1WQHA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome recycling factor
publication title X-ray structural studies of Mycobacterium Tuberculosis RRF and a comparative study of RRFS of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 58
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqhA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqhA02
1DD5A 4KB4A 5JSBB 3LAJA 3L4JA 1ISEA 1B4AA 3LPXA 1Y698 2ZFZA 3V4GA 3NUHA 1XXBA 3MMLB 2P5MA 2Y3PA 3FOFA 3FHZA 2RGRA 2XCRB 1GE9A 1XXAA 3BUEA 1WIHA 1AB4A 4G0UA 1WQHA 3OREA 3LAPA 3L4KA 1ZVUA 2PHCB 3OPFA 3LF9A 4KAWX 1WQGA 4JLRC 5MLC9 1IS1A 4KC6A 1B4BA 4J3NA 2XCOA 4DDQA 5JVOA 4G0VA 4OYDB 5CJ9A 3ERED 3LHPS 4KDDA 1XXCA 1EH1A 3CAGA 1BJTA 3OEPA 1F9NA 1WQFA 5JSNB 1BGWA 4GFQA 2XCQA 2KWAA 3VA7A 4G0WA 3QX3A 4L8IA 4KB2A 1EK8A 4FM9A 3FOEA
chains in the Genus database with same CATH superfamily
1WOOA 1K4TA 1O26A 2WAQA 4C45A 3FOFA 3FHZA 4IP9A 2B63A 1HQMA 1O2AA 1WIHA 4C3JK 3HOWK 2B63K 2VUMA 4LK0A 1J6WA 3TTGA 3GTJC 2XCOA 3GTLA 3WVOA 2VUMK 5IYCC 3GTPC 5HL8A 4G7ZA 2JA7A 1VLOA 5IP7K 3TFJA 1VJEA 1F9NA 2A69D 5D4DA 3K5LA 2JA7K 4KMDA 1K83A 1I3QC 2A6HD 4KB4A 1K83K 4D3ZA 4P5BA 3LPXA 1USMA 1O2BA 4BBSK 1I3QK 4ZH4A 3K7AC 3I4NK 4A3KC 3IAYA 1SC7A 2YU9A 3WODA 1G51A 4BBRK 4RMFA 2E2JC 2YU9K 4KC6A 1TWHA 4D3YA 3K7AK 4Y52C 1IL2A 4KDDA 1USOA 5FLMC 1TWHK 1O28A 5JSNB 4A3IC 1A31A 1I6HK 1ZYRD 2GSOA 5FLMK 4A3EK 1DCOA 4A3IK 4EJ3A 1TL8A 4GTAA 5E68A 4LJZA 1IQ0A 4OIRA 1I50A 3DXJA 3S17C 3SZZA 5C3EC 3T02A 4OYDB 3AQPA 2Y0SL 3MAQA 1BJTA 3GTMC 3GSIA 5IYBK 2CW0D 1TWAA 4YFKA 3P9AA 4X6AC 1TWAK 3FOEA 2RH6A 3HKZL 1SFOC 4LK1A 2JA8K 1XXBA 2XCRB 4X6AK 1YCLA 3GTOA 5C9HA 1R5ZA 1WQHA 5M5XK 3S2DC 4BXXC 4A3MK 3FKIC 4BY1C 1LPQA 1WQGA 3GTOK 4J3NA 4DDQA 3T00A 2O5JA 1RRJA 3S2DK 3S1QK 2XCQA 1PJ7A 4C3HK 4F3EA 4G0WA 4AH6A 4KMAA 4AYBL 3TFIA 3H3VD 3S15K 3K5NA 2Y3PA 4KMHA 5IOQA 4IP8A 1GE9A 1Y1VA 2JH3A 1K4SA 2E2HC 1TWGC 2NVXA 1Y1VK 1ZYRA 2NVXK 1UV7A 3H0GA 3N0CA 3PO2C 4QCLA 1TWGK 3H0GK 1V9MA 4LR2A 5M5YK 3M4OC 4GFQA 5C44C 3HOUK 3A8KA 5JSBB 3KYLA 4BKWA 4BY7K 3HOWC 3AH5A 3M4OK 3N0BA 2B63C 5C44K 1YNND 3M3YK 4G0UA 5JFEA 2VUMC 2WAQL 1Q8IA 4GTCA 5IP7C 3CQZC 1TWCA 3GTLC 4GTEA 3DU6A 1WOPA 2JA7C 3ADAC 4QIWD 3LHPS 3CQZA 1WORA 3GEEA 3S1MK 4LMOA 4OIOA 4O26A 1DCHA 1K83C 1I6VD 3CQZK 3GTLK 3S1NK 1TWFA 2R93A 4BBSC 4YFNA 4KB2A 1XZPB 1TWFK 5M5WK 3I4NC 4A93K 1IE0A 3T01A 4OINA 2R93K 1ZXOA 2E2IA 2NVYA 4JK1A 3I4MK 3NUHA 1IW7D 4BBRC 2E2IK 3HKZD 3S2HC 2NVYK 1INNA 1O2FB 2YU9C 1XZPA 2JA5C 2PMZA 4FGUA 3L4KA 2V6SA 2PHCB 1F7VA 1TWHC 1J6XA 2JA5A 3S2HK 2PMZL 4FZBA 4QJVB 1I6HC 1VGXA 2R7ZA 2JA5K 1RR8C 5EGEA 1VH2A 1Y1WA 4A3EC 2JA6C 3SZYA 3HOYK 3BP3A 5IYDC 2R7ZK 3PO3K 4FYDA 1BGWA 1T8IA 4XSZA 1Y1WK 2JA6A 4QJVA 2PA8D 1SMYD 2WB1D 1NH3A 2JA6K 3L4JA 5IYDK 2O5IA 3V4GA 1O24A 2ZUEA 5CHPA 1I50C 3N3YA 3A8JA 1BDFA 3AD7C 4P5AA 5MLC9 5IYBC 4KMUA 4KARA 1X31C 3ERED 1I50K 5IOTA 1JVIA 1TWAC 1YNNA 1J6VA 1YNJD 4Y7NK 3RZOK 3SJRA 3BP8C 4GTLA 2JA8C 3QX3A 3RZDK 4PAAA 4FM9A 4ILDA 1YX2A 4A3BK 4A3MC 4AN8A 3GTOC 4C3IC 3GTGA 5C4JC 4KN4A 2NVTC 2B9SB 1I6VA 3GTKA 2A69A 3OREA 3LAPA 3GTGK 3S1QC 1R49A 2V6TA 5IOSA 2ZUFA 3GTKK 2A6HA 4H3TA 4C3IK 2GSNA 5C4JK 2W7VA 2NVTK 5C4XC 1XPPA 1F93A 4C3HC 1A36A 5IP9K 1IW7A 3S14K 1R9TA 4KM8A 3M4AA 3OEPA 1ZQ1C 1WQFA 1R9TK 4GTBA 5C4XK 1F7UA 3S15C 1XZQB 3LAJA 4PABA 5IORA 1B4AA 1Y698 3G4CA 1Y1VC 2NVQC 1KQ4A 2NVXC 4O2DA 1XZQA 3AD8C 2NVQK 1DCPA 1SMYA 1MIUA 2WB1A 3H0GC 4A3JC 4P9SA 1JOEA 5JVOA 3HOXK 2BE5D 2GAGC 4KM9A 3HOUC 4A3FK 4A3JK 1IBAA 4BY7C 3VA7A 3M3YC 4NOIA 3K57A 4XCHA 1XXAA 1YNJA 3BUEA 2FQOA 3EQLA 1TWCC 2CW0A 3OPFA 3S1MC 3S1RK 3S1NC 3JSTA 4A3DK 3S16K 1TWCK 1WCMC 2A6ED 2CFAB 1TWFC 3CAGA 4A93C 2R93C 1WSVA 1WCMA 3I4MC 2Y0SD 3HOVK 2E2IC 4GT9A 2R92C 2NVYC 1BS2A 1WCMK 4XSXA 1C0AA 2CFAA 2R92A 1A35A 2P5MA 3GIRA 2R92K 1AB4A 4OIPA 4M1XA 2R4GA 1O29A 4BLAA 4A3LC 4JLRC 5TJ3A 3HOYC 2R7ZC 1IS1A 3PO3C 2GAHC 4WJ3M 5TMFA 1Y1WC 3GTJA 1XXCA 4NOKA 4A3LK 3GTPA 3GTJK 4C2MC 4WJ4A 2A68D 3H3VL 5IYCK 3GTPK 4L8IA 4C2MA 3K5MA 1DD5A 1I3QA 2O5JD 5FJ8K 4BLBA 5L46A 2BE5A 4C2MK 4GTFA 1O25A 4AYBD 3TFHA 4KN7A 1SEUA 1V5VA 1ZVUA 3HXAA 3K58A 1L0WA 4G7HA 5TMCA 4XLNA 4KATA 4KASA 4A3KK 4Y7NC 3RZOC 4XLPA 3RZDC 1VRQC 2PPBA 4LLGA 3S0XA 2E2JK 3DU5A 4WILA 4LQYA 4A3BC 4Y52K 1ZBSA 3G4AA 1O27A 1ISEA 5CQGA 2EBBA 3A8IA 3GTGC 4GZYA 4QIWA 4AHCA 1EFWA 2A6EA 2RGRA 3GTKC 2F4QA 4Q5SA 4YFXA 3HOZC 4QIWL 2Y0SA 4GTDA 5IP9C 3S14C 1EQRA 1B4BA 1R9TC 2WAQD 3AQOA 3HOZK 1EH1A 3S17K 3HKZA 4Q5VA 1HQMD 3GDZA 5C3EK 3GEIA 1TGOA 3GTMA 4LOWA 1WSRA 2V6UA 3Q3QA 1J98A 2P8TA 3GTMK 2GSUA 3GEHA 3IPJA 4FXDA 4OIQA 1SFOA 3K59A 1RU0A 3HOXC 2A68A 1SFOK 4KAWX 4A3FC 3FKIA 3GTQC 3K5OA 4BXXK 4MEXA 2FQTA 1JQWA 3FKIK 4BY1K 2PA8L 4AYBA 2D6FC 2WB1L 3GTQA 2PMZD 4G7OA 4A3CC 4NOMA 1PJ5A 3GTQK 1EK8A 1PJ6A 5M3FK 4A3GC 4MEYA 2ZFZA 4A3CK 4NOLA 3MMLB 3S1RC 1EJ9A 4A3DC 4A3GK 3S16C 2E2HA 3LF9A 1TWGA 4MQ9A 5EGHA 4Q5GA 2E2HK 4G0VA 5CJ9A 1EI6A 1WOSA 3AD9C 3HOVC 5M3MK 4Q4ZA 3PO2K 1HI9A 2KWAA 4YG2A 4C3JC
chains in the Genus database with same CATH topology
3K5MA 1DD5A 4ILDA 1K4TA 4BLAA 1I3QA 2O5JD 4BLBA 1O26A 2WAQA 4AN8A 4GTFA 1O25A 3K5NA 3GTGA 2Y3PA 4KMHA 4IP9A 4IP8A 1GE9A 1Y1VA 2B9SB 1SEUA 2B63A 1O2AA 1WIHA 1K4SA 2JH3A 3GTKA 2NVXA 3OREA 3LAPA 1ZVUA 3K58A 1R49A 5IOSA 2VUMA 4H3TA 4KATA 2GSNA 4KASA 2XCOA 3H0GA 3GTLA 3N0CA 4QCLA 3WVOA 1A36A 4C3HC 4FM9A 2JA7A 1R9TA 1V9MA 4KM8A 3M4AA 3OEPA 3S0XA 3DU5A 4LR2A 1F9NA 2A69D 1WQFA 3K5LA 4GFQA 4LQYA 4GTBA 4KMDA 1K83A 2A6HD 1ZBSA 3G4AA 4KB4A 5JSBB 3KYLA 4D3ZA 1O27A 3LAJA 1ISEA 4BKWA 5CQGA 4P5BA 1B4AA 3LPXA 1Y698 3AH5A 3G4CA 5IORA 3N0BA 1O2BA 4QIWA 1KQ4A 4AHCA 5IOQA 2RGRA 1YNND 2F4QA 4G0UA 3IAYA 1SC7A 2YU9A 5JFEA 2Y0SA 4GTDA 1Q8IA 4GTCA 1MIUA 1TWCA 2WB1A 4GTEA 3DU6A 4KC6A 1B4BA 1TWHA 4D3YA 5JVOA 2BE5D 3LHPS 3CQZA 3AQOA 4KDDA 4KM9A 1EH1A 4LMOA 3HKZA 4Q5VA 1HQMD 4O26A 1O28A 1I6VD 5JSNB 1TWFA 1TGOA 1A31A 3GTMA 4KMAA 2R93A 3VA7A 3Q3QA 1ZYRD 4KB2A 2GSOA 1ZXOA 2E2IA 2NVYA 2GSUA 4EJ3A 4FXDA 3NUHA 1IW7D 1TL8A 1SFOA 3K57A 1XXAA 3BUEA 3K59A 4GTAA 2PMZA 4FGUA 3L4KA 2PHCB 1I50A 3OPFA 4KAWX 2JA5A 3FKIA 4FZBA 4OYDB 3K5OA 2R7ZA 3AQPA 4AYBA 3MAQA 1RR8C 2A6ED 2CFAB 3CAGA 1Y1WA 1BJTA 5EGEA 3GTQA 4FYDA 1BGWA 1T8IA 2CW0D 1TWAA 4NOMA 1WCMA 3P9AA 2JA6A 4GT9A 1SMYD 1EK8A 3FOEA 1NH3A 2RH6A 2CFAA 3L4JA 3V4GA 2ZFZA 2R92A 1O24A 3FHZA 1A35A 4NOLA 1XXBA 2P5MA 3MMLB 1EJ9A 4C3IC 2XCRB 5CHPA 1AB4A 3GTOA 5C9HA 3N3YA 1R5ZA 1WQHA 4M1XA 2R4GA 3LF9A 1TWGA 1LPQA 1WQGA 4JLRC 2E2HA 1O29A 4P5AA 5MLC9 5EGHA 5TJ3A 3FOFA 1IS1A 4Q5GA 4J3NA 4DDQA 4KARA 4G0VA 5CJ9A 1RRJA 3ERED 3GTJA 1XXCA 5IOTA 4NOKA 1YNJD 3GTPA 4C2MC 2A68D 3SJRA 2XCQA 2KWAA 4F3EA 4GTLA 4G0WA 3QX3A 4L8IA 4C3JC 4C2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DD5 A;  4KB4 A;  5JSB B;  3LAJ A;  3L4J A;  1ISE A;  1B4A A;  3LPX A;  1Y69 8;  2ZFZ A;  3V4G A;  3NUH A;  1XXB A;  3MML B;  2P5M A;  2Y3P A;  3FOF A;  3FHZ A;  2RGR A;  2XCR B;  1GE9 A;  1XXA A;  3BUE A;  1WIH A;  1AB4 A;  4G0U A;  1WQH A;  3ORE A;  3LAP A;  3L4K A;  1ZVU A;  2PHC B;  3OPF A;  3LF9 A;  4KAW X;  1WQG A;  4JLR C;  5MLC 9;  1IS1 A;  4KC6 A;  1B4B A;  4J3N A;  2XCO A;  4DDQ A;  5JVO A;  4G0V A;  4OYD B;  5CJ9 A;  3ERE D;  3LHP S;  4KDD A;  1XXC A;  1EH1 A;  3CAG A;  1BJT A;  3OEP A;  1F9N A;  1WQF A;  5JSN B;  1BGW A;  4GFQ A;  2XCQ A;  2KWA A;  3VA7 A;  4G0W A;  3QX3 A;  4L8I A;  4KB2 A;  1EK8 A;  4FM9 A;  3FOE A; 
#chains in the Genus database with same CATH topology
 1WOO A;  1K4T A;  1O26 A;  2WAQ A;  4C45 A;  3FOF A;  3FHZ A;  4IP9 A;  2B63 A;  1HQM A;  1O2A A;  1WIH A;  4C3J K;  3HOW K;  2B63 K;  2VUM A;  4LK0 A;  1J6W A;  3TTG A;  3GTJ C;  2XCO A;  3GTL A;  3WVO A;  2VUM K;  5IYC C;  3GTP C;  5HL8 A;  4G7Z A;  2JA7 A;  1VLO A;  5IP7 K;  3TFJ A;  1VJE A;  1F9N A;  2A69 D;  5D4D A;  3K5L A;  2JA7 K;  4KMD A;  1K83 A;  1I3Q C;  2A6H D;  4KB4 A;  1K83 K;  4D3Z A;  4P5B A;  3LPX A;  1USM A;  1O2B A;  4BBS K;  1I3Q K;  4ZH4 A;  3K7A C;  3I4N K;  4A3K C;  3IAY A;  1SC7 A;  2YU9 A;  3WOD A;  1G51 A;  4BBR K;  4RMF A;  2E2J C;  2YU9 K;  4KC6 A;  1TWH A;  4D3Y A;  3K7A K;  4Y52 C;  1IL2 A;  4KDD A;  1USO A;  5FLM C;  1TWH K;  1O28 A;  5JSN B;  4A3I C;  1A31 A;  1I6H K;  1ZYR D;  2GSO A;  5FLM K;  4A3E K;  1DCO A;  4A3I K;  4EJ3 A;  1TL8 A;  4GTA A;  5E68 A;  4LJZ A;  1IQ0 A;  4OIR A;  1I50 A;  3DXJ A;  3S17 C;  3SZZ A;  5C3E C;  3T02 A;  4OYD B;  3AQP A;  2Y0S L;  3MAQ A;  1BJT A;  3GTM C;  3GSI A;  5IYB K;  2CW0 D;  1TWA A;  4YFK A;  3P9A A;  4X6A C;  1TWA K;  3FOE A;  2RH6 A;  3HKZ L;  1SFO C;  4LK1 A;  2JA8 K;  1XXB A;  2XCR B;  4X6A K;  1YCL A;  3GTO A;  5C9H A;  1R5Z A;  1WQH A;  5M5X K;  3S2D C;  4BXX C;  4A3M K;  3FKI C;  4BY1 C;  1LPQ A;  1WQG A;  3GTO K;  4J3N A;  4DDQ A;  3T00 A;  2O5J A;  1RRJ A;  3S2D K;  3S1Q K;  2XCQ A;  1PJ7 A;  4C3H K;  4F3E A;  4G0W A;  4AH6 A;  4KMA A;  4AYB L;  3TFI A;  3H3V D;  3S15 K;  3K5N A;  2Y3P A;  4KMH A;  5IOQ A;  4IP8 A;  1GE9 A;  1Y1V A;  2JH3 A;  1K4S A;  2E2H C;  1TWG C;  2NVX A;  1Y1V K;  1ZYR A;  2NVX K;  1UV7 A;  3H0G A;  3N0C A;  3PO2 C;  4QCL A;  1TWG K;  3H0G K;  1V9M A;  4LR2 A;  5M5Y K;  3M4O C;  4GFQ A;  5C44 C;  3HOU K;  3A8K A;  5JSB B;  3KYL A;  4BKW A;  4BY7 K;  3HOW C;  3AH5 A;  3M4O K;  3N0B A;  2B63 C;  5C44 K;  1YNN D;  3M3Y K;  4G0U A;  5JFE A;  2VUM C;  2WAQ L;  1Q8I A;  4GTC A;  5IP7 C;  3CQZ C;  1TWC A;  3GTL C;  4GTE A;  3DU6 A;  1WOP A;  2JA7 C;  3ADA C;  4QIW D;  3LHP S;  3CQZ A;  1WOR A;  3GEE A;  3S1M K;  4LMO A;  4OIO A;  4O26 A;  1DCH A;  1K83 C;  1I6V D;  3CQZ K;  3GTL K;  3S1N K;  1TWF A;  2R93 A;  4BBS C;  4YFN A;  4KB2 A;  1XZP B;  1TWF K;  5M5W K;  3I4N C;  4A93 K;  1IE0 A;  3T01 A;  4OIN A;  2R93 K;  1ZXO A;  2E2I A;  2NVY A;  4JK1 A;  3I4M K;  3NUH A;  1IW7 D;  4BBR C;  2E2I K;  3HKZ D;  3S2H C;  2NVY K;  1INN A;  1O2F B;  2YU9 C;  1XZP A;  2JA5 C;  2PMZ A;  4FGU A;  3L4K A;  2V6S A;  2PHC B;  1F7V A;  1TWH C;  1J6X A;  2JA5 A;  3S2H K;  2PMZ L;  4FZB A;  4QJV B;  1I6H C;  1VGX A;  2R7Z A;  2JA5 K;  1RR8 C;  5EGE A;  1VH2 A;  1Y1W A;  4A3E C;  2JA6 C;  3SZY A;  3HOY K;  3BP3 A;  5IYD C;  2R7Z K;  3PO3 K;  4FYD A;  1BGW A;  1T8I A;  4XSZ A;  1Y1W K;  2JA6 A;  4QJV A;  2PA8 D;  1SMY D;  2WB1 D;  1NH3 A;  2JA6 K;  3L4J A;  5IYD K;  2O5I A;  3V4G A;  1O24 A;  2ZUE A;  5CHP A;  1I50 C;  3N3Y A;  3A8J A;  1BDF A;  3AD7 C;  4P5A A;  5MLC 9;  5IYB C;  4KMU A;  4KAR A;  1X31 C;  3ERE D;  1I50 K;  5IOT A;  1JVI A;  1TWA C;  1YNN A;  1J6V A;  1YNJ D;  4Y7N K;  3RZO K;  3SJR A;  3BP8 C;  4GTL A;  2JA8 C;  3QX3 A;  3RZD K;  4PAA A;  4FM9 A;  4ILD A;  1YX2 A;  4A3B K;  4A3M C;  4AN8 A;  3GTO C;  4C3I C;  3GTG A;  5C4J C;  4KN4 A;  2NVT C;  2B9S B;  1I6V A;  3GTK A;  2A69 A;  3ORE A;  3LAP A;  3GTG K;  3S1Q C;  1R49 A;  2V6T A;  5IOS A;  2ZUF A;  3GTK K;  2A6H A;  4H3T A;  4C3I K;  2GSN A;  5C4J K;  2W7V A;  2NVT K;  5C4X C;  1XPP A;  1F93 A;  4C3H C;  1A36 A;  5IP9 K;  1IW7 A;  3S14 K;  1R9T A;  4KM8 A;  3M4A A;  3OEP A;  1ZQ1 C;  1WQF A;  1R9T K;  4GTB A;  5C4X K;  1F7U A;  3S15 C;  1XZQ B;  3LAJ A;  4PAB A;  5IOR A;  1B4A A;  1Y69 8;  3G4C A;  1Y1V C;  2NVQ C;  1KQ4 A;  2NVX C;  4O2D A;  1XZQ A;  3AD8 C;  2NVQ K;  1DCP A;  1SMY A;  1MIU A;  2WB1 A;  3H0G C;  4A3J C;  4P9S A;  1JOE A;  5JVO A;  3HOX K;  2BE5 D;  2GAG C;  4KM9 A;  3HOU C;  4A3F K;  4A3J K;  1IBA A;  4BY7 C;  3VA7 A;  3M3Y C;  4NOI A;  3K57 A;  4XCH A;  1XXA A;  1YNJ A;  3BUE A;  2FQO A;  3EQL A;  1TWC C;  2CW0 A;  3OPF A;  3S1M C;  3S1R K;  3S1N C;  3JST A;  4A3D K;  3S16 K;  1TWC K;  1WCM C;  2A6E D;  2CFA B;  1TWF C;  3CAG A;  4A93 C;  2R93 C;  1WSV A;  1WCM A;  3I4M C;  2Y0S D;  3HOV K;  2E2I C;  4GT9 A;  2R92 C;  2NVY C;  1BS2 A;  1WCM K;  4XSX A;  1C0A A;  2CFA A;  2R92 A;  1A35 A;  2P5M A;  3GIR A;  2R92 K;  1AB4 A;  4OIP A;  4M1X A;  2R4G A;  1O29 A;  4BLA A;  4A3L C;  4JLR C;  5TJ3 A;  3HOY C;  2R7Z C;  1IS1 A;  3PO3 C;  2GAH C;  4WJ3 M;  5TMF A;  1Y1W C;  3GTJ A;  1XXC A;  4NOK A;  4A3L K;  3GTP A;  3GTJ K;  4C2M C;  4WJ4 A;  2A68 D;  3H3V L;  5IYC K;  3GTP K;  4L8I A;  4C2M A;  3K5M A;  1DD5 A;  1I3Q A;  2O5J D;  5FJ8 K;  4BLB A;  5L46 A;  2BE5 A;  4C2M K;  4GTF A;  1O25 A;  4AYB D;  3TFH A;  4KN7 A;  1SEU A;  1V5V A;  1ZVU A;  3HXA A;  3K58 A;  1L0W A;  4G7H A;  5TMC A;  4XLN A;  4KAT A;  4KAS A;  4A3K K;  4Y7N C;  3RZO C;  4XLP A;  3RZD C;  1VRQ C;  2PPB A;  4LLG A;  3S0X A;  2E2J K;  3DU5 A;  4WIL A;  4LQY A;  4A3B C;  4Y52 K;  1ZBS A;  3G4A A;  1O27 A;  1ISE A;  5CQG A;  2EBB A;  3A8I A;  3GTG C;  4GZY A;  4QIW A;  4AHC A;  1EFW A;  2A6E A;  2RGR A;  3GTK C;  2F4Q A;  4Q5S A;  4YFX A;  3HOZ C;  4QIW L;  2Y0S A;  4GTD A;  5IP9 C;  3S14 C;  1EQR A;  1B4B A;  1R9T C;  2WAQ D;  3AQO A;  3HOZ K;  1EH1 A;  3S17 K;  3HKZ A;  4Q5V A;  1HQM D;  3GDZ A;  5C3E K;  3GEI A;  1TGO A;  3GTM A;  4LOW A;  1WSR A;  2V6U A;  3Q3Q A;  1J98 A;  2P8T A;  3GTM K;  2GSU A;  3GEH A;  3IPJ A;  4FXD A;  4OIQ A;  1SFO A;  3K59 A;  1RU0 A;  3HOX C;  2A68 A;  1SFO K;  4KAW X;  4A3F C;  3FKI A;  3GTQ C;  3K5O A;  4BXX K;  4MEX A;  2FQT A;  1JQW A;  3FKI K;  4BY1 K;  2PA8 L;  4AYB A;  2D6F C;  2WB1 L;  3GTQ A;  2PMZ D;  4G7O A;  4A3C C;  4NOM A;  1PJ5 A;  3GTQ K;  1EK8 A;  1PJ6 A;  5M3F K;  4A3G C;  4MEY A;  2ZFZ A;  4A3C K;  4NOL A;  3MML B;  3S1R C;  1EJ9 A;  4A3D C;  4A3G K;  3S16 C;  2E2H A;  3LF9 A;  1TWG A;  4MQ9 A;  5EGH A;  4Q5G A;  2E2H K;  4G0V A;  5CJ9 A;  1EI6 A;  1WOS A;  3AD9 C;  3HOV C;  5M3M K;  4Q4Z A;  3PO2 K;  1HI9 A;  2KWA A;  4YG2 A;  4C3J C; 
#chains in the Genus database with same CATH homology
 3K5M A;  1DD5 A;  4ILD A;  1K4T A;  4BLA A;  1I3Q A;  2O5J D;  4BLB A;  1O26 A;  2WAQ A;  4AN8 A;  4GTF A;  1O25 A;  3K5N A;  3GTG A;  2Y3P A;  4KMH A;  4IP9 A;  4IP8 A;  1GE9 A;  1Y1V A;  2B9S B;  1SEU A;  2B63 A;  1O2A A;  1WIH A;  1K4S A;  2JH3 A;  3GTK A;  2NVX A;  3ORE A;  3LAP A;  1ZVU A;  3K58 A;  1R49 A;  5IOS A;  2VUM A;  4H3T A;  4KAT A;  2GSN A;  4KAS A;  2XCO A;  3H0G A;  3GTL A;  3N0C A;  4QCL A;  3WVO A;  1A36 A;  4C3H C;  4FM9 A;  2JA7 A;  1R9T A;  1V9M A;  4KM8 A;  3M4A A;  3OEP A;  3S0X A;  3DU5 A;  4LR2 A;  1F9N A;  2A69 D;  1WQF A;  3K5L A;  4GFQ A;  4LQY A;  4GTB A;  4KMD A;  1K83 A;  2A6H D;  1ZBS A;  3G4A A;  4KB4 A;  5JSB B;  3KYL A;  4D3Z A;  1O27 A;  3LAJ A;  1ISE A;  4BKW A;  5CQG A;  4P5B A;  1B4A A;  3LPX A;  1Y69 8;  3AH5 A;  3G4C A;  5IOR A;  3N0B A;  1O2B A;  4QIW A;  1KQ4 A;  4AHC A;  5IOQ A;  2RGR A;  1YNN D;  2F4Q A;  4G0U A;  3IAY A;  1SC7 A;  2YU9 A;  5JFE A;  2Y0S A;  4GTD A;  1Q8I A;  4GTC A;  1MIU A;  1TWC A;  2WB1 A;  4GTE A;  3DU6 A;  4KC6 A;  1B4B A;  1TWH A;  4D3Y A;  5JVO A;  2BE5 D;  3LHP S;  3CQZ A;  3AQO A;  4KDD A;  4KM9 A;  1EH1 A;  4LMO A;  3HKZ A;  4Q5V A;  1HQM D;  4O26 A;  1O28 A;  1I6V D;  5JSN B;  1TWF A;  1TGO A;  1A31 A;  3GTM A;  4KMA A;  2R93 A;  3VA7 A;  3Q3Q A;  1ZYR D;  4KB2 A;  2GSO A;  1ZXO A;  2E2I A;  2NVY A;  2GSU A;  4EJ3 A;  4FXD A;  3NUH A;  1IW7 D;  1TL8 A;  1SFO A;  3K57 A;  1XXA A;  3BUE A;  3K59 A;  4GTA A;  2PMZ A;  4FGU A;  3L4K A;  2PHC B;  1I50 A;  3OPF A;  4KAW X;  2JA5 A;  3FKI A;  4FZB A;  4OYD B;  3K5O A;  2R7Z A;  3AQP A;  4AYB A;  3MAQ A;  1RR8 C;  2A6E D;  2CFA B;  3CAG A;  1Y1W A;  1BJT A;  5EGE A;  3GTQ A;  4FYD A;  1BGW A;  1T8I A;  2CW0 D;  1TWA A;  4NOM A;  1WCM A;  3P9A A;  2JA6 A;  4GT9 A;  1SMY D;  1EK8 A;  3FOE A;  1NH3 A;  2RH6 A;  2CFA A;  3L4J A;  3V4G A;  2ZFZ A;  2R92 A;  1O24 A;  3FHZ A;  1A35 A;  4NOL A;  1XXB A;  2P5M A;  3MML B;  1EJ9 A;  4C3I C;  2XCR B;  5CHP A;  1AB4 A;  3GTO A;  5C9H A;  3N3Y A;  1R5Z A;  1WQH A;  4M1X A;  2R4G A;  3LF9 A;  1TWG A;  1LPQ A;  1WQG A;  4JLR C;  2E2H A;  1O29 A;  4P5A A;  5MLC 9;  5EGH A;  5TJ3 A;  3FOF A;  1IS1 A;  4Q5G A;  4J3N A;  4DDQ A;  4KAR A;  4G0V A;  5CJ9 A;  1RRJ A;  3ERE D;  3GTJ A;  1XXC A;  5IOT A;  4NOK A;  1YNJ D;  3GTP A;  4C2M C;  2A68 D;  3SJR A;  2XCQ A;  2KWA A;  4F3E A;  4GTL A;  4G0W A;  3QX3 A;  4L8I A;  4C3J C;  4C2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...