD 4NOMA 2B63A 3CAGA 3HOZK 2XCQA 1IL2A 1R9TA 4AYBA 3LHPS 3TFHA 3GTLK 4ILDA 1PJ6A 3M4OK 3I4NC 2PA8D 3S14K 1SEUA 4P9SA 1YCLA 4KASA 3HKZL 4IP9A 3GTKK 4XSZA 5JVOA 2XCOA 4G0UA 1WCMA 2Y0SD 3IPJA 3M4AA 4MQ9A 4WJ4A 2R92C 4FYDA 4BLBA 1XZPB 1K83C 1XZQB 1YX2A 1Y1WK 4A3IC 3T01A 4FM9A 4A3DK 5JFEA 5D4DA 3GTOA 2V6SA 1ISEA 3HOVC 2R7ZC 2PA8L 1WOPA 1O29A 1G51A 1IW7A 1YNNA 4GZYA 2JA5A 1WSVA 3H0GK 3GTMA 3EQLA 3OREA 1WIHA 2NVTK 3S1QK 3K5NA 3OEPA 2D6FC 4A3LC 3S1QC 1TWHA 3LAJA 3S1NK 4AHCA 3NUHA 5L46A 3TFIA 1YNJD 4BLAA 5IP9C 1I3QA 3SZYA 4KMHA 3V4GA 4BXXC 2E2IA 5IP7K 2ZUFA 3WVOA 4AN8A 1Y1WA 4C3HC 2JA5K 1USMA 4KM9A 2JA7K 2A69A 4NOLA 1O24A 2E2IC 1SFOA 1I50A 2R93C 1BGWA 2R4GA 4A93K 2PMZL 1EK8A 1WQHA 1IS1A 1F9NA 1WORA 1O28A 1ZXOA 4GFQA 5FLMK 4BY1K 3GTPA 3N0BA 3HOYC 4LQYA 1O26A 3S15K 4AYBL 1WCMK 1GE9A 4MEXA 2O5IA 3MMLB 3HOYK 1WCMC 3GTOK 4BBRK 2F4QA 3T00A 1I6HC 4FXDA 3S1MC 2GSNA 2CW0A 4YG2A 1T8IA 3HOVK 3S2HK 3G4CA 3AD7C 1O25A 1I6HK 1VRQC 1R9TK 5IOSA 1TL8A 4GTBA 1O2AA 1EH1A 1TWCK 5CQGA 4P5AA 4YFKA 4XSXA 2EBBA 2NVTC 4A3KK 3FOFA 3H3VL 3G4AA 2RH6A 2KWAA 1A36A 4A3EC 3M3YC 4Y52K 5CJ9A 3PO3C 1JOEA 4A3JC 3PO3K 5IP9K 4Q5SA 1BS2A 4P5BA 5M5XK 3GTKC 3M3YK 1AB4A 4KMUA 2PPBA 1TGOA 2VUMK 2R92K 2A68A 1SMYD 4OIOA 3GTQC 3BUEA 1O2BA 3K58A 3GTJA 1IQ0A 1TWAA 1PJ5A 3K5LA 2PMZA 5C9HA 1TWGK 1WOSA 4J3NA 3HXAA 4A93C 4C45A 3BP8C 2XCRB 5HL8A 4BY7C 3GTMK 3K5OA 3PO2K 1XZPA 5TMFA 2CW0D 5EGEA 3RZOC 4Q5VA 4D3ZA 2GSOA 1X31C 3S0XA 1XXBA 2NVQC 4A3BC 5IYBC 4A3GC 2BE5A 4KAWX 1Q8IA 2A68D 4KMDA 3QX3A 4NOIA 3OPFA 1XXAA 1VGXA 1Y1VA 3Q3QA 1DCPA 2ZFZA 4G0WA 2W7VA 3GTLC 2O5JA 1J6WA 4A3KC 3I4MK 5EGHA 3GTGA 1EFWA 3I4MC 2YU9C 1O27A 4AYBD 3VA7A 3SZZA 3N3YA 5IYCK 2P8TA 4M1XA 1I6VD 3LPXA 4OINA 2GSUA 3GIRA 4JK1A 3RZDC 4RMFA 3S16C 4X6AK 1YNND 2GAGC 2NVYA 3CQZC 4KATA 3S16K 4G7ZA 2E2HK 1F7VA 5C4XC 4F3EA 1LPQA 3MAQA 3GTQK 1K83K 3S15C 2WAQD 1IBAA 1SMYA 3HOWK 2WAQA 4OIPA 5M5WK 5IYDK 1B4BA 3AD9C 1R49A 4AH6A 1TWFA 5IYDC 1JQWA 4QIWL 4G7HA 3S2DK 1I6VA 5JSBB 1V5VA 3A8KA 4WILA 3S1NC 2NVQK 4KARA 4GTCA 5IYBK 4C2MA 4JLRC 1K4TA 3FKIK 3P9AA 1A35A 1RRJA 4C3HK 2CFAB 1DCHA 1V9MA 2BE5D 3DU6A 4BXXK 1WQFA 1F93A 4OIRA 4OYDB 2R93K 1TWFC 3S1RK 4LLGA 1MIUA 1J6XA 3S1RC 1J98A 1WSRA 1ZVUA 1TWHC 1ZYRA 3FKIA 4L8IA 4C3IK 3TTGA 2R93A 1I50C 1L0WA 1IW7D 3AQPA 2R7ZA 2P5MA 4LOWA 4KB2A 5FLMC 5IORA 3GSIA 3CQZK 2A6HA 5C44K 5FJ8K 4XLNA 2E2HC 4FGUA 2JH3A 3HKZD 1K83A 2JA8C 3HOXK 3GTOC 5TJ3A 4C2MK 3HOWC 1XPPA 2A6HD 4A3BK 2WB1A 2JA8K 4GTEA 4ZH4A 4C2MC 3GDZA 3K7AC 4QIWD 4MEYA 4XLPA 3K7AK 1Y1VC 1R9TC 2V6UA 1J6VA 2GAHC 5C4JC 3HOZC 4OIQA 3I4NK 5M3MK 2YU9K 4A3JK 3CQZA 4KN4A 2NVXK 1Y1VK 2NVXA 5JSNB 4Y52C 2YU9A 1PJ7A 2Y0SL 4LR2A 2E2JK 3K59A 4Y7NC 3K5MA 2NVXC 1YNJA 5IOTA 2A6ED 3WODA 1Y698 1RU0A 4GTAA 1Y1WC 1WOOA 1EQRA 1VLOA 4O26A 3L4KA 3S17K 1SFOC 4G0VA 1VH2A 4A3IK 2R7ZK 1XZQA 4GT9A 4BBSK 1TWGC 1BDFA 3BP3A 1I50K 1ZBSA 3AH5A 4BBSC 3H0GC 1EJ9A 3GTMC 1EI6A 2JA7A 4O2DA 2A69D 1O2FB 5TMCA 2B9SB 4A3CC 3ERED 3DXJA 4IP8A 1I3QK 3AQOA 3RZOK 2Y0SA 5C3EC 4A3LK 4A3GK 1TWAC 1HQMA 3FKIC 1TWAK 4WJ3M 4NOKA 1USOA 3GTJK 4A3MC 1VJEA 1RR8C 5C3EK 3KYLA 2FQTA 3SJRA 2NVYC 4GTLA 4A3FK 3GTQA 5IP7C 1TWFK 1HQMD 2PHCB 5C4JK 5E68A 4D3YA 4DDQA 1INNA 2NVYK 2CFAA 2WB1L 3FHZA 4LJZA 4X6AC 4Y7NK 3K57A 4KM8A 4QIWA 3H3VD 5IYCC 1WQGA 5M5YK 3RZDK 2E2HA 2PMZD 5C4XK 4BBRC 2A6EA 3GEEA 4LK1A 4LK0A 2ZUEA 3FOEA 3GEHA 4PABA 3S2HC 1DD5A 2V6TA 3L4JA 3GEIA 3HKZA 3S1MK 4KMAA 2B63C 3GTGK 4QCLA 2B63K 1TWCC 1HI9A 2RGRA 1R5ZA 4C3JC 3GTGC 4GTDA 3S2DC 4A3CK 3A8IA 1C0AA 5IOQA 1K4SA 3JSTA 3M4OC 3ADAC 4GTFA 4C3JK 3S14C 2E2JC 4A3EK 1DCOA 2Y3PA 4QJVB 4XCHA 4KDDA 3GTPK 2JA5C 1IE0A 3GTPC 2VUMC 3IAYA 1XXCA 2JA6A 3T02A 3LAPA 4KC6A 3AD8C 3H0GA 4G7OA 2E2IK 3S17C 4KB4A 2VUMA 4A3DC 1SFOK 2FQOA 1TWGA 4LMOA 1A31A 3N0CA 4BY7K 5CHPA 2JA6C 1TWHK 3HOUK 4C3IC 1B4AA 4BKWA 5M3FK 1ZQ1C 1SC7A 4BY1C 2WB1D 4EJ3A 3HOXC 2JA6K 4KN7A 3HOUC 1BJTA 5C44C 3PO2C 1I3QC 1TWCA 1KQ4A 4FZBA 3TFJA 1F7UA 4YFNA 3GTKA 4Q5GA 4YFXA
chains in the Genus database with same CATH topology
3LF9A 3DU5A 4H3TA 5MLC9 2R92A 4P5AA 4KARA 4GTCA 3GTLA 4C2MA 4JLRC 4NOKA 1NH3A 1K4TA 3FOFA 3P9AA 1A35A 2RH6A 2KWAA 1RR8C 1A36A 3G4AA 2O5JD 1ZYRD 3KYLA 4NOMA 1RRJA 2B63A 3SJRA 2XCQA 3CAGA 1R9TA 4GTLA 2CFAB 5CJ9A 4AYBA 3GTQA 1V9MA 2BE5D 3LHPS 1HQMD 2PHCB 4ILDA 3DU6A 4P5BA 4D3YA 1SEUA 4DDQA 4KASA 4IP9A 1AB4A 1WQFA 3AQOA 1TGOA 4OYDB 5JVOA 2CFAA 2XCOA 3FHZA 1SMYD 1MIUA 4G0UA 1WCMA 1ZVUA 3BUEA 3M4AA 3K57A 1O2BA 3FKIA 4QIWA 4L8IA 3K58A 3GTJA 4KM8A 1TWAA 4FYDA 2R93A 4BLBA 3K5LA 1IW7D 2PMZA 2R7ZA 5C9HA 1WQGA 4KB2A 2P5MA 3AQPA 4J3NA 5IORA 2E2HA 4FM9A 5JFEA 2XCRB 3LAPA 3GTOA 4FGUA 2JH3A 1ISEA 1K83A 3K5OA 1O29A 3FOEA 2CW0D 5TJ3A 1DD5A 5EGEA 3L4JA 4Q5VA 3HKZA 4KMAA 4D3ZA 2A6HD 2JA5A 3GTMA 2WB1A 4QCLA 1WIHA 1XXBA 2GSOA 3OREA 3K5NA 3S0XA 3OEPA 4GTEA 4KAWX 4C2MC 1TWHA 1Q8IA 2A68D 4KMDA 3LAJA 1R5ZA 4AHCA 2RGRA 4C3JC 3NUHA 3QX3A 4GTDA 3OPFA 5IOQA 1YNJD 1XXAA 4BLAA 1K4SA 1Y1VA 1I3QA 3Q3QA 3V4GA 4KMHA 4GTFA 2E2IA 2ZFZA 3CQZA 4G0WA 2Y3PA 3WVOA 2NVXA 4AN8A 5JSNB 1Y1WA 4C3HC 2YU9A 5EGHA 3GTGA 4KDDA 4KM9A 4LR2A 3K59A 1O27A 3VA7A 4NOLA 3K5MA 3IAYA 1XXCA 2JA6A 5IOTA 3N3YA 4M1XA 2A6ED 1I6VD 2Y0SA 4KC6A 1Y698 1O24A 1SFOA 2GSUA 1I50A 3LPXA 3H0GA 1BGWA 4GTAA 4KB4A 2R4GA 2VUMA 1YNND 4O26A 3L4KA 2NVYA 1EK8A 1WQHA 1IS1A 1F9NA 4KATA 4G0VA 1TWGA 4LMOA 4F3EA 1LPQA 1A31A 3N0CA 3MAQA 4GT9A 5CHPA 1O28A 1ZXOA 4GFQA 3GTPA 4C3IC 1B4AA 4BKWA 3N0BA 4LQYA 1O26A 1SC7A 1ZBSA 1GE9A 2WAQA 3AH5A 3MMLB 4EJ3A 1EJ9A 2F4QA 1BJTA 4FXDA 2JA7A 1TWCA 1KQ4A 2GSNA 1B4BA 1T8IA 4FZBA 1R49A 3G4CA 1TWFA 2A69D 2B9SB 1O25A 3ERED 5IOSA 1TL8A 4IP8A 4GTBA 1O2AA 3GTKA 1EH1A 4Q5GA 5JSBB 5CQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LF9 A;  3QX3 A;  3NUH A;  5MLC 9;  3L4K A;  4G0V A;  3OPF A;  2P5M A;  4J3N A;  1WQG A;  4KB2 A;  1XXA A;  4JLR C;  1EK8 A;  3FOF A;  4FM9 A;  4GFQ A;  2KWA A;  3V4G A;  2XCR B;  1B4A A;  2ZFZ A;  3CAG A;  5CJ9 A;  4G0W A;  2XCQ A;  1ISE A;  2Y3P A;  1GE9 A;  5JSN B;  3MML B;  3LHP S;  2PHC B;  1F9N A;  4KDD A;  1BJT A;  3FOE A;  4DDQ A;  3VA7 A;  1DD5 A;  1AB4 A;  1WQF A;  1B4B A;  3L4J A;  1XXC A;  4OYD B;  2RGR A;  5JVO A;  2XCO A;  3LAP A;  4KC6 A;  3LPX A;  1Y69 8;  3ORE A;  1WIH A;  1XXB A;  3FHZ A;  3ERE D;  4G0U A;  1BGW A;  3OEP A;  4KB4 A;  4KAW X;  1ZVU A;  3BUE A;  1EH1 A;  4L8I A;  3LAJ A;  5JSB B;  1WQH A;  1IS1 A; 
#chains in the Genus database with same CATH topology
 3LF9 A;  3DU5 A;  4H3T A;  5MLC 9;  2R92 A;  4Q4Z A;  2WAQ L;  3GTJ C;  4A3F C;  1JVI A;  3GTL A;  4PAA A;  4A3M K;  3A8J A;  1NH3 A;  1UV7 A;  4QJV A;  2JA7 C;  2O5J D;  1ZYR D;  4NOM A;  2B63 A;  3CAG A;  3HOZ K;  2XCQ A;  1IL2 A;  1R9T A;  4AYB A;  3LHP S;  3TFH A;  3GTL K;  4ILD A;  1PJ6 A;  3M4O K;  3I4N C;  2PA8 D;  3S14 K;  1SEU A;  4P9S A;  1YCL A;  4KAS A;  3HKZ L;  4IP9 A;  3GTK K;  4XSZ A;  5JVO A;  2XCO A;  4G0U A;  1WCM A;  2Y0S D;  3IPJ A;  3M4A A;  4MQ9 A;  4WJ4 A;  2R92 C;  4FYD A;  4BLB A;  1XZP B;  1K83 C;  1XZQ B;  1YX2 A;  1Y1W K;  4A3I C;  3T01 A;  4FM9 A;  4A3D K;  5JFE A;  5D4D A;  3GTO A;  2V6S A;  1ISE A;  3HOV C;  2R7Z C;  2PA8 L;  1WOP A;  1O29 A;  1G51 A;  1IW7 A;  1YNN A;  4GZY A;  2JA5 A;  1WSV A;  3H0G K;  3GTM A;  3EQL A;  3ORE A;  1WIH A;  2NVT K;  3S1Q K;  3K5N A;  3OEP A;  2D6F C;  4A3L C;  3S1Q C;  1TWH A;  3LAJ A;  3S1N K;  4AHC A;  3NUH A;  5L46 A;  3TFI A;  1YNJ D;  4BLA A;  5IP9 C;  1I3Q A;  3SZY A;  4KMH A;  3V4G A;  4BXX C;  2E2I A;  5IP7 K;  2ZUF A;  3WVO A;  4AN8 A;  1Y1W A;  4C3H C;  2JA5 K;  1USM A;  4KM9 A;  2JA7 K;  2A69 A;  4NOL A;  1O24 A;  2E2I C;  1SFO A;  1I50 A;  2R93 C;  1BGW A;  2R4G A;  4A93 K;  2PMZ L;  1EK8 A;  1WQH A;  1IS1 A;  1F9N A;  1WOR A;  1O28 A;  1ZXO A;  4GFQ A;  5FLM K;  4BY1 K;  3GTP A;  3N0B A;  3HOY C;  4LQY A;  1O26 A;  3S15 K;  4AYB L;  1WCM K;  1GE9 A;  4MEX A;  2O5I A;  3MML B;  3HOY K;  1WCM C;  3GTO K;  4BBR K;  2F4Q A;  3T00 A;  1I6H C;  4FXD A;  3S1M C;  2GSN A;  2CW0 A;  4YG2 A;  1T8I A;  3HOV K;  3S2H K;  3G4C A;  3AD7 C;  1O25 A;  1I6H K;  1VRQ C;  1R9T K;  5IOS A;  1TL8 A;  4GTB A;  1O2A A;  1EH1 A;  1TWC K;  5CQG A;  4P5A A;  4YFK A;  4XSX A;  2EBB A;  2NVT C;  4A3K K;  3FOF A;  3H3V L;  3G4A A;  2RH6 A;  2KWA A;  1A36 A;  4A3E C;  3M3Y C;  4Y52 K;  5CJ9 A;  3PO3 C;  1JOE A;  4A3J C;  3PO3 K;  5IP9 K;  4Q5S A;  1BS2 A;  4P5B A;  5M5X K;  3GTK C;  3M3Y K;  1AB4 A;  4KMU A;  2PPB A;  1TGO A;  2VUM K;  2R92 K;  2A68 A;  1SMY D;  4OIO A;  3GTQ C;  3BUE A;  1O2B A;  3K58 A;  3GTJ A;  1IQ0 A;  1TWA A;  1PJ5 A;  3K5L A;  2PMZ A;  5C9H A;  1TWG K;  1WOS A;  4J3N A;  3HXA A;  4A93 C;  4C45 A;  3BP8 C;  2XCR B;  5HL8 A;  4BY7 C;  3GTM K;  3K5O A;  3PO2 K;  1XZP A;  5TMF A;  2CW0 D;  5EGE A;  3RZO C;  4Q5V A;  4D3Z A;  2GSO A;  1X31 C;  3S0X A;  1XXB A;  2NVQ C;  4A3B C;  5IYB C;  4A3G C;  2BE5 A;  4KAW X;  1Q8I A;  2A68 D;  4KMD A;  3QX3 A;  4NOI A;  3OPF A;  1XXA A;  1VGX A;  1Y1V A;  3Q3Q A;  1DCP A;  2ZFZ A;  4G0W A;  2W7V A;  3GTL C;  2O5J A;  1J6W A;  4A3K C;  3I4M K;  5EGH A;  3GTG A;  1EFW A;  3I4M C;  2YU9 C;  1O27 A;  4AYB D;  3VA7 A;  3SZZ A;  3N3Y A;  5IYC K;  2P8T A;  4M1X A;  1I6V D;  3LPX A;  4OIN A;  2GSU A;  3GIR A;  4JK1 A;  3RZD C;  4RMF A;  3S16 C;  4X6A K;  1YNN D;  2GAG C;  2NVY A;  3CQZ C;  4KAT A;  3S16 K;  4G7Z A;  2E2H K;  1F7V A;  5C4X C;  4F3E A;  1LPQ A;  3MAQ A;  3GTQ K;  1K83 K;  3S15 C;  2WAQ D;  1IBA A;  1SMY A;  3HOW K;  2WAQ A;  4OIP A;  5M5W K;  5IYD K;  1B4B A;  3AD9 C;  1R49 A;  4AH6 A;  1TWF A;  5IYD C;  1JQW A;  4QIW L;  4G7H A;  3S2D K;  1I6V A;  5JSB B;  1V5V A;  3A8K A;  4WIL A;  3S1N C;  2NVQ K;  4KAR A;  4GTC A;  5IYB K;  4C2M A;  4JLR C;  1K4T A;  3FKI K;  3P9A A;  1A35 A;  1RRJ A;  4C3H K;  2CFA B;  1DCH A;  1V9M A;  2BE5 D;  3DU6 A;  4BXX K;  1WQF A;  1F93 A;  4OIR A;  4OYD B;  2R93 K;  1TWF C;  3S1R K;  4LLG A;  1MIU A;  1J6X A;  3S1R C;  1J98 A;  1WSR A;  1ZVU A;  1TWH C;  1ZYR A;  3FKI A;  4L8I A;  4C3I K;  3TTG A;  2R93 A;  1I50 C;  1L0W A;  1IW7 D;  3AQP A;  2R7Z A;  2P5M A;  4LOW A;  4KB2 A;  5FLM C;  5IOR A;  3GSI A;  3CQZ K;  2A6H A;  5C44 K;  5FJ8 K;  4XLN A;  2E2H C;  4FGU A;  2JH3 A;  3HKZ D;  1K83 A;  2JA8 C;  3HOX K;  3GTO C;  5TJ3 A;  4C2M K;  3HOW C;  1XPP A;  2A6H D;  4A3B K;  2WB1 A;  2JA8 K;  4GTE A;  4ZH4 A;  4C2M C;  3GDZ A;  3K7A C;  4QIW D;  4MEY A;  4XLP A;  3K7A K;  1Y1V C;  1R9T C;  2V6U A;  1J6V A;  2GAH C;  5C4J C;  3HOZ C;  4OIQ A;  3I4N K;  5M3M K;  2YU9 K;  4A3J K;  3CQZ A;  4KN4 A;  2NVX K;  1Y1V K;  2NVX A;  5JSN B;  4Y52 C;  2YU9 A;  1PJ7 A;  2Y0S L;  4LR2 A;  2E2J K;  3K59 A;  4Y7N C;  3K5M A;  2NVX C;  1YNJ A;  5IOT A;  2A6E D;  3WOD A;  1Y69 8;  1RU0 A;  4GTA A;  1Y1W C;  1WOO A;  1EQR A;  1VLO A;  4O26 A;  3L4K A;  3S17 K;  1SFO C;  4G0V A;  1VH2 A;  4A3I K;  2R7Z K;  1XZQ A;  4GT9 A;  4BBS K;  1TWG C;  1BDF A;  3BP3 A;  1I50 K;  1ZBS A;  3AH5 A;  4BBS C;  3H0G C;  1EJ9 A;  3GTM C;  1EI6 A;  2JA7 A;  4O2D A;  2A69 D;  1O2F B;  5TMC A;  2B9S B;  4A3C C;  3ERE D;  3DXJ A;  4IP8 A;  1I3Q K;  3AQO A;  3RZO K;  2Y0S A;  5C3E C;  4A3L K;  4A3G K;  1TWA C;  1HQM A;  3FKI C;  1TWA K;  4WJ3 M;  4NOK A;  1USO A;  3GTJ K;  4A3M C;  1VJE A;  1RR8 C;  5C3E K;  3KYL A;  2FQT A;  3SJR A;  2NVY C;  4GTL A;  4A3F K;  3GTQ A;  5IP7 C;  1TWF K;  1HQM D;  2PHC B;  5C4J K;  5E68 A;  4D3Y A;  4DDQ A;  1INN A;  2NVY K;  2CFA A;  2WB1 L;  3FHZ A;  4LJZ A;  4X6A C;  4Y7N K;  3K57 A;  4KM8 A;  4QIW A;  3H3V D;  5IYC C;  1WQG A;  5M5Y K;  3RZD K;  2E2H A;  2PMZ D;  5C4X K;  4BBR C;  2A6E A;  3GEE A;  4LK1 A;  4LK0 A;  2ZUE A;  3FOE A;  3GEH A;  4PAB A;  3S2H C;  1DD5 A;  2V6T A;  3L4J A;  3GEI A;  3HKZ A;  3S1M K;  4KMA A;  2B63 C;  3GTG K;  4QCL A;  2B63 K;  1TWC C;  1HI9 A;  2RGR A;  1R5Z A;  4C3J C;  3GTG C;  4GTD A;  3S2D C;  4A3C K;  3A8I A;  1C0A A;  5IOQ A;  1K4S A;  3JST A;  3M4O C;  3ADA C;  4GTF A;  4C3J K;  3S14 C;  2E2J C;  4A3E K;  1DCO A;  2Y3P A;  4QJV B;  4XCH A;  4KDD A;  3GTP K;  2JA5 C;  1IE0 A;  3GTP C;  2VUM C;  3IAY A;  1XXC A;  2JA6 A;  3T02 A;  3LAP A;  4KC6 A;  3AD8 C;  3H0G A;  4G7O A;  2E2I K;  3S17 C;  4KB4 A;  2VUM A;  4A3D C;  1SFO K;  2FQO A;  1TWG A;  4LMO A;  1A31 A;  3N0C A;  4BY7 K;  5CHP A;  2JA6 C;  1TWH K;  3HOU K;  4C3I C;  1B4A A;  4BKW A;  5M3F K;  1ZQ1 C;  1SC7 A;  4BY1 C;  2WB1 D;  4EJ3 A;  3HOX C;  2JA6 K;  4KN7 A;  3HOU C;  1BJT A;  5C44 C;  3PO2 C;  1I3Q C;  1TWC A;  1KQ4 A;  4FZB A;  3TFJ A;  1F7U A;  4YFN A;  3GTK A;  4Q5G A;  4YFX A; 
#chains in the Genus database with same CATH homology
 3LF9 A;  3DU5 A;  4H3T A;  5MLC 9;  2R92 A;  4P5A A;  4KAR A;  4GTC A;  3GTL A;  4C2M A;  4JLR C;  4NOK A;  1NH3 A;  1K4T A;  3FOF A;  3P9A A;  1A35 A;  2RH6 A;  2KWA A;  1RR8 C;  1A36 A;  3G4A A;  2O5J D;  1ZYR D;  3KYL A;  4NOM A;  1RRJ A;  2B63 A;  3SJR A;  2XCQ A;  3CAG A;  1R9T A;  4GTL A;  2CFA B;  5CJ9 A;  4AYB A;  3GTQ A;  1V9M A;  2BE5 D;  3LHP S;  1HQM D;  2PHC B;  4ILD A;  3DU6 A;  4P5B A;  4D3Y A;  1SEU A;  4DDQ A;  4KAS A;  4IP9 A;  1AB4 A;  1WQF A;  3AQO A;  1TGO A;  4OYD B;  5JVO A;  2CFA A;  2XCO A;  3FHZ A;  1SMY D;  1MIU A;  4G0U A;  1WCM A;  1ZVU A;  3BUE A;  3M4A A;  3K57 A;  1O2B A;  3FKI A;  4QIW A;  4L8I A;  3K58 A;  3GTJ A;  4KM8 A;  1TWA A;  4FYD A;  2R93 A;  4BLB A;  3K5L A;  1IW7 D;  2PMZ A;  2R7Z A;  5C9H A;  1WQG A;  4KB2 A;  2P5M A;  3AQP A;  4J3N A;  5IOR A;  2E2H A;  4FM9 A;  5JFE A;  2XCR B;  3LAP A;  3GTO A;  4FGU A;  2JH3 A;  1ISE A;  1K83 A;  3K5O A;  1O29 A;  3FOE A;  2CW0 D;  5TJ3 A;  1DD5 A;  5EGE A;  3L4J A;  4Q5V A;  3HKZ A;  4KMA A;  4D3Z A;  2A6H D;  2JA5 A;  3GTM A;  2WB1 A;  4QCL A;  1WIH A;  1XXB A;  2GSO A;  3ORE A;  3K5N A;  3S0X A;  3OEP A;  4GTE A;  4KAW X;  4C2M C;  1TWH A;  1Q8I A;  2A68 D;  4KMD A;  3LAJ A;  1R5Z A;  4AHC A;  2RGR A;  4C3J C;  3NUH A;  3QX3 A;  4GTD A;  3OPF A;  5IOQ A;  1YNJ D;  1XXA A;  4BLA A;  1K4S A;  1Y1V A;  1I3Q A;  3Q3Q A;  3V4G A;  4KMH A;  4GTF A;  2E2I A;  2ZFZ A;  3CQZ A;  4G0W A;  2Y3P A;  3WVO A;  2NVX A;  4AN8 A;  5JSN B;  1Y1W A;  4C3H C;  2YU9 A;  5EGH A;  3GTG A;  4KDD A;  4KM9 A;  4LR2 A;  3K59 A;  1O27 A;  3VA7 A;  4NOL A;  3K5M A;  3IAY A;  1XXC A;  2JA6 A;  5IOT A;  3N3Y A;  4M1X A;  2A6E D;  1I6V D;  2Y0S A;  4KC6 A;  1Y69 8;  1O24 A;  1SFO A;  2GSU A;  1I50 A;  3LPX A;  3H0G A;  1BGW A;  4GTA A;  4KB4 A;  2R4G A;  2VUM A;  1YNN D;  4O26 A;  3L4K A;  2NVY A;  1EK8 A;  1WQH A;  1IS1 A;  1F9N A;  4KAT A;  4G0V A;  1TWG A;  4LMO A;  4F3E A;  1LPQ A;  1A31 A;  3N0C A;  3MAQ A;  4GT9 A;  5CHP A;  1O28 A;  1ZXO A;  4GFQ A;  3GTP A;  4C3I C;  1B4A A;  4BKW A;  3N0B A;  4LQY A;  1O26 A;  1SC7 A;  1ZBS A;  1GE9 A;  2WAQ A;  3AH5 A;  3MML B;  4EJ3 A;  1EJ9 A;  2F4Q A;  1BJT A;  4FXD A;  2JA7 A;  1TWC A;  1KQ4 A;  2GSN A;  1B4B A;  1T8I A;  4FZB A;  1R49 A;  3G4C A;  1TWF A;  2A69 D;  2B9S B;  1O25 A;  3ERE D;  5IOS A;  1TL8 A;  4IP8 A;  4GTB A;  1O2A A;  3GTK A;  1EH1 A;  4Q5G A;  5JSB B;  5CQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...