1WQHA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
b'IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome recycling factor
publication title X-ray structural studies of Mycobacterium Tuberculosis RRF and a comparative study of RRFS of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 58
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqhA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqhA02
4OYDB 3LPXA 4KDDA 1ZVUA 2XCRB 1EH1A 2RGRA 5JSBB 2Y3PA 1WQFA 2PHCB 2KWAA 3LAPA 1EK8A 4G0VA 3LHPS 3MMLB 4KAWX 2ZFZA 1F9NA 3FOFA 3LAJA 3L4JA 1WQGA 2P5MA 3ERED 2XCQA 3FHZA 4G0UA 3OEPA 1XXAA 4KB2A 4J3NA 5CJ9A 4G0WA 3QX3A 4KB4A 1B4AA 1WIHA 4KC6A 1GE9A 4L8IA 1XXBA 2XCOA 3OPFA 1DD5A 1Y698 3CAGA 4FM9A 3OREA 3V4GA 3L4KA 4JLRC 5JSNB 1AB4A 3LF9A 1BGWA 1XXCA 3NUHA 5JVOA 1ISEA 3VA7A 1IS1A 1B4BA 4DDQA 5MLC9 3FOEA 1WQHA 3BUEA 4GFQA 1BJTA
chains in the Genus database with same CATH superfamily
3K5MA 1USOA 5M3FK 2XCRB 5FJ8K 1EQRA 2PHCB 2O5JD 1O29A 4YFKA 4BY7K 4KN4A 3S14C 4A3BK 1WOOA 4P5AA 3HOUC 3ADAC 1IBAA 3BP8C 3I4NK 3AD7C 4FZBA 4AYBD 4A3DK 4KATA 2JA5K 4LMOA 1JOEA 3Q3QA 1LPQA 1DCPA 2RH6A 3HKZA 3AD8C 1O27A 2NVTK 4GTCA 3A8IA 3M3YC 5E68A 4JLRC 1WCMC 3RZOC 2JA8K 4GZYA 5FLMC 1WQHA 3K5OA 1WSVA 1PJ6A 5D4DA 4C3IK 4A3JC 4A3KC 2A68D 3K5LA 3WODA 1ZQ1C 3S1NK 2PA8L 2JA5A 2KWAA 1EK8A 3S15K 2R93C 2R4GA 3GDZA 4NOKA 2XCQA 3HOZC 2R92K 3K58A 4A3EC 3RZDK 1XPPA 2YU9K 1SMYA 1JQWA 1TWCC 5IYCC 4C3HC 2V6TA 4BXXK 3T01A 2GAHC 4NOMA 2WB1A 3GTGK 3WVOA 1TWAK 1J6VA 1AB4A 3CQZK 2A6ED 3FOEA 3GTOC 3BUEA 3HOWC 4KMUA 4OYDB 2BE5D 2V6UA 2R92A 2YU9A 4P9SA 4BKWA 4GTFA 4QIWA 4Q5VA 2JA6C 1MIUA 3GTMC 3GTGA 1TWAA 4PABA 2V6SA 3FKIK 5IP9K 4A93K 3GIRA 3CQZA 3OEPA 3S17C 5TMCA 3S2HC 5M5YK 3S2DK 4GTEA 2CW0A 3S1MC 3GTPK 5JSNB 1O2AA 4OIOA 5IP7C 1YNNA 5C4JC 3FOFA 3L4KA 5TMFA 5MLC9 4C45A 1BJTA 3FKIA 1X31C 3K59A 1VLOA 3EQLA 4KAWX 3H0GK 2NVQK 5IYDC 4G0UA 3GTPA 4QJVB 1K4SA 2W7VA 1TWFC 4GTDA 4KC6A 2WB1L 4XSXA 3H3VL 3S16C 5M5WK 3K7AC 1BGWA 3VA7A 3GTJC 4H3TA 3H0GA 1XZQA 4KMHA 1Y1WC 3LAPA 2PMZA 4QIWL 1EJ9A 4BY1C 1XZPB 3LAJA 3GTLC 5HL8A 3SZYA 1EFWA 1O26A 4P5BA 2E2HC 2A6HD 2B9SB 3GEEA 4KARA 1Q8IA 1B4AA 4BLAA 1ZYRD 1HI9A 4MEXA 1R9TC 4BLBA 1SFOK 1PJ7A 1R5ZA 1VRQC 5IOTA 3PO2C 1UV7A 1BDFA 1Y1VK 5IORA 1I50C 4X6AC 4KN7A 4G0VA 4GTBA 1INNA 1I6HC 4Q5GA 1BS2A 3M3YK 4ILDA 3HOVK 1SFOA 3HKZD 3HOXK 5C4XK 1J98A 4KB2A 2WAQA 5CJ9A 4OIPA 4LK0A 2E2IK 1Y1VA 4WJ3M 3TFHA 3S1RC 4PAAA 5IYBK 1I3QK 4C2MK 2VUMK 2GSUA 4C3JC 4G7OA 4A3FC 1DCHA 3DXJA 2Y0SA 3A8JA 1J6XA 1B4BA 2B63K 4FXDA 3SZZA 2NVYK 4GFQA 5M5XK 2JA7K 4KDDA 2D6FC 1EH1A 4LK1A 4BBRK 2E2IA 4Y7NC 4A3LC 1I3QA 4C2MA 1SMYD 2ZFZA 2VUMA 1TWGK 1SC7A 2GSOA 4GTLA 2WB1D 3N0BA 4NOIA 2B63A 5C3EK 5L46A 3HOYK 3H3VD 2NVYA 4BY7C 4A3BC 1IW7A 3PO3K 2JA7A 4Y52K 4BBSK 3I4NC 4O2DA 4A3DC 4XLNA 2JA5C 1TWGA 4LOWA 1YNJD 5TJ3A 1F7VA 4QIWD 4G7HA 4OINA 3GTOA 4GT9A 1WQFA 3DU6A 3P9AA 2JA8C 1EI6A 3TFIA 3S0XA 4C3IC 1O24A 3S1NC 4O26A 3M4OK 2WAQL 1JVIA 3GTQK 4GTAA 3S15C 4A3IK 3S1QK 2NVXK 3HKZL 1YNND 2ZUFA 3OREA 3G4AA 3GEHA 2R92C 3RZDC 2YU9C 4XCHA 4A3GK 4BXXC 2A6EA 3A8KA 5EGHA 3GTGC 4KM9A 1TWAC 5CQGA 3GTQA 4F3EA 3CQZC 1WORA 2NVXA 2FQTA 3MMLB 3I4MK 3MAQA 3L4JA 4XSZA 3AH5A 1I6VD 3AQPA 3QX3A 3N3YA 1WIHA 4MQ9A 1C0AA 5C44K 3OPFA 1TWHK 3FKIC 5IP9C 4A93C 2E2JK 1IE0A 2GSNA 3SJRA 1ISEA 2R7ZK 2A69A 2CFAA 3S2DC 2PMZD 1XZQB 4AN8A 1TL8A 3GTPC 1K83K 1TWHA 4LR2A 4A3MC 4KMAA 3KYLA 1NH3A 1XXAA 2R7ZA 3T02A 4M1XA 4D3YA 3H0GC 1V9MA 1A31A 5CHPA 2NVQC 1SEUA 2F4QA 4LJZA 1K83A 3N0CA 3S14K 2FQOA 3GTKC 3HOUK 3K57A 1HQMA 1O2BA 3LHPS 2WAQD 3RZOK 1WCMK 1WSRA 5EGEA 5FLMK 4LLGA 2Y0SD 1GE9A 1XXBA 4A3JK 1R49A 4A3KK 4NOLA 4FM9A 4Y7NK 4QCLA 4A3CC 2R93K 1A36A 4OIRA 1TGOA 3HOZK 1WCMA 4A3EK 5JSBB 2JH3A 1TWCK 5IYCK 1SFOC 4C3HK 2PMZL 2P8TA 1Y1VC 1G51A 2O5JA 1IL2A 2P5MA 3ERED 3FHZA 4MEYA 1IW7D 2R93A 4YFNA 1ZBSA 1YCLA 3GTOK 5IOSA 4AYBA 3HOWK 1L0WA 3HOVC 1TWCA 1YX2A 4D3ZA 3M4AA 3V4GA 4Q4ZA 3HOXC 5C4XC 3NUHA 1O2FB 2GAGC 2E2IC 2JA6K 3IPJA 3GTMK 1PJ5A 5IYBC 1I3QC 4C2MC 3LPXA 2NVTC 2VUMC 3IAYA 1RU0A 3S17K 2A68A 3S2HK 2B63C 2NVYC 4KASA 2JA7C 3GSIA 3S1MK 3DU5A 5IP7K 4ZH4A 5C4JK 1F93A 4BBRC 4G0WA 2JA6A 3GTMA 2CW0D 4L8IA 1TWGC 1WOSA 1Y698 1O28A 3CAGA 1VH2A 1ZXOA 3LF9A 2Y0SL 4RMFA 5JVOA 5C3EC 4FYDA 3HOYC 4FGUA 3AQOA 3PO3C 1RRJA 3TFJA 2O5IA 4Y52C 5IYDK 4BBSC 4LQYA 2Y3PA 1YNJA 3K5NA 1F7UA 1TWFK 2BE5A 1T8IA 1O25A 3S16K 3GEIA 1IQ0A 3K7AK 4IP8A 3GTJK 1RR8C 4KMDA 4OIQA 4XLPA 4AYBL 2XCOA 2A69D 5JFEA 2ZUEA 4WJ4A 1Y1WK 4Q5SA 1TWFA 3M4OC 1V5VA 3GTQC 1IS1A 4JK1A 4BY1K 4A3IC 3S1QC 2NVXC 4IP9A 4A3MK 2CFAB 3GTLK 1ZVUA 3AD9C 3GTJA 2E2HK 4YFXA 4G7ZA 4A3GC 1A35A 4QJVA 1WQGA 4EJ3A 1Y1WA 1R9TK 3G4CA 4J3NA 3PO2K 3GTKK 1I6VA 1DCOA 3T00A 3I4MC 3GTLA 2PPBA 5IOQA 1I50K 4X6AK 2E2HA 3TTGA 1I6HK 4DDQA 2PA8D 1HQMD 1K4TA 5C44C 1R9TA 1TWHC 5M3MK 2RGRA 2E2JC 3GTKA 2R7ZC 1XZPA 3S1RK 4WILA 4AH6A 1F9NA 1I50A 4C3JK 5C9HA 3JSTA 4A3FK 4A3CK 1KQ4A 3BP3A 1K83C 4YG2A 4KB4A 1VGXA 2A6HA 1DD5A 1J6WA 1VJEA 2EBBA 1USMA 1XXCA 4KM8A 3HXAA 4A3LK 4AHCA 1ZYRA 1WOPA
chains in the Genus database with same CATH topology
5EGHA 4C2MC 3LPXA 3K5MA 4KM9A 3IAYA 2XCRB 4KMHA 5CQGA 3GTQA 4F3EA 2PMZA 2PHCB 2O5JD 1O29A 3LAPA 2NVXA 1EJ9A 3MMLB 3MAQA 4P5AA 3L4JA 4KASA 3LAJA 3DU5A 3AH5A 1I6VD 4FZBA 1O26A 4P5BA 4KATA 4G0WA 2A6HD 4LMOA 2JA6A 2B9SB 1LPQA 3GTMA 3AQPA 3Q3QA 4KARA 3N3YA 1Q8IA 2CW0D 1B4AA 3HKZA 1WIHA 2RH6A 1O27A 4L8IA 4BLAA 3OPFA 1Y698 1O28A 3CAGA 1ZYRD 4GTCA 1ZXOA 4BLBA 4JLRC 3LF9A 1R5ZA 3SJRA 2GSNA 5IOTA 1ISEA 5JVOA 4FYDA 1WQHA 4FGUA 3K5OA 3AQOA 1RRJA 2CFAA 5IORA 2A68D 4AN8A 3K5LA 1TL8A 4LQYA 2Y3PA 2JA5A 3K5NA 2KWAA 4G0VA 1EK8A 4GTBA 2R4GA 1T8IA 4Q5GA 1TWHA 4NOKA 1O25A 4LR2A 2XCQA 4ILDA 1SFOA 3K58A 4KMAA 3KYLA 1NH3A 4IP8A 4KB2A 2WAQA 2R7ZA 1RR8C 1XXAA 4KMDA 5CJ9A 4C3HC 4M1XA 1Y1VA 4D3YA 4NOMA 2WB1A 1V9MA 1A31A 2XCOA 3WVOA 2GSUA 1SEUA 2A69D 5CHPA 4C3JC 2F4QA 5JFEA 3QX3A 1K83A 1TWFA 2Y0SA 1AB4A 3N0CA 2A6ED 1IS1A 1B4BA 3FOEA 4FXDA 3BUEA 4GFQA 4IP9A 4OYDB 2BE5D 4KDDA 2CFAB 2R92A 1ZVUA 1EH1A 3K57A 2YU9A 3GTJA 2E2IA 1O2BA 4BKWA 3LHPS 4GTFA 4QIWA 4Q5VA 1MIUA 1I3QA 4C2MA 3GTGA 1SMYD 1A35A 1TWAA 2VUMA 2ZFZA 1WQGA 1SC7A 4EJ3A 1Y1WA 2GSOA 4GTLA 3CQZA 3OEPA 5EGEA 3G4CA 4J3NA 3N0BA 2B63A 2NVYA 2JA7A 1GE9A 1XXBA 1R49A 3GTLA 4NOLA 4GTEA 5IOQA 4FM9A 2E2HA 5JSNB 1O2AA 3L4KA 4QCLA 3FOFA 4DDQA 5MLC9 1TWGA 1BJTA 3FKIA 1HQMD 1YNJD 1K4TA 1R9TA 1A36A 1TGOA 5TJ3A 1WCMA 2RGRA 3GTOA 5JSBB 2JH3A 1WQFA 4GT9A 3GTKA 3DU6A 3P9AA 3K59A 4KAWX 3S0XA 1F9NA 4C3IC 1I50A 1O24A 2P5MA 3GTPA 3ERED 3FHZA 5C9HA 4G0UA 1IW7D 1K4SA 4O26A 2R93A 1KQ4A 1ZBSA 4GTAA 4GTDA 4KB4A 4KC6A 4AYBA 5IOSA 1YNND 1DD5A 3OREA 1TWCA 3G4AA 4D3ZA 3M4AA 3V4GA 1BGWA 1XXCA 3NUHA 4KM8A 3VA7A 4H3TA 4AHCA 3H0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYD B;  3LPX A;  4KDD A;  1ZVU A;  2XCR B;  1EH1 A;  2RGR A;  5JSB B;  2Y3P A;  1WQF A;  2PHC B;  2KWA A;  3LAP A;  1EK8 A;  4G0V A;  3LHP S;  3MML B;  4KAW X;  2ZFZ A;  1F9N A;  3FOF A;  3LAJ A;  3L4J A;  1WQG A;  2P5M A;  3ERE D;  2XCQ A;  3FHZ A;  4G0U A;  3OEP A;  1XXA A;  4KB2 A;  4J3N A;  5CJ9 A;  4G0W A;  3QX3 A;  4KB4 A;  1B4A A;  1WIH A;  4KC6 A;  1GE9 A;  4L8I A;  1XXB A;  2XCO A;  3OPF A;  1DD5 A;  1Y69 8;  3CAG A;  4FM9 A;  3ORE A;  3V4G A;  3L4K A;  4JLR C;  5JSN B;  1AB4 A;  3LF9 A;  1BGW A;  1XXC A;  3NUH A;  5JVO A;  1ISE A;  3VA7 A;  1IS1 A;  1B4B A;  4DDQ A;  5MLC 9;  3FOE A;  1WQH A;  3BUE A;  4GFQ A;  1BJT A; 
#chains in the Genus database with same CATH topology
 3K5M A;  1USO A;  5M3F K;  2XCR B;  5FJ8 K;  1EQR A;  2PHC B;  2O5J D;  1O29 A;  4YFK A;  4BY7 K;  4KN4 A;  3S14 C;  4A3B K;  1WOO A;  4P5A A;  3HOU C;  3ADA C;  1IBA A;  3BP8 C;  3I4N K;  3AD7 C;  4FZB A;  4AYB D;  4A3D K;  4KAT A;  2JA5 K;  4LMO A;  1JOE A;  3Q3Q A;  1LPQ A;  1DCP A;  2RH6 A;  3HKZ A;  3AD8 C;  1O27 A;  2NVT K;  4GTC A;  3A8I A;  3M3Y C;  5E68 A;  4JLR C;  1WCM C;  3RZO C;  2JA8 K;  4GZY A;  5FLM C;  1WQH A;  3K5O A;  1WSV A;  1PJ6 A;  5D4D A;  4C3I K;  4A3J C;  4A3K C;  2A68 D;  3K5L A;  3WOD A;  1ZQ1 C;  3S1N K;  2PA8 L;  2JA5 A;  2KWA A;  1EK8 A;  3S15 K;  2R93 C;  2R4G A;  3GDZ A;  4NOK A;  2XCQ A;  3HOZ C;  2R92 K;  3K58 A;  4A3E C;  3RZD K;  1XPP A;  2YU9 K;  1SMY A;  1JQW A;  1TWC C;  5IYC C;  4C3H C;  2V6T A;  4BXX K;  3T01 A;  2GAH C;  4NOM A;  2WB1 A;  3GTG K;  3WVO A;  1TWA K;  1J6V A;  1AB4 A;  3CQZ K;  2A6E D;  3FOE A;  3GTO C;  3BUE A;  3HOW C;  4KMU A;  4OYD B;  2BE5 D;  2V6U A;  2R92 A;  2YU9 A;  4P9S A;  4BKW A;  4GTF A;  4QIW A;  4Q5V A;  2JA6 C;  1MIU A;  3GTM C;  3GTG A;  1TWA A;  4PAB A;  2V6S A;  3FKI K;  5IP9 K;  4A93 K;  3GIR A;  3CQZ A;  3OEP A;  3S17 C;  5TMC A;  3S2H C;  5M5Y K;  3S2D K;  4GTE A;  2CW0 A;  3S1M C;  3GTP K;  5JSN B;  1O2A A;  4OIO A;  5IP7 C;  1YNN A;  5C4J C;  3FOF A;  3L4K A;  5TMF A;  5MLC 9;  4C45 A;  1BJT A;  3FKI A;  1X31 C;  3K59 A;  1VLO A;  3EQL A;  4KAW X;  3H0G K;  2NVQ K;  5IYD C;  4G0U A;  3GTP A;  4QJV B;  1K4S A;  2W7V A;  1TWF C;  4GTD A;  4KC6 A;  2WB1 L;  4XSX A;  3H3V L;  3S16 C;  5M5W K;  3K7A C;  1BGW A;  3VA7 A;  3GTJ C;  4H3T A;  3H0G A;  1XZQ A;  4KMH A;  1Y1W C;  3LAP A;  2PMZ A;  4QIW L;  1EJ9 A;  4BY1 C;  1XZP B;  3LAJ A;  3GTL C;  5HL8 A;  3SZY A;  1EFW A;  1O26 A;  4P5B A;  2E2H C;  2A6H D;  2B9S B;  3GEE A;  4KAR A;  1Q8I A;  1B4A A;  4BLA A;  1ZYR D;  1HI9 A;  4MEX A;  1R9T C;  4BLB A;  1SFO K;  1PJ7 A;  1R5Z A;  1VRQ C;  5IOT A;  3PO2 C;  1UV7 A;  1BDF A;  1Y1V K;  5IOR A;  1I50 C;  4X6A C;  4KN7 A;  4G0V A;  4GTB A;  1INN A;  1I6H C;  4Q5G A;  1BS2 A;  3M3Y K;  4ILD A;  3HOV K;  1SFO A;  3HKZ D;  3HOX K;  5C4X K;  1J98 A;  4KB2 A;  2WAQ A;  5CJ9 A;  4OIP A;  4LK0 A;  2E2I K;  1Y1V A;  4WJ3 M;  3TFH A;  3S1R C;  4PAA A;  5IYB K;  1I3Q K;  4C2M K;  2VUM K;  2GSU A;  4C3J C;  4G7O A;  4A3F C;  1DCH A;  3DXJ A;  2Y0S A;  3A8J A;  1J6X A;  1B4B A;  2B63 K;  4FXD A;  3SZZ A;  2NVY K;  4GFQ A;  5M5X K;  2JA7 K;  4KDD A;  2D6F C;  1EH1 A;  4LK1 A;  4BBR K;  2E2I A;  4Y7N C;  4A3L C;  1I3Q A;  4C2M A;  1SMY D;  2ZFZ A;  2VUM A;  1TWG K;  1SC7 A;  2GSO A;  4GTL A;  2WB1 D;  3N0B A;  4NOI A;  2B63 A;  5C3E K;  5L46 A;  3HOY K;  3H3V D;  2NVY A;  4BY7 C;  4A3B C;  1IW7 A;  3PO3 K;  2JA7 A;  4Y52 K;  4BBS K;  3I4N C;  4O2D A;  4A3D C;  4XLN A;  2JA5 C;  1TWG A;  4LOW A;  1YNJ D;  5TJ3 A;  1F7V A;  4QIW D;  4G7H A;  4OIN A;  3GTO A;  4GT9 A;  1WQF A;  3DU6 A;  3P9A A;  2JA8 C;  1EI6 A;  3TFI A;  3S0X A;  4C3I C;  1O24 A;  3S1N C;  4O26 A;  3M4O K;  2WAQ L;  1JVI A;  3GTQ K;  4GTA A;  3S15 C;  4A3I K;  3S1Q K;  2NVX K;  3HKZ L;  1YNN D;  2ZUF A;  3ORE A;  3G4A A;  3GEH A;  2R92 C;  3RZD C;  2YU9 C;  4XCH A;  4A3G K;  4BXX C;  2A6E A;  3A8K A;  5EGH A;  3GTG C;  4KM9 A;  1TWA C;  5CQG A;  3GTQ A;  4F3E A;  3CQZ C;  1WOR A;  2NVX A;  2FQT A;  3MML B;  3I4M K;  3MAQ A;  3L4J A;  4XSZ A;  3AH5 A;  1I6V D;  3AQP A;  3QX3 A;  3N3Y A;  1WIH A;  4MQ9 A;  1C0A A;  5C44 K;  3OPF A;  1TWH K;  3FKI C;  5IP9 C;  4A93 C;  2E2J K;  1IE0 A;  2GSN A;  3SJR A;  1ISE A;  2R7Z K;  2A69 A;  2CFA A;  3S2D C;  2PMZ D;  1XZQ B;  4AN8 A;  1TL8 A;  3GTP C;  1K83 K;  1TWH A;  4LR2 A;  4A3M C;  4KMA A;  3KYL A;  1NH3 A;  1XXA A;  2R7Z A;  3T02 A;  4M1X A;  4D3Y A;  3H0G C;  1V9M A;  1A31 A;  5CHP A;  2NVQ C;  1SEU A;  2F4Q A;  4LJZ A;  1K83 A;  3N0C A;  3S14 K;  2FQO A;  3GTK C;  3HOU K;  3K57 A;  1HQM A;  1O2B A;  3LHP S;  2WAQ D;  3RZO K;  1WCM K;  1WSR A;  5EGE A;  5FLM K;  4LLG A;  2Y0S D;  1GE9 A;  1XXB A;  4A3J K;  1R49 A;  4A3K K;  4NOL A;  4FM9 A;  4Y7N K;  4QCL A;  4A3C C;  2R93 K;  1A36 A;  4OIR A;  1TGO A;  3HOZ K;  1WCM A;  4A3E K;  5JSB B;  2JH3 A;  1TWC K;  5IYC K;  1SFO C;  4C3H K;  2PMZ L;  2P8T A;  1Y1V C;  1G51 A;  2O5J A;  1IL2 A;  2P5M A;  3ERE D;  3FHZ A;  4MEY A;  1IW7 D;  2R93 A;  4YFN A;  1ZBS A;  1YCL A;  3GTO K;  5IOS A;  4AYB A;  3HOW K;  1L0W A;  3HOV C;  1TWC A;  1YX2 A;  4D3Z A;  3M4A A;  3V4G A;  4Q4Z A;  3HOX C;  5C4X C;  3NUH A;  1O2F B;  2GAG C;  2E2I C;  2JA6 K;  3IPJ A;  3GTM K;  1PJ5 A;  5IYB C;  1I3Q C;  4C2M C;  3LPX A;  2NVT C;  2VUM C;  3IAY A;  1RU0 A;  3S17 K;  2A68 A;  3S2H K;  2B63 C;  2NVY C;  4KAS A;  2JA7 C;  3GSI A;  3S1M K;  3DU5 A;  5IP7 K;  4ZH4 A;  5C4J K;  1F93 A;  4BBR C;  4G0W A;  2JA6 A;  3GTM A;  2CW0 D;  4L8I A;  1TWG C;  1WOS A;  1Y69 8;  1O28 A;  3CAG A;  1VH2 A;  1ZXO A;  3LF9 A;  2Y0S L;  4RMF A;  5JVO A;  5C3E C;  4FYD A;  3HOY C;  4FGU A;  3AQO A;  3PO3 C;  1RRJ A;  3TFJ A;  2O5I A;  4Y52 C;  5IYD K;  4BBS C;  4LQY A;  2Y3P A;  1YNJ A;  3K5N A;  1F7U A;  1TWF K;  2BE5 A;  1T8I A;  1O25 A;  3S16 K;  3GEI A;  1IQ0 A;  3K7A K;  4IP8 A;  3GTJ K;  1RR8 C;  4KMD A;  4OIQ A;  4XLP A;  4AYB L;  2XCO A;  2A69 D;  5JFE A;  2ZUE A;  4WJ4 A;  1Y1W K;  4Q5S A;  1TWF A;  3M4O C;  1V5V A;  3GTQ C;  1IS1 A;  4JK1 A;  4BY1 K;  4A3I C;  3S1Q C;  2NVX C;  4IP9 A;  4A3M K;  2CFA B;  3GTL K;  1ZVU A;  3AD9 C;  3GTJ A;  2E2H K;  4YFX A;  4G7Z A;  4A3G C;  1A35 A;  4QJV A;  1WQG A;  4EJ3 A;  1Y1W A;  1R9T K;  3G4C A;  4J3N A;  3PO2 K;  3GTK K;  1I6V A;  1DCO A;  3T00 A;  3I4M C;  3GTL A;  2PPB A;  5IOQ A;  1I50 K;  4X6A K;  2E2H A;  3TTG A;  1I6H K;  4DDQ A;  2PA8 D;  1HQM D;  1K4T A;  5C44 C;  1R9T A;  1TWH C;  5M3M K;  2RGR A;  2E2J C;  3GTK A;  2R7Z C;  1XZP A;  3S1R K;  4WIL A;  4AH6 A;  1F9N A;  1I50 A;  4C3J K;  5C9H A;  3JST A;  4A3F K;  4A3C K;  1KQ4 A;  3BP3 A;  1K83 C;  4YG2 A;  4KB4 A;  1VGX A;  2A6H A;  1DD5 A;  1J6W A;  1VJE A;  2EBB A;  1USM A;  1XXC A;  4KM8 A;  3HXA A;  4A3L K;  4AHC A;  1ZYR A;  1WOP A; 
#chains in the Genus database with same CATH homology
 5EGH A;  4C2M C;  3LPX A;  3K5M A;  4KM9 A;  3IAY A;  2XCR B;  4KMH A;  5CQG A;  3GTQ A;  4F3E A;  2PMZ A;  2PHC B;  2O5J D;  1O29 A;  3LAP A;  2NVX A;  1EJ9 A;  3MML B;  3MAQ A;  4P5A A;  3L4J A;  4KAS A;  3LAJ A;  3DU5 A;  3AH5 A;  1I6V D;  4FZB A;  1O26 A;  4P5B A;  4KAT A;  4G0W A;  2A6H D;  4LMO A;  2JA6 A;  2B9S B;  1LPQ A;  3GTM A;  3AQP A;  3Q3Q A;  4KAR A;  3N3Y A;  1Q8I A;  2CW0 D;  1B4A A;  3HKZ A;  1WIH A;  2RH6 A;  1O27 A;  4L8I A;  4BLA A;  3OPF A;  1Y69 8;  1O28 A;  3CAG A;  1ZYR D;  4GTC A;  1ZXO A;  4BLB A;  4JLR C;  3LF9 A;  1R5Z A;  3SJR A;  2GSN A;  5IOT A;  1ISE A;  5JVO A;  4FYD A;  1WQH A;  4FGU A;  3K5O A;  3AQO A;  1RRJ A;  2CFA A;  5IOR A;  2A68 D;  4AN8 A;  3K5L A;  1TL8 A;  4LQY A;  2Y3P A;  2JA5 A;  3K5N A;  2KWA A;  4G0V A;  1EK8 A;  4GTB A;  2R4G A;  1T8I A;  4Q5G A;  1TWH A;  4NOK A;  1O25 A;  4LR2 A;  2XCQ A;  4ILD A;  1SFO A;  3K58 A;  4KMA A;  3KYL A;  1NH3 A;  4IP8 A;  4KB2 A;  2WAQ A;  2R7Z A;  1RR8 C;  1XXA A;  4KMD A;  5CJ9 A;  4C3H C;  4M1X A;  1Y1V A;  4D3Y A;  4NOM A;  2WB1 A;  1V9M A;  1A31 A;  2XCO A;  3WVO A;  2GSU A;  1SEU A;  2A69 D;  5CHP A;  4C3J C;  2F4Q A;  5JFE A;  3QX3 A;  1K83 A;  1TWF A;  2Y0S A;  1AB4 A;  3N0C A;  2A6E D;  1IS1 A;  1B4B A;  3FOE A;  4FXD A;  3BUE A;  4GFQ A;  4IP9 A;  4OYD B;  2BE5 D;  4KDD A;  2CFA B;  2R92 A;  1ZVU A;  1EH1 A;  3K57 A;  2YU9 A;  3GTJ A;  2E2I A;  1O2B A;  4BKW A;  3LHP S;  4GTF A;  4QIW A;  4Q5V A;  1MIU A;  1I3Q A;  4C2M A;  3GTG A;  1SMY D;  1A35 A;  1TWA A;  2VUM A;  2ZFZ A;  1WQG A;  1SC7 A;  4EJ3 A;  1Y1W A;  2GSO A;  4GTL A;  3CQZ A;  3OEP A;  5EGE A;  3G4C A;  4J3N A;  3N0B A;  2B63 A;  2NVY A;  2JA7 A;  1GE9 A;  1XXB A;  1R49 A;  3GTL A;  4NOL A;  4GTE A;  5IOQ A;  4FM9 A;  2E2H A;  5JSN B;  1O2A A;  3L4K A;  4QCL A;  3FOF A;  4DDQ A;  5MLC 9;  1TWG A;  1BJT A;  3FKI A;  1HQM D;  1YNJ D;  1K4T A;  1R9T A;  1A36 A;  1TGO A;  5TJ3 A;  1WCM A;  2RGR A;  3GTO A;  5JSB B;  2JH3 A;  1WQF A;  4GT9 A;  3GTK A;  3DU6 A;  3P9A A;  3K59 A;  4KAW X;  3S0X A;  1F9N A;  4C3I C;  1I50 A;  1O24 A;  2P5M A;  3GTP A;  3ERE D;  3FHZ A;  5C9H A;  4G0U A;  1IW7 D;  1K4S A;  4O26 A;  2R93 A;  1KQ4 A;  1ZBS A;  4GTA A;  4GTD A;  4KB4 A;  4KC6 A;  4AYB A;  5IOS A;  1YNN D;  1DD5 A;  3ORE A;  1TWC A;  3G4A A;  4D3Z A;  3M4A A;  3V4G A;  1BGW A;  1XXC A;  3NUH A;  4KM8 A;  3VA7 A;  4H3T A;  4AHC A;  3H0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...