1WQHA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structural studies of Mycobacterium Tuberculosis RRF and a comparative study of RRFS of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome recycling factor
total genus 58
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqhA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqhA02
1ISEA 1EK8A 3LAJA 1GE9A 4DDQA 3LAPA 1EH1A 1B4AA 1AB4A 4J3NA 3V4GA 3MMLB 4OYDB 4GFQA 4KB4A 3VA7A 1ZVUA 1Y698 3FHZA 3LPXA 1XXBA 3CAGA 1XXCA 5MLC9 1IS1A 3FOFA 3FOEA 3BUEA 4KAWX 2PHCB 4KB2A 4G0UA 1XXAA 3L4KA 1WQFA 2KWAA 1WQGA 3LF9A 1BGWA 1BJTA 1F9NA 1WIHA 1B4BA 2Y3PA 3OREA 5JVOA 3ERED 3LHPS 3NUHA 1WQHA 2P5MA 5CJ9A 2ZFZA 1DD5A 5JSNB 3OEPA 3QX3A 4G0WA 2XCOA 3OPFA 4FM9A 2XCRB 3L4JA 4L8IA 4KC6A 2XCQA 4JLRC 2RGRA 4G0VA 4KDDA 5JSBB
chains in the Genus database with same CATH superfamily
1GE9A 4DDQA 2JA5C 4BLAA 4OIOA 1TGOA 3K5LA 3GTKC 3AH5A 1K4TA 4A3IK 4YFXA 3GTLK 3N0CA 1YX2A 3AD8C 3BUEA 5L46A 2YU9A 3DU6A 1I50A 5JVOA 1K83C 4BKWA 2E2IK 3LHPS 4NOKA 3GTPA 3H0GK 2ZFZA 4BBSC 2O5IA 2BE5A 5IP7C 3I4NC 2Y0SA 4A3MK 4A3MC 5C9HA 4MQ9A 1B4AA 5D4DA 4G7HA 1O27A 3K5MA 3T02A 1R9TC 3VA7A 3HOWC 3CAGA 2GSUA 5FLMK 4A3CK 5MLC9 3HOYC 2PMZL 4XCHA 2CFAA 1I6HC 3HOVK 4NOMA 1SMYD 1YCLA 3S16K 3G4CA 3S1RK 4BXXK 3RZDK 1UV7A 3S0XA 1EQRA 4BXXC 2JA8C 1DD5A 3K57A 5JSNB 3GTPK 1J6WA 1EI6A 2WAQD 3HKZL 4A3JK 1WCMA 1ISEA 2Y0SD 1I50K 3H0GA 3G4AA 1JOEA 3S2HK 1O28A 4Y52K 1Y1VC 2P8TA 4P9SA 1TWGA 1X31C 2GSOA 4P5BA 2NVTC 2NVYK 2JA6K 4NOLA 2NVXK 4LLGA 4YFKA 4Y52C 3S2HC 1YNNA 1ZBSA 2V6TA 1F7VA 3T01A 1WIHA 3H0GC 2NVYA 1TWCA 2R7ZK 1V9MA 4G0WA 4QCLA 2JA8K 2RGRA 3HOUK 2XCOA 3TFIA 3ADAC 4PAAA 3LAJA 3S1RC 3RZDC 3HOUC 1WCMK 4XSXA 4J3NA 2R7ZC 4GTEA 1ZQ1C 3SJRA 5HL8A 3FHZA 1Y698 4QIWA 5FLMC 4WJ4A 1PJ5A 3SZZA 4LMOA 1IS1A 5IP7K 4GTAA 2E2JK 3I4NK 3S1MC 3PO2K 4G0UA 1TWGK 1XXAA 3HKZA 2E2JC 1VH2A 4GTCA 5IOQA 2GAHC 2WB1D 2Y3PA 3S14K 1SMYA 4KMHA 5C44C 4KASA 3GTQA 5C4JC 4AYBD 4A3FK 2ZUFA 4LOWA 5M3FK 3BP3A 4AHCA 2XCQA 1R5ZA 3HOXK 4BBRK 2WB1L 4QIWL 4PABA 2PMZA 4A3EC 1F93A 3Q3QA 4G7ZA 1HI9A 1TWAK 3MMLB 4OYDB 1VGXA 3HOWK 3I4MK 2E2IA 4GTBA 5IORA 3GTOA 1WSRA 4C2MA 4A3GC 4C45A 5IYCC 2JA5A 1A35A 1BJTA 3T00A 3OREA 4GTFA 4L8IA 5IYDK 1IW7A 4OINA 2NVXA 3LAPA 3K5NA 1TL8A 3BP8C 3RZOK 5C4XC 1YNND 3PO3K 2B63A 2B63K 1XPPA 4A3BC 4A3EK 2E2HA 2F4QA 3FOEA 2E2HC 3GTOK 3DU5A 4G7OA 2KWAA 3AD9C 1O2BA 4H3TA 3K58A 1Y1VK 5M3MK 4OIRA 4D3YA 4BBRC 3JSTA 4XLNA 3GTOC 1TWHC 1J6VA 4KN4A 4BY1C 3S1NK 3SZYA 3GSIA 3GTQK 1TWFC 3S1MK 4A3IC 2GSNA 3HXAA 3K7AK 2PHCB 2WB1A 1A31A 3GTJC 2NVQC 4G0VA 1TWAA 2JA7C 1V5VA 2JA7K 4A3KC 1I3QC 1PJ7A 4Y7NK 2R92A 4C3HK 3AD7C 2FQTA 5JFEA 3L4JA 2A6HD 2BE5D 4KM9A 3S1QK 4FGUA 3IAYA 3P9AA 2YU9K 1O26A 1SFOK 1TWGC 3TFJA 4BY1K 3S1NC 1ZVUA 2R7ZA 1K83K 3LPXA 4GTLA 1O25A 1NH3A 3S1QC 3GTGK 4A3GK 4C2MC 4KAWX 1EJ9A 3S2DC 5E68A 1IW7D 3A8KA 2P5MA 2GAGC 1JVIA 2EBBA 4LR2A 4A3DK 5EGHA 1TWCK 4OIQA 3K7AC 2XCRB 1I3QK 4Y7NC 1F7UA 5IOTA 3M4OK 1T8IA 4Q5VA 2D6FC 2A68D 3GEEA 1EH1A 1DCHA 3S16C 4GFQA 4A3LK 3S17C 1LPQA 4X6AC 2NVTK 2JA6A 2FQOA 3TFHA 4Q4ZA 2VUMK 3L4KA 3CQZA 4KMAA 4GT9A 4BBSK 4P5AA 5M5YK 3OEPA 3FKIK 4A3DC 2RH6A 4AYBA 1YNJD 4WILA 1J6XA 5M5WK 1WOOA 1VRQC 1IE0A 4KMDA 3GTKA 4QIWD 1TWCC 1R9TA 2NVYC 3GDZA 4A3CC 3GTGC 3AQOA 1SC7A 1ZYRD 3CQZC 3PO2C 1C0AA 3GTKK 3A8JA 1RRJA 4KARA 3GTMA 3GTPC 2R92C 1Y1VA 4C3IK 1I50C 4Q5GA 3FKIA 2W7VA 2YU9C 4WJ3M 1WCMC 1SEUA 4XSZA 1HQMA 3EQLA 4LJZA 3GEIA 2WAQL 3HKZD 4C3JK 3HOZC 4KB4A 1RR8C 1JQWA 3RZOC 5IP9C 1TWFA 1XXCA 3S15K 5IP9K 1O24A 3S2DK 4BLBA 3WVOA 4JK1A 4OIPA 1WQFA 1ZYRA 1A36A 1BGWA 4D3ZA 1F9NA 5TMCA 5C3EK 1Y1WC 1TWFK 1WQHA 4RMFA 1IL2A 5IOSA 2JH3A 1O2AA 4FM9A 1XZPB 4IP9A 1SFOA 1WSVA 4GTDA 4Q5SA 1EK8A 1YNJA 3MAQA 2V6SA 4AH6A 3I4MC 3GTLC 1VLOA 1K83A 3WODA 1XXBA 1I6VD 5CHPA 3M4AA 2B63C 4KATA 3GTGA 1R49A 3FOFA 4AYBL 3HOVC 3GTJA 4C3JC 3HOZK 1WQGA 3LF9A 5C4JK 2A68A 1EFWA 2NVQK 2O5JD 4XLPA 3S14C 4FYDA 5TMFA 4KDDA 4X6AK 5TJ3A 3HOYK 1DCOA 3M3YC 5C44K 5IYCK 4F3EA 2VUMC 1HQMD 2R93A 3S15C 2JA6C 2E2IC 1Q8IA 3M4OC 4ILDA 3CQZK 1I6VA 1VJEA 2JA7A 1TWAC 1XZQB 3TTGA 1RU0A 5IYBK 1USOA 4KMUA 5CJ9A 5C4XK 5IYBC 2B9SB 4A3JC 4A3FC 1WORA 1G51A 3IPJA 1IQ0A 3K59A 1BDFA 2A6HA 2NVXC 4IP8A 2A6EA 3PO3C 1TWHA 4QJVA 3V4GA 2CW0A 1MIUA 4QJVB 2VUMA 5C3EC 1L0WA 4A3LC 1J98A 4GZYA 3M3YK 2R4GA 4MEXA 1K4SA 4LK1A 3S17K 3NUHA 4AN8A 5EGEA 3N0BA 4ZH4A 1XZQA 2R93K 2CFAB 4C3HC 1KQ4A 1PJ6A 3OPFA 1I3QA 1I6HK 2E2HK 1ZXOA 4O26A 3H3VL 4C2MK 1AB4A 3KYLA 3AQPA 2R92K 2R93C 2JA5K 1TWHK 1O29A 1O2FB 4FXDA 2A69D 1R9TK 3GIRA 4LK0A 3GTQC 3H3VD 2O5JA 5CQGA 4LQYA 4BY7C 4KB2A 1XZPA 3GTMK 2PA8L 2PMZD 1B4BA 1Y1WA 3N3YA 2ZUEA 4KM8A 4KC6A 3K5OA 1WOSA 4NOIA 5JSBB 2PA8D 4YG2A 3GTJK 4KN7A 3GEHA 1IBAA 1Y1WK 4FZBA 3DXJA 5M5XK 4M1XA 2PPBA 2A6ED 2Y0SL 3GTLA 2CW0D 4A3BK 4EJ3A 4O2DA 1USMA 4YFNA 4MEYA 2A69A 3FKIC 3HOXC 1SFOC 1WOPA 1DCPA 3ERED 3GTMC 2WAQA 2V6UA 5IYDC 1BS2A 3QX3A 4A93K 4BY7K 4A3KK 1INNA 4JLRC 5FJ8K 4C3IC 4A93C 3A8IA
chains in the Genus database with same CATH topology
2PMZA 1T8IA 4Q5VA 2A68D 3Q3QA 1GE9A 4DDQA 1EH1A 4BLAA 4F3EA 4OYDB 3MMLB 1HQMD 1TGOA 3K5LA 4GFQA 3AH5A 1K4TA 2R93A 2E2IA 1Q8IA 1LPQA 3N0CA 4GTBA 5IORA 2JA6A 4ILDA 3GTOA 3BUEA 4C2MA 2YU9A 3DU6A 1I50A 3L4KA 2JA7A 2JA5A 3CQZA 1A35A 1BJTA 4GT9A 4KMAA 5JVOA 4P5AA 4BKWA 3OREA 3LHPS 4NOKA 3GTPA 5CJ9A 2ZFZA 2B9SB 4GTFA 3OEPA 2Y0SA 4AYBA 4L8IA 2RH6A 1YNJD 3FHZA 3K59A 5C9HA 2NVXA 4IP8A 3LAPA 1TWHA 3K5NA 1B4AA 1TL8A 1O27A 3V4GA 4KMDA 3K5MA 3GTKA 1MIUA 1YNND 1R9TA 2VUMA 3VA7A 2B63A 3CAGA 2GSUA 3AQOA 2E2HA 5MLC9 2F4QA 3FOEA 1SC7A 2CFAA 1ZYRD 2R4GA 4NOMA 1SMYD 3DU5A 1RRJA 1K4SA 2KWAA 3G4CA 4KARA 3GTMA 1O2BA 4H3TA 4AN8A 3NUHA 5EGEA 3S0XA 3N0BA 3K58A 2CFAB 1Y1VA 1DD5A 3K57A 5JSNB 1KQ4A 4C3HC 3OPFA 4D3YA 1I3QA 4Q5GA 3FKIA 1ZXOA 1WCMA 1ISEA 1SEUA 3H0GA 4O26A 3G4AA 1AB4A 1O28A 3KYLA 3AQPA 4KB4A 1RR8C 1TWGA 1O29A 2GSOA 4FXDA 4P5BA 1TWFA 2A69D 1XXCA 1O24A 4NOLA 5CQGA 4LQYA 2GSNA 3WVOA 4BLBA 2PHCB 4KB2A 2WB1A 1A31A 1ZBSA 1WQFA 4G0VA 1TWAA 1A36A 4D3ZA 1BGWA 1B4BA 1F9NA 1Y1WA 1WIHA 2NVYA 3N3YA 1WQHA 1TWCA 1V9MA 5IOSA 2JH3A 1O2AA 4G0WA 4KM8A 4FM9A 4QCLA 2R92A 5JFEA 3L4JA 4KC6A 4IP9A 3K5OA 1SFOA 2RGRA 2A6HD 2BE5D 5JSBB 2XCOA 4GTDA 4KM9A 1EK8A 4FGUA 3LAJA 3IAYA 3P9AA 4FZBA 1O26A 4J3NA 3MAQA 4M1XA 2A6ED 4GTEA 3SJRA 3GTLA 2R7ZA 1Y698 2CW0D 4QIWA 1K83A 1ZVUA 4EJ3A 1XXBA 1O25A 1I6VD 3LPXA 3M4AA 1NH3A 5CHPA 4KATA 3GTGA 1R49A 4LMOA 1IS1A 3FOFA 4GTAA 4C2MC 4KAWX 1EJ9A 4G0UA 1XXAA 3HKZA 1IW7D 3GTJA 4C3JC 5IOQA 4GTCA 1WQGA 3LF9A 2Y3PA 3ERED 4KMHA 4KASA 4GTLA 2P5MA 2WAQA 3GTQA 2O5JD 4LR2A 4FYDA 5EGHA 3QX3A 2XCRB 4AHCA 2XCQA 1R5ZA 4JLRC 4C3IC 4KDDA 5IOTA 5TJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISE A;  1EK8 A;  3LAJ A;  1GE9 A;  4DDQ A;  3LAP A;  1EH1 A;  1B4A A;  1AB4 A;  4J3N A;  3V4G A;  3MML B;  4OYD B;  4GFQ A;  4KB4 A;  3VA7 A;  1ZVU A;  1Y69 8;  3FHZ A;  3LPX A;  1XXB A;  3CAG A;  1XXC A;  5MLC 9;  1IS1 A;  3FOF A;  3FOE A;  3BUE A;  4KAW X;  2PHC B;  4KB2 A;  4G0U A;  1XXA A;  3L4K A;  1WQF A;  2KWA A;  1WQG A;  3LF9 A;  1BGW A;  1BJT A;  1F9N A;  1WIH A;  1B4B A;  2Y3P A;  3ORE A;  5JVO A;  3ERE D;  3LHP S;  3NUH A;  1WQH A;  2P5M A;  5CJ9 A;  2ZFZ A;  1DD5 A;  5JSN B;  3OEP A;  3QX3 A;  4G0W A;  2XCO A;  3OPF A;  4FM9 A;  2XCR B;  3L4J A;  4L8I A;  4KC6 A;  2XCQ A;  4JLR C;  2RGR A;  4G0V A;  4KDD A;  5JSB B; 
#chains in the Genus database with same CATH topology
 1GE9 A;  4DDQ A;  2JA5 C;  4BLA A;  4OIO A;  1TGO A;  3K5L A;  3GTK C;  3AH5 A;  1K4T A;  4A3I K;  4YFX A;  3GTL K;  3N0C A;  1YX2 A;  3AD8 C;  3BUE A;  5L46 A;  2YU9 A;  3DU6 A;  1I50 A;  5JVO A;  1K83 C;  4BKW A;  2E2I K;  3LHP S;  4NOK A;  3GTP A;  3H0G K;  2ZFZ A;  4BBS C;  2O5I A;  2BE5 A;  5IP7 C;  3I4N C;  2Y0S A;  4A3M K;  4A3M C;  5C9H A;  4MQ9 A;  1B4A A;  5D4D A;  4G7H A;  1O27 A;  3K5M A;  3T02 A;  1R9T C;  3VA7 A;  3HOW C;  3CAG A;  2GSU A;  5FLM K;  4A3C K;  5MLC 9;  3HOY C;  2PMZ L;  4XCH A;  2CFA A;  1I6H C;  3HOV K;  4NOM A;  1SMY D;  1YCL A;  3S16 K;  3G4C A;  3S1R K;  4BXX K;  3RZD K;  1UV7 A;  3S0X A;  1EQR A;  4BXX C;  2JA8 C;  1DD5 A;  3K57 A;  5JSN B;  3GTP K;  1J6W A;  1EI6 A;  2WAQ D;  3HKZ L;  4A3J K;  1WCM A;  1ISE A;  2Y0S D;  1I50 K;  3H0G A;  3G4A A;  1JOE A;  3S2H K;  1O28 A;  4Y52 K;  1Y1V C;  2P8T A;  4P9S A;  1TWG A;  1X31 C;  2GSO A;  4P5B A;  2NVT C;  2NVY K;  2JA6 K;  4NOL A;  2NVX K;  4LLG A;  4YFK A;  4Y52 C;  3S2H C;  1YNN A;  1ZBS A;  2V6T A;  1F7V A;  3T01 A;  1WIH A;  3H0G C;  2NVY A;  1TWC A;  2R7Z K;  1V9M A;  4G0W A;  4QCL A;  2JA8 K;  2RGR A;  3HOU K;  2XCO A;  3TFI A;  3ADA C;  4PAA A;  3LAJ A;  3S1R C;  3RZD C;  3HOU C;  1WCM K;  4XSX A;  4J3N A;  2R7Z C;  4GTE A;  1ZQ1 C;  3SJR A;  5HL8 A;  3FHZ A;  1Y69 8;  4QIW A;  5FLM C;  4WJ4 A;  1PJ5 A;  3SZZ A;  4LMO A;  1IS1 A;  5IP7 K;  4GTA A;  2E2J K;  3I4N K;  3S1M C;  3PO2 K;  4G0U A;  1TWG K;  1XXA A;  3HKZ A;  2E2J C;  1VH2 A;  4GTC A;  5IOQ A;  2GAH C;  2WB1 D;  2Y3P A;  3S14 K;  1SMY A;  4KMH A;  5C44 C;  4KAS A;  3GTQ A;  5C4J C;  4AYB D;  4A3F K;  2ZUF A;  4LOW A;  5M3F K;  3BP3 A;  4AHC A;  2XCQ A;  1R5Z A;  3HOX K;  4BBR K;  2WB1 L;  4QIW L;  4PAB A;  2PMZ A;  4A3E C;  1F93 A;  3Q3Q A;  4G7Z A;  1HI9 A;  1TWA K;  3MML B;  4OYD B;  1VGX A;  3HOW K;  3I4M K;  2E2I A;  4GTB A;  5IOR A;  3GTO A;  1WSR A;  4C2M A;  4A3G C;  4C45 A;  5IYC C;  2JA5 A;  1A35 A;  1BJT A;  3T00 A;  3ORE A;  4GTF A;  4L8I A;  5IYD K;  1IW7 A;  4OIN A;  2NVX A;  3LAP A;  3K5N A;  1TL8 A;  3BP8 C;  3RZO K;  5C4X C;  1YNN D;  3PO3 K;  2B63 A;  2B63 K;  1XPP A;  4A3B C;  4A3E K;  2E2H A;  2F4Q A;  3FOE A;  2E2H C;  3GTO K;  3DU5 A;  4G7O A;  2KWA A;  3AD9 C;  1O2B A;  4H3T A;  3K58 A;  1Y1V K;  5M3M K;  4OIR A;  4D3Y A;  4BBR C;  3JST A;  4XLN A;  3GTO C;  1TWH C;  1J6V A;  4KN4 A;  4BY1 C;  3S1N K;  3SZY A;  3GSI A;  3GTQ K;  1TWF C;  3S1M K;  4A3I C;  2GSN A;  3HXA A;  3K7A K;  2PHC B;  2WB1 A;  1A31 A;  3GTJ C;  2NVQ C;  4G0V A;  1TWA A;  2JA7 C;  1V5V A;  2JA7 K;  4A3K C;  1I3Q C;  1PJ7 A;  4Y7N K;  2R92 A;  4C3H K;  3AD7 C;  2FQT A;  5JFE A;  3L4J A;  2A6H D;  2BE5 D;  4KM9 A;  3S1Q K;  4FGU A;  3IAY A;  3P9A A;  2YU9 K;  1O26 A;  1SFO K;  1TWG C;  3TFJ A;  4BY1 K;  3S1N C;  1ZVU A;  2R7Z A;  1K83 K;  3LPX A;  4GTL A;  1O25 A;  1NH3 A;  3S1Q C;  3GTG K;  4A3G K;  4C2M C;  4KAW X;  1EJ9 A;  3S2D C;  5E68 A;  1IW7 D;  3A8K A;  2P5M A;  2GAG C;  1JVI A;  2EBB A;  4LR2 A;  4A3D K;  5EGH A;  1TWC K;  4OIQ A;  3K7A C;  2XCR B;  1I3Q K;  4Y7N C;  1F7U A;  5IOT A;  3M4O K;  1T8I A;  4Q5V A;  2D6F C;  2A68 D;  3GEE A;  1EH1 A;  1DCH A;  3S16 C;  4GFQ A;  4A3L K;  3S17 C;  1LPQ A;  4X6A C;  2NVT K;  2JA6 A;  2FQO A;  3TFH A;  4Q4Z A;  2VUM K;  3L4K A;  3CQZ A;  4KMA A;  4GT9 A;  4BBS K;  4P5A A;  5M5Y K;  3OEP A;  3FKI K;  4A3D C;  2RH6 A;  4AYB A;  1YNJ D;  4WIL A;  1J6X A;  5M5W K;  1WOO A;  1VRQ C;  1IE0 A;  4KMD A;  3GTK A;  4QIW D;  1TWC C;  1R9T A;  2NVY C;  3GDZ A;  4A3C C;  3GTG C;  3AQO A;  1SC7 A;  1ZYR D;  3CQZ C;  3PO2 C;  1C0A A;  3GTK K;  3A8J A;  1RRJ A;  4KAR A;  3GTM A;  3GTP C;  2R92 C;  1Y1V A;  4C3I K;  1I50 C;  4Q5G A;  3FKI A;  2W7V A;  2YU9 C;  4WJ3 M;  1WCM C;  1SEU A;  4XSZ A;  1HQM A;  3EQL A;  4LJZ A;  3GEI A;  2WAQ L;  3HKZ D;  4C3J K;  3HOZ C;  4KB4 A;  1RR8 C;  1JQW A;  3RZO C;  5IP9 C;  1TWF A;  1XXC A;  3S15 K;  5IP9 K;  1O24 A;  3S2D K;  4BLB A;  3WVO A;  4JK1 A;  4OIP A;  1WQF A;  1ZYR A;  1A36 A;  1BGW A;  4D3Z A;  1F9N A;  5TMC A;  5C3E K;  1Y1W C;  1TWF K;  1WQH A;  4RMF A;  1IL2 A;  5IOS A;  2JH3 A;  1O2A A;  4FM9 A;  1XZP B;  4IP9 A;  1SFO A;  1WSV A;  4GTD A;  4Q5S A;  1EK8 A;  1YNJ A;  3MAQ A;  2V6S A;  4AH6 A;  3I4M C;  3GTL C;  1VLO A;  1K83 A;  3WOD A;  1XXB A;  1I6V D;  5CHP A;  3M4A A;  2B63 C;  4KAT A;  3GTG A;  1R49 A;  3FOF A;  4AYB L;  3HOV C;  3GTJ A;  4C3J C;  3HOZ K;  1WQG A;  3LF9 A;  5C4J K;  2A68 A;  1EFW A;  2NVQ K;  2O5J D;  4XLP A;  3S14 C;  4FYD A;  5TMF A;  4KDD A;  4X6A K;  5TJ3 A;  3HOY K;  1DCO A;  3M3Y C;  5C44 K;  5IYC K;  4F3E A;  2VUM C;  1HQM D;  2R93 A;  3S15 C;  2JA6 C;  2E2I C;  1Q8I A;  3M4O C;  4ILD A;  3CQZ K;  1I6V A;  1VJE A;  2JA7 A;  1TWA C;  1XZQ B;  3TTG A;  1RU0 A;  5IYB K;  1USO A;  4KMU A;  5CJ9 A;  5C4X K;  5IYB C;  2B9S B;  4A3J C;  4A3F C;  1WOR A;  1G51 A;  3IPJ A;  1IQ0 A;  3K59 A;  1BDF A;  2A6H A;  2NVX C;  4IP8 A;  2A6E A;  3PO3 C;  1TWH A;  4QJV A;  3V4G A;  2CW0 A;  1MIU A;  4QJV B;  2VUM A;  5C3E C;  1L0W A;  4A3L C;  1J98 A;  4GZY A;  3M3Y K;  2R4G A;  4MEX A;  1K4S A;  4LK1 A;  3S17 K;  3NUH A;  4AN8 A;  5EGE A;  3N0B A;  4ZH4 A;  1XZQ A;  2R93 K;  2CFA B;  4C3H C;  1KQ4 A;  1PJ6 A;  3OPF A;  1I3Q A;  1I6H K;  2E2H K;  1ZXO A;  4O26 A;  3H3V L;  4C2M K;  1AB4 A;  3KYL A;  3AQP A;  2R92 K;  2R93 C;  2JA5 K;  1TWH K;  1O29 A;  1O2F B;  4FXD A;  2A69 D;  1R9T K;  3GIR A;  4LK0 A;  3GTQ C;  3H3V D;  2O5J A;  5CQG A;  4LQY A;  4BY7 C;  4KB2 A;  1XZP A;  3GTM K;  2PA8 L;  2PMZ D;  1B4B A;  1Y1W A;  3N3Y A;  2ZUE A;  4KM8 A;  4KC6 A;  3K5O A;  1WOS A;  4NOI A;  5JSB B;  2PA8 D;  4YG2 A;  3GTJ K;  4KN7 A;  3GEH A;  1IBA A;  1Y1W K;  4FZB A;  3DXJ A;  5M5X K;  4M1X A;  2PPB A;  2A6E D;  2Y0S L;  3GTL A;  2CW0 D;  4A3B K;  4EJ3 A;  4O2D A;  1USM A;  4YFN A;  4MEY A;  2A69 A;  3FKI C;  3HOX C;  1SFO C;  1WOP A;  1DCP A;  3ERE D;  3GTM C;  2WAQ A;  2V6U A;  5IYD C;  1BS2 A;  3QX3 A;  4A93 K;  4BY7 K;  4A3K K;  1INN A;  4JLR C;  5FJ8 K;  4C3I C;  4A93 C;  3A8I A; 
#chains in the Genus database with same CATH homology
 2PMZ A;  1T8I A;  4Q5V A;  2A68 D;  3Q3Q A;  1GE9 A;  4DDQ A;  1EH1 A;  4BLA A;  4F3E A;  4OYD B;  3MML B;  1HQM D;  1TGO A;  3K5L A;  4GFQ A;  3AH5 A;  1K4T A;  2R93 A;  2E2I A;  1Q8I A;  1LPQ A;  3N0C A;  4GTB A;  5IOR A;  2JA6 A;  4ILD A;  3GTO A;  3BUE A;  4C2M A;  2YU9 A;  3DU6 A;  1I50 A;  3L4K A;  2JA7 A;  2JA5 A;  3CQZ A;  1A35 A;  1BJT A;  4GT9 A;  4KMA A;  5JVO A;  4P5A A;  4BKW A;  3ORE A;  3LHP S;  4NOK A;  3GTP A;  5CJ9 A;  2ZFZ A;  2B9S B;  4GTF A;  3OEP A;  2Y0S A;  4AYB A;  4L8I A;  2RH6 A;  1YNJ D;  3FHZ A;  3K59 A;  5C9H A;  2NVX A;  4IP8 A;  3LAP A;  1TWH A;  3K5N A;  1B4A A;  1TL8 A;  1O27 A;  3V4G A;  4KMD A;  3K5M A;  3GTK A;  1MIU A;  1YNN D;  1R9T A;  2VUM A;  3VA7 A;  2B63 A;  3CAG A;  2GSU A;  3AQO A;  2E2H A;  5MLC 9;  2F4Q A;  3FOE A;  1SC7 A;  2CFA A;  1ZYR D;  2R4G A;  4NOM A;  1SMY D;  3DU5 A;  1RRJ A;  1K4S A;  2KWA A;  3G4C A;  4KAR A;  3GTM A;  1O2B A;  4H3T A;  4AN8 A;  3NUH A;  5EGE A;  3S0X A;  3N0B A;  3K58 A;  2CFA B;  1Y1V A;  1DD5 A;  3K57 A;  5JSN B;  1KQ4 A;  4C3H C;  3OPF A;  4D3Y A;  1I3Q A;  4Q5G A;  3FKI A;  1ZXO A;  1WCM A;  1ISE A;  1SEU A;  3H0G A;  4O26 A;  3G4A A;  1AB4 A;  1O28 A;  3KYL A;  3AQP A;  4KB4 A;  1RR8 C;  1TWG A;  1O29 A;  2GSO A;  4FXD A;  4P5B A;  1TWF A;  2A69 D;  1XXC A;  1O24 A;  4NOL A;  5CQG A;  4LQY A;  2GSN A;  3WVO A;  4BLB A;  2PHC B;  4KB2 A;  2WB1 A;  1A31 A;  1ZBS A;  1WQF A;  4G0V A;  1TWA A;  1A36 A;  4D3Z A;  1BGW A;  1B4B A;  1F9N A;  1Y1W A;  1WIH A;  2NVY A;  3N3Y A;  1WQH A;  1TWC A;  1V9M A;  5IOS A;  2JH3 A;  1O2A A;  4G0W A;  4KM8 A;  4FM9 A;  4QCL A;  2R92 A;  5JFE A;  3L4J A;  4KC6 A;  4IP9 A;  3K5O A;  1SFO A;  2RGR A;  2A6H D;  2BE5 D;  5JSB B;  2XCO A;  4GTD A;  4KM9 A;  1EK8 A;  4FGU A;  3LAJ A;  3IAY A;  3P9A A;  4FZB A;  1O26 A;  4J3N A;  3MAQ A;  4M1X A;  2A6E D;  4GTE A;  3SJR A;  3GTL A;  2R7Z A;  1Y69 8;  2CW0 D;  4QIW A;  1K83 A;  1ZVU A;  4EJ3 A;  1XXB A;  1O25 A;  1I6V D;  3LPX A;  3M4A A;  1NH3 A;  5CHP A;  4KAT A;  3GTG A;  1R49 A;  4LMO A;  1IS1 A;  3FOF A;  4GTA A;  4C2M C;  4KAW X;  1EJ9 A;  4G0U A;  1XXA A;  3HKZ A;  1IW7 D;  3GTJ A;  4C3J C;  5IOQ A;  4GTC A;  1WQG A;  3LF9 A;  2Y3P A;  3ERE D;  4KMH A;  4KAS A;  4GTL A;  2P5M A;  2WAQ A;  3GTQ A;  2O5J D;  4LR2 A;  4FYD A;  5EGH A;  3QX3 A;  2XCR B;  4AHC A;  2XCQ A;  1R5Z A;  4JLR C;  4C3I C;  4KDD A;  5IOT A;  5TJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...