1WQHA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Ribosome recycling factor
publication title X-ray structural studies of Mycobacterium Tuberculosis RRF and a comparative study of RRFS of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 58
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqhA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqhA02
3LAJA 4J3NA 1AB4A 1EH1A 4KB2A 1B4BA 1XXBA 4KC6A 3OREA 3V4GA 4JLRC 4KDDA 3BUEA 3NUHA 4KAWX 1B4AA 4OYDB 2PHCB 3OEPA 1IS1A 4KB4A 1WIHA 5CJ9A 5JVOA 4DDQA 3FHZA 3QX3A 1EK8A 1WQHA 5MLC9 3L4JA 2RGRA 2Y3PA 3L4KA 4G0WA 1Y698 3LPXA 2P5MA 2ZFZA 3FOFA 1F9NA 3VA7A 3LAPA 4FM9A 3CAGA 1DD5A 1ZVUA 2XCRB 3LHPS 4L8IA 3OPFA 1BJTA 3FOEA 3ERED 5JSNB 4G0UA 1XXCA 4G0VA 3MMLB 1ISEA 1XXAA 4GFQA 1WQGA 1GE9A 2KWAA 1WQFA 2XCQA 2XCOA 3LF9A 1BGWA 5JSBB
chains in the Genus database with same CATH superfamily
3S14C 3GTJA 4XLPA 3N0CA 1TWGK 4BBRK 1USOA 4BBRC 4GTBA 3T01A 3S0XA 2GAHC 4XSZA 1I50A 2GSOA 1Y1WK 5IOQA 4C45A 3P9AA 5IP9K 3ERED 1TWGA 2BE5D 5M3FK 1XXCA 4KN4A 1X31C 2V6SA 4QIWD 2Y0SL 1WQFA 1XZQA 1ZQ1C 3K57A 1Y1WA 1EI6A 4GZYA 1ZBSA 2E2IC 4A3KK 3KYLA 4A3KC 5IYCC 3GTMK 3DXJA 3HOVC 3S17K 2R7ZK 3S17C 2BE5A 2R7ZC 4GTDA 3S1RC 4QIWA 1VJEA 2E2JC 2ZUEA 5IYBK 4ILDA 3AQPA 1F7UA 4P5BA 5CQGA 1K4TA 2E2IA 4GTLA 4XSXA 1RU0A 5IOSA 2A6HD 3IPJA 1J6XA 2CFAB 1R9TK 3DU5A 2R7ZA 4FZBA 3MAQA 1YNND 1XZPB 3I4NK 2A68D 2WB1L 2JA8K 4KC6A 4FXDA 5IP7C 1TWFC 3S1MC 4G7ZA 1B4AA 1USMA 2A6HA 5M5YK 2PMZD 1R9TA 3TFHA 2WAQA 5E68A 3PO3C 3GTQC 4OIQA 3HOWK 2JA7C 2A68A 1O28A 4GTCA 4L8IA 2V6TA 4G0VA 1WSVA 3GIRA 2B63K 4C2MK 2KWAA 2B63C 4A3DC 2PMZA 3LF9A 4GTFA 3N3YA 3SZYA 4LMOA 3OEPA 5CJ9A 3AQOA 3GTOK 3GTOC 1DCHA 4KM8A 2B63A 4C2MA 2EBBA 3S1NK 4P9SA 3RZOC 3S1NC 2R4GA 4LOWA 5C44K 4MEXA 5TMCA 2YU9K 3GEIA 4A3EC 1IW7D 3K7AC 4GFQA 3TFJA 5EGHA 1ZXOA 3GTOA 4BBSK 1BGWA 4BLBA 2B9SB 1B4BA 4QJVA 2JA6K 1I3QC 4KDDA 3RZDK 4PAAA 1IW7A 3K5MA 4ZH4A 4DDQA 1TWAK 1TWAC 3GSIA 1WQHA 4G0WA 3CQZC 1A31A 3GTGK 3GTGC 4BY7K 1IQ0A 1TL8A 3FKIK 4FM9A 1ZVUA 4IP9A 1NH3A 1I3QA 2JA6A 4F3EA 4C3IC 3K5OA 4OIPA 1TWAA 3IAYA 4MEYA 1SFOK 3GTKC 4A3IK 3GTGA 4AYBD 1R5ZA 1MIUA 1WORA 2F4QA 1VH2A 4BY1C 3FKIA 3BUEA 3A8IA 1O27A 1IL2A 2D6FC 4NOKA 3FHZA 3ADAC 2RGRA 2Y3PA 1IE0A 3S16C 1SFOA 4KASA 4AYBA 2P8TA 4KATA 3EQLA 4LR2A 2FQOA 4NOIA 2GAGC 3HKZD 1TWCC 2PA8D 1O25A 2JA5K 2JA5C 1GE9A 1WQGA 3K5NA 2Y0SD 1O29A 2W7VA 1PJ6A 4GTEA 1LPQA 3PO2K 3PO2C 2E2IK 3V4GA 3HKZA 5IYCK 1TWCA 1F93A 3G4CA 3HOVK 5JFEA 4YFXA 4YFKA 3S1RK 4A3GC 4NOMA 2JA5A 5IORA 3LPXA 2E2JK 1F9NA 5TJ3A 5C3EK 5IYDC 5C3EC 5JSNB 1TWHC 4AHCA 1SMYD 4JK1A 4QIWL 4Y7NC 4Y7NK 1WOOA 4KMDA 4Y52K 4Y52C 2GSNA 1UV7A 1SC7A 3A8JA 5EGEA 3N0BA 1WOSA 2WB1D 4BLAA 1R49A 4KB2A 4Q5GA 5HL8A 5IP7K 1TWFK 5CHPA 4C3JK 3S1MK 1WIHA 4C3JC 1WOPA 4P5AA 1SMYA 4LQYA 3L4JA 2O5IA 4C3HK 4C3HC 3PO3K 4Q5SA 3GTQK 1YNNA 3GTLC 2JA7K 2WB1A 1G51A 2ZUFA 1TWFA 4MQ9A 2WAQL 5C4XK 2CW0D 5C4XC 4A3DK 4D3YA 4YFNA 3I4MC 3S2DC 3G4AA 2RH6A 2NVTK 2NVTC 3GTQA 3K59A 2JA7A 2PMZL 4XLNA 3HOUC 3AH5A 1BDFA 1YX2A 3HOXK 2CW0A 3HOXC 3DU6A 4WJ4A 2FQTA 3RZOK 3LAPA 1RRJA 1V9MA 3GDZA 1BJTA 4A3EK 2A6ED 1DCOA 4OINA 3K7AK 4NOLA 1Q8IA 3LAJA 1SEUA 4A3BC 1A35A 3HOYK 4KM9A 3HOYC 1I3QK 1EJ9A 4KAWX 1XPPA 4D3ZA 1XZPA 2A6EA 3QX3A 5MLC9 3CQZK 1Y698 2ZFZA 3GEEA 4A3JC 1XZQB 2E2HK 2E2HC 3OPFA 4LK0A 3FOEA 4C3IK 3MMLB 1XXAA 3SZZA 1Y1VC 3AD8C 1T8IA 2XCOA 3H3VL 4FYDA 1ZYRD 1JVIA 3CQZA 3GTKK 4KARA 1J6WA 1J6VA 1KQ4A 1K83C 1PJ7A 2VUMC 3H0GC 4BY1K 4G7HA 2E2HA 5JVOA 3S15C 1EK8A 2P5MA 4A3FK 4A3FC 3K5LA 4LJZA 3S16K 1A36A 1ZYRA 3VA7A 3M4OC 4KMAA 3M4OK 3S1QC 2R93C 3GTKA 2VUMA 1O2FB 4G0UA 1TWCK 1EQRA 4H3TA 3HXAA 2NVXK 1I50C 1O24A 1J98A 2NVXC 3GTMC 2XCQA 4AYBL 4RMFA 2O5JD 2R93A 1TWGC 1K4SA 4OYDB 1IS1A 2NVXA 2GSUA 1Y1WC 4X6AK 4X6AC 3WVOA 4IP8A 3JSTA 4A3GK 4KMUA 2A69D 3GTMA 1RR8C 2Y0SA 2NVQK 2NVQC 5FJ8K 5IP9C 3HKZL 2XCRB 2O5JA 5IYDK 3LHPS 2PA8L 1TWHK 1L0WA 1VRQC 4FGUA 1V5VA 2A69A 3HOZK 4A93K 4A93C 3HOZC 2JH3A 3NUHA 4KB4A 1I6HK 1I6HC 1TWHA 1O2AA 4A3MK 4O26A 4A3MC 5D4DA 1JOEA 5IYBC 1HQMD 3FOFA 3T02A 5IOTA 4Q5VA 1DD5A 3GTLK 4BXXK 4BXXC 4WILA 4LLGA 4QJVB 1R9TC 5M3MK 2WAQD 3I4NC 2JA8C 3I4MK 1HQMA 3S2DK 1XXBA 4OIOA 1VGXA 4JLRC 4GTAA 3GTLA 2R92K 3TFIA 3TTGA 2R92C 1WCMK 1WCMC 3HOUK 3L4KA 1DCPA 3HOWC 3S2HK 4QCLA 3S2HC 3Q3QA 1INNA 1EFWA 4LK1A 4KN7A 1BS2A 1ISEA 2R92A 4GT9A 4C2MC 1WCMA 4YG2A 1I6VD 3M3YK 3M3YC 3WODA 5JSBB 3AD9C 4KMHA 4G7OA 4A3BK 2V6UA 5M5WK 2CFAA 3BP3A 3SJRA 5TMFA 3M4AA 2PHCB 4A3CK 4A3CC 5C4JK 5C4JC 3K58A 1I6VA 2PPBA 3GTPK 4O2DA 3GTPC 5C44C 3A8KA 3CAGA 2YU9C 4BKWA 4A3JK 1O26A 4A3LK 4A3LC 4AN8A 5L46A 1TGOA 4M1XA 4Q4ZA 1HI9A 3T00A 1Y1VK 4BBSC 3H3VD 1YNJD 1WSRA 4J3NA 3GTPA 1AB4A 1EH1A 3OREA 2JA6C 1K83K 2VUMK 2YU9A 3RZDC 5C9HA 3H0GK 4XCHA 5M5XK 2NVYK 2NVYC 3S15K 4OIRA 3GTJK 4BY7C 3GTJC 1Y1VA 1YNJA 3FKIC 1YCLA 4AH6A 2R93K 1JQWA 3S1QK 3GEHA 5FLMK 1K83A 5FLMC 3H0GA 4WJ3M 4PABA 1I50K 1PJ5A 3BP8C 1VLOA 1F7VA 1IBAA 3AD7C 1SFOC 2NVYA 1C0AA 4EJ3A 1O2BA 4A3IC 3S14K
chains in the Genus database with same CATH topology
3GTJA 3G4AA 2RH6A 3N0CA 2B9SB 1B4BA 3GTQA 2JH3A 4KDDA 3K59A 2JA7A 3NUHA 4GTBA 3K5MA 4KB4A 3S0XA 4DDQA 1TWHA 1I50A 1WQHA 2GSOA 3AH5A 1O2AA 4G0WA 1A31A 5IOQA 4O26A 3DU6A 1HQMD 1TL8A 3FOFA 3LAPA 5IOTA 4FM9A 4Q5VA 3P9AA 1DD5A 1RRJA 1ZVUA 1V9MA 4IP9A 1NH3A 1I3QA 2JA6A 1TWGA 1BJTA 3ERED 2A6ED 2BE5D 4F3EA 4C3IC 1XXCA 1ZXOA 3K5OA 4NOLA 1WQFA 1TWAA 3IAYA 3K57A 1Y1WA 3GTGA 1Q8IA 3LAJA 1R5ZA 1MIUA 1SEUA 1ZBSA 1XXBA 2F4QA 1A35A 3FKIA 4KM9A 4JLRC 3BUEA 3KYLA 4GTAA 3GTLA 1O27A 1EJ9A 4KAWX 4D3ZA 4NOKA 3FHZA 4GTDA 3QX3A 2RGRA 5MLC9 4QIWA 2Y3PA 3L4KA 1Y698 2ZFZA 1SFOA 4ILDA 4AYBA 4KASA 3AQPA 4KATA 4P5BA 5CQGA 4LR2A 1K4TA 4QCLA 2E2IA 3Q3QA 3OPFA 4GTLA 3FOEA 5IOSA 2A6HD 1O25A 3MMLB 1ISEA 2R92A 2CFAB 3DU5A 2R7ZA 1GE9A 1WQGA 1XXAA 1WCMA 3K5NA 4FZBA 4GT9A 1I6VD 1O29A 3MAQA 1T8IA 2XCOA 5JSBB 1YNND 4FYDA 1ZYRD 1LPQA 3CQZA 4GTEA 4KARA 1KQ4A 2A68D 4KMHA 4KC6A 4FXDA 3V4GA 2CFAA 3SJRA 3HKZA 2E2HA 1TWCA 3G4CA 1B4AA 3M4AA 2PHCB 5JVOA 5JFEA 1EK8A 4NOMA 1R9TA 2JA5A 5IORA 3K58A 3LPXA 2P5MA 2WAQA 3K5LA 1F9NA 1A36A 3VA7A 5TJ3A 4KMAA 3CAGA 3GTKA 1O28A 4GTCA 2VUMA 4BKWA 4C2MC 4L8IA 1O26A 4G0UA 5JSNB 4AN8A 4H3TA 1TGOA 4AHCA 1O24A 4M1XA 4G0VA 1SMYD 4KMDA 2KWAA 2GSNA 2PMZA 2XCQA 3LF9A 1SC7A 1YNJD 4GTFA 3N0BA 3N3YA 5EGEA 4J3NA 3GTPA 1AB4A 1EH1A 4KB2A 1R49A 2R93A 2O5JD 4Q5GA 3OREA 4BLAA 2YU9A 5C9HA 4LMOA 1K4SA 1O2BA 5CHPA 4OYDB 3OEPA 5CJ9A 1IS1A 1WIHA 4C3JC 3AQOA 2NVXA 4P5AA 2GSUA 4LQYA 3WVOA 4IP8A 3L4JA 4KM8A 2B63A 4C2MA 2A69D 3GTMA 1Y1VA 1RR8C 4C3HC 2Y0SA 2R4GA 2WB1A 2XCRB 3LHPS 1K83A 1IW7D 3H0GA 1TWFA 4GFQA 4FGUA 5EGHA 2CW0D 2NVYA 4EJ3A 3GTOA 1BGWA 4BLBA 4D3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAJ A;  4J3N A;  1AB4 A;  1EH1 A;  4KB2 A;  1B4B A;  1XXB A;  4KC6 A;  3ORE A;  3V4G A;  4JLR C;  4KDD A;  3BUE A;  3NUH A;  4KAW X;  1B4A A;  4OYD B;  2PHC B;  3OEP A;  1IS1 A;  4KB4 A;  1WIH A;  5CJ9 A;  5JVO A;  4DDQ A;  3FHZ A;  3QX3 A;  1EK8 A;  1WQH A;  5MLC 9;  3L4J A;  2RGR A;  2Y3P A;  3L4K A;  4G0W A;  1Y69 8;  3LPX A;  2P5M A;  2ZFZ A;  3FOF A;  1F9N A;  3VA7 A;  3LAP A;  4FM9 A;  3CAG A;  1DD5 A;  1ZVU A;  2XCR B;  3LHP S;  4L8I A;  3OPF A;  1BJT A;  3FOE A;  3ERE D;  5JSN B;  4G0U A;  1XXC A;  4G0V A;  3MML B;  1ISE A;  1XXA A;  4GFQ A;  1WQG A;  1GE9 A;  2KWA A;  1WQF A;  2XCQ A;  2XCO A;  3LF9 A;  1BGW A;  5JSB B; 
#chains in the Genus database with same CATH topology
 3S14 C;  3GTJ A;  4XLP A;  3N0C A;  1TWG K;  4BBR K;  1USO A;  4BBR C;  4GTB A;  3T01 A;  3S0X A;  2GAH C;  4XSZ A;  1I50 A;  2GSO A;  1Y1W K;  5IOQ A;  4C45 A;  3P9A A;  5IP9 K;  3ERE D;  1TWG A;  2BE5 D;  5M3F K;  1XXC A;  4KN4 A;  1X31 C;  2V6S A;  4QIW D;  2Y0S L;  1WQF A;  1XZQ A;  1ZQ1 C;  3K57 A;  1Y1W A;  1EI6 A;  4GZY A;  1ZBS A;  2E2I C;  4A3K K;  3KYL A;  4A3K C;  5IYC C;  3GTM K;  3DXJ A;  3HOV C;  3S17 K;  2R7Z K;  3S17 C;  2BE5 A;  2R7Z C;  4GTD A;  3S1R C;  4QIW A;  1VJE A;  2E2J C;  2ZUE A;  5IYB K;  4ILD A;  3AQP A;  1F7U A;  4P5B A;  5CQG A;  1K4T A;  2E2I A;  4GTL A;  4XSX A;  1RU0 A;  5IOS A;  2A6H D;  3IPJ A;  1J6X A;  2CFA B;  1R9T K;  3DU5 A;  2R7Z A;  4FZB A;  3MAQ A;  1YNN D;  1XZP B;  3I4N K;  2A68 D;  2WB1 L;  2JA8 K;  4KC6 A;  4FXD A;  5IP7 C;  1TWF C;  3S1M C;  4G7Z A;  1B4A A;  1USM A;  2A6H A;  5M5Y K;  2PMZ D;  1R9T A;  3TFH A;  2WAQ A;  5E68 A;  3PO3 C;  3GTQ C;  4OIQ A;  3HOW K;  2JA7 C;  2A68 A;  1O28 A;  4GTC A;  4L8I A;  2V6T A;  4G0V A;  1WSV A;  3GIR A;  2B63 K;  4C2M K;  2KWA A;  2B63 C;  4A3D C;  2PMZ A;  3LF9 A;  4GTF A;  3N3Y A;  3SZY A;  4LMO A;  3OEP A;  5CJ9 A;  3AQO A;  3GTO K;  3GTO C;  1DCH A;  4KM8 A;  2B63 A;  4C2M A;  2EBB A;  3S1N K;  4P9S A;  3RZO C;  3S1N C;  2R4G A;  4LOW A;  5C44 K;  4MEX A;  5TMC A;  2YU9 K;  3GEI A;  4A3E C;  1IW7 D;  3K7A C;  4GFQ A;  3TFJ A;  5EGH A;  1ZXO A;  3GTO A;  4BBS K;  1BGW A;  4BLB A;  2B9S B;  1B4B A;  4QJV A;  2JA6 K;  1I3Q C;  4KDD A;  3RZD K;  4PAA A;  1IW7 A;  3K5M A;  4ZH4 A;  4DDQ A;  1TWA K;  1TWA C;  3GSI A;  1WQH A;  4G0W A;  3CQZ C;  1A31 A;  3GTG K;  3GTG C;  4BY7 K;  1IQ0 A;  1TL8 A;  3FKI K;  4FM9 A;  1ZVU A;  4IP9 A;  1NH3 A;  1I3Q A;  2JA6 A;  4F3E A;  4C3I C;  3K5O A;  4OIP A;  1TWA A;  3IAY A;  4MEY A;  1SFO K;  3GTK C;  4A3I K;  3GTG A;  4AYB D;  1R5Z A;  1MIU A;  1WOR A;  2F4Q A;  1VH2 A;  4BY1 C;  3FKI A;  3BUE A;  3A8I A;  1O27 A;  1IL2 A;  2D6F C;  4NOK A;  3FHZ A;  3ADA C;  2RGR A;  2Y3P A;  1IE0 A;  3S16 C;  1SFO A;  4KAS A;  4AYB A;  2P8T A;  4KAT A;  3EQL A;  4LR2 A;  2FQO A;  4NOI A;  2GAG C;  3HKZ D;  1TWC C;  2PA8 D;  1O25 A;  2JA5 K;  2JA5 C;  1GE9 A;  1WQG A;  3K5N A;  2Y0S D;  1O29 A;  2W7V A;  1PJ6 A;  4GTE A;  1LPQ A;  3PO2 K;  3PO2 C;  2E2I K;  3V4G A;  3HKZ A;  5IYC K;  1TWC A;  1F93 A;  3G4C A;  3HOV K;  5JFE A;  4YFX A;  4YFK A;  3S1R K;  4A3G C;  4NOM A;  2JA5 A;  5IOR A;  3LPX A;  2E2J K;  1F9N A;  5TJ3 A;  5C3E K;  5IYD C;  5C3E C;  5JSN B;  1TWH C;  4AHC A;  1SMY D;  4JK1 A;  4QIW L;  4Y7N C;  4Y7N K;  1WOO A;  4KMD A;  4Y52 K;  4Y52 C;  2GSN A;  1UV7 A;  1SC7 A;  3A8J A;  5EGE A;  3N0B A;  1WOS A;  2WB1 D;  4BLA A;  1R49 A;  4KB2 A;  4Q5G A;  5HL8 A;  5IP7 K;  1TWF K;  5CHP A;  4C3J K;  3S1M K;  1WIH A;  4C3J C;  1WOP A;  4P5A A;  1SMY A;  4LQY A;  3L4J A;  2O5I A;  4C3H K;  4C3H C;  3PO3 K;  4Q5S A;  3GTQ K;  1YNN A;  3GTL C;  2JA7 K;  2WB1 A;  1G51 A;  2ZUF A;  1TWF A;  4MQ9 A;  2WAQ L;  5C4X K;  2CW0 D;  5C4X C;  4A3D K;  4D3Y A;  4YFN A;  3I4M C;  3S2D C;  3G4A A;  2RH6 A;  2NVT K;  2NVT C;  3GTQ A;  3K59 A;  2JA7 A;  2PMZ L;  4XLN A;  3HOU C;  3AH5 A;  1BDF A;  1YX2 A;  3HOX K;  2CW0 A;  3HOX C;  3DU6 A;  4WJ4 A;  2FQT A;  3RZO K;  3LAP A;  1RRJ A;  1V9M A;  3GDZ A;  1BJT A;  4A3E K;  2A6E D;  1DCO A;  4OIN A;  3K7A K;  4NOL A;  1Q8I A;  3LAJ A;  1SEU A;  4A3B C;  1A35 A;  3HOY K;  4KM9 A;  3HOY C;  1I3Q K;  1EJ9 A;  4KAW X;  1XPP A;  4D3Z A;  1XZP A;  2A6E A;  3QX3 A;  5MLC 9;  3CQZ K;  1Y69 8;  2ZFZ A;  3GEE A;  4A3J C;  1XZQ B;  2E2H K;  2E2H C;  3OPF A;  4LK0 A;  3FOE A;  4C3I K;  3MML B;  1XXA A;  3SZZ A;  1Y1V C;  3AD8 C;  1T8I A;  2XCO A;  3H3V L;  4FYD A;  1ZYR D;  1JVI A;  3CQZ A;  3GTK K;  4KAR A;  1J6W A;  1J6V A;  1KQ4 A;  1K83 C;  1PJ7 A;  2VUM C;  3H0G C;  4BY1 K;  4G7H A;  2E2H A;  5JVO A;  3S15 C;  1EK8 A;  2P5M A;  4A3F K;  4A3F C;  3K5L A;  4LJZ A;  3S16 K;  1A36 A;  1ZYR A;  3VA7 A;  3M4O C;  4KMA A;  3M4O K;  3S1Q C;  2R93 C;  3GTK A;  2VUM A;  1O2F B;  4G0U A;  1TWC K;  1EQR A;  4H3T A;  3HXA A;  2NVX K;  1I50 C;  1O24 A;  1J98 A;  2NVX C;  3GTM C;  2XCQ A;  4AYB L;  4RMF A;  2O5J D;  2R93 A;  1TWG C;  1K4S A;  4OYD B;  1IS1 A;  2NVX A;  2GSU A;  1Y1W C;  4X6A K;  4X6A C;  3WVO A;  4IP8 A;  3JST A;  4A3G K;  4KMU A;  2A69 D;  3GTM A;  1RR8 C;  2Y0S A;  2NVQ K;  2NVQ C;  5FJ8 K;  5IP9 C;  3HKZ L;  2XCR B;  2O5J A;  5IYD K;  3LHP S;  2PA8 L;  1TWH K;  1L0W A;  1VRQ C;  4FGU A;  1V5V A;  2A69 A;  3HOZ K;  4A93 K;  4A93 C;  3HOZ C;  2JH3 A;  3NUH A;  4KB4 A;  1I6H K;  1I6H C;  1TWH A;  1O2A A;  4A3M K;  4O26 A;  4A3M C;  5D4D A;  1JOE A;  5IYB C;  1HQM D;  3FOF A;  3T02 A;  5IOT A;  4Q5V A;  1DD5 A;  3GTL K;  4BXX K;  4BXX C;  4WIL A;  4LLG A;  4QJV B;  1R9T C;  5M3M K;  2WAQ D;  3I4N C;  2JA8 C;  3I4M K;  1HQM A;  3S2D K;  1XXB A;  4OIO A;  1VGX A;  4JLR C;  4GTA A;  3GTL A;  2R92 K;  3TFI A;  3TTG A;  2R92 C;  1WCM K;  1WCM C;  3HOU K;  3L4K A;  1DCP A;  3HOW C;  3S2H K;  4QCL A;  3S2H C;  3Q3Q A;  1INN A;  1EFW A;  4LK1 A;  4KN7 A;  1BS2 A;  1ISE A;  2R92 A;  4GT9 A;  4C2M C;  1WCM A;  4YG2 A;  1I6V D;  3M3Y K;  3M3Y C;  3WOD A;  5JSB B;  3AD9 C;  4KMH A;  4G7O A;  4A3B K;  2V6U A;  5M5W K;  2CFA A;  3BP3 A;  3SJR A;  5TMF A;  3M4A A;  2PHC B;  4A3C K;  4A3C C;  5C4J K;  5C4J C;  3K58 A;  1I6V A;  2PPB A;  3GTP K;  4O2D A;  3GTP C;  5C44 C;  3A8K A;  3CAG A;  2YU9 C;  4BKW A;  4A3J K;  1O26 A;  4A3L K;  4A3L C;  4AN8 A;  5L46 A;  1TGO A;  4M1X A;  4Q4Z A;  1HI9 A;  3T00 A;  1Y1V K;  4BBS C;  3H3V D;  1YNJ D;  1WSR A;  4J3N A;  3GTP A;  1AB4 A;  1EH1 A;  3ORE A;  2JA6 C;  1K83 K;  2VUM K;  2YU9 A;  3RZD C;  5C9H A;  3H0G K;  4XCH A;  5M5X K;  2NVY K;  2NVY C;  3S15 K;  4OIR A;  3GTJ K;  4BY7 C;  3GTJ C;  1Y1V A;  1YNJ A;  3FKI C;  1YCL A;  4AH6 A;  2R93 K;  1JQW A;  3S1Q K;  3GEH A;  5FLM K;  1K83 A;  5FLM C;  3H0G A;  4WJ3 M;  4PAB A;  1I50 K;  1PJ5 A;  3BP8 C;  1VLO A;  1F7V A;  1IBA A;  3AD7 C;  1SFO C;  2NVY A;  1C0A A;  4EJ3 A;  1O2B A;  4A3I C;  3S14 K; 
#chains in the Genus database with same CATH homology
 3GTJ A;  3G4A A;  2RH6 A;  3N0C A;  2B9S B;  1B4B A;  3GTQ A;  2JH3 A;  4KDD A;  3K59 A;  2JA7 A;  3NUH A;  4GTB A;  3K5M A;  4KB4 A;  3S0X A;  4DDQ A;  1TWH A;  1I50 A;  1WQH A;  2GSO A;  3AH5 A;  1O2A A;  4G0W A;  1A31 A;  5IOQ A;  4O26 A;  3DU6 A;  1HQM D;  1TL8 A;  3FOF A;  3LAP A;  5IOT A;  4FM9 A;  4Q5V A;  3P9A A;  1DD5 A;  1RRJ A;  1ZVU A;  1V9M A;  4IP9 A;  1NH3 A;  1I3Q A;  2JA6 A;  1TWG A;  1BJT A;  3ERE D;  2A6E D;  2BE5 D;  4F3E A;  4C3I C;  1XXC A;  1ZXO A;  3K5O A;  4NOL A;  1WQF A;  1TWA A;  3IAY A;  3K57 A;  1Y1W A;  3GTG A;  1Q8I A;  3LAJ A;  1R5Z A;  1MIU A;  1SEU A;  1ZBS A;  1XXB A;  2F4Q A;  1A35 A;  3FKI A;  4KM9 A;  4JLR C;  3BUE A;  3KYL A;  4GTA A;  3GTL A;  1O27 A;  1EJ9 A;  4KAW X;  4D3Z A;  4NOK A;  3FHZ A;  4GTD A;  3QX3 A;  2RGR A;  5MLC 9;  4QIW A;  2Y3P A;  3L4K A;  1Y69 8;  2ZFZ A;  1SFO A;  4ILD A;  4AYB A;  4KAS A;  3AQP A;  4KAT A;  4P5B A;  5CQG A;  4LR2 A;  1K4T A;  4QCL A;  2E2I A;  3Q3Q A;  3OPF A;  4GTL A;  3FOE A;  5IOS A;  2A6H D;  1O25 A;  3MML B;  1ISE A;  2R92 A;  2CFA B;  3DU5 A;  2R7Z A;  1GE9 A;  1WQG A;  1XXA A;  1WCM A;  3K5N A;  4FZB A;  4GT9 A;  1I6V D;  1O29 A;  3MAQ A;  1T8I A;  2XCO A;  5JSB B;  1YNN D;  4FYD A;  1ZYR D;  1LPQ A;  3CQZ A;  4GTE A;  4KAR A;  1KQ4 A;  2A68 D;  4KMH A;  4KC6 A;  4FXD A;  3V4G A;  2CFA A;  3SJR A;  3HKZ A;  2E2H A;  1TWC A;  3G4C A;  1B4A A;  3M4A A;  2PHC B;  5JVO A;  5JFE A;  1EK8 A;  4NOM A;  1R9T A;  2JA5 A;  5IOR A;  3K58 A;  3LPX A;  2P5M A;  2WAQ A;  3K5L A;  1F9N A;  1A36 A;  3VA7 A;  5TJ3 A;  4KMA A;  3CAG A;  3GTK A;  1O28 A;  4GTC A;  2VUM A;  4BKW A;  4C2M C;  4L8I A;  1O26 A;  4G0U A;  5JSN B;  4AN8 A;  4H3T A;  1TGO A;  4AHC A;  1O24 A;  4M1X A;  4G0V A;  1SMY D;  4KMD A;  2KWA A;  2GSN A;  2PMZ A;  2XCQ A;  3LF9 A;  1SC7 A;  1YNJ D;  4GTF A;  3N0B A;  3N3Y A;  5EGE A;  4J3N A;  3GTP A;  1AB4 A;  1EH1 A;  4KB2 A;  1R49 A;  2R93 A;  2O5J D;  4Q5G A;  3ORE A;  4BLA A;  2YU9 A;  5C9H A;  4LMO A;  1K4S A;  1O2B A;  5CHP A;  4OYD B;  3OEP A;  5CJ9 A;  1IS1 A;  1WIH A;  4C3J C;  3AQO A;  2NVX A;  4P5A A;  2GSU A;  4LQY A;  3WVO A;  4IP8 A;  3L4J A;  4KM8 A;  2B63 A;  4C2M A;  2A69 D;  3GTM A;  1Y1V A;  1RR8 C;  4C3H C;  2Y0S A;  2R4G A;  2WB1 A;  2XCR B;  3LHP S;  1K83 A;  1IW7 D;  3H0G A;  1TWF A;  4GFQ A;  4FGU A;  5EGH A;  2CW0 D;  2NVY A;  4EJ3 A;  3GTO A;  1BGW A;  4BLB A;  4D3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...