1WQHA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structural studies of Mycobacterium Tuberculosis RRF and a comparative study of RRFS of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome recycling factor
total genus 58
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqhA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqhA02
3MMLB 3LF9A 1B4AA 1ZVUA 4J3NA 2P5MA 2RGRA 3OEPA 3ERED 3VA7A 3NUHA 3L4KA 4KAWX 1WQGA 2PHCB 4KC6A 2ZFZA 3V4GA 4GFQA 3FOFA 3LHPS 1B4BA 2Y3PA 1XXBA 4G0UA 1EK8A 5JSNB 3QX3A 1EH1A 5MLC9 3BUEA 3FOEA 1ISEA 4DDQA 4OYDB 3OPFA 1Y698 1AB4A 1F9NA 4JLRC 3CAGA 3FHZA 2XCRB 4KB2A 3OREA 4G0WA 2XCOA 1IS1A 4KB4A 1WQHA 5JSBB 1WIHA 1XXCA 2XCQA 5CJ9A 5JVOA 1WQFA 2KWAA 3LAPA 3L4JA 4G0VA 3LAJA 1BGWA 1DD5A 3LPXA 1GE9A 1BJTA 1XXAA 4FM9A 4KDDA 4L8IA
chains in the Genus database with same CATH superfamily
3MMLB 1R9TC 4A3GC 1SFOK 1I50C 2Y0SD 5IP7C 4Y7NC 2ZFZA 3GEHA 3S17C 3LHPS 2YU9A 1YNNA 5C4JK 1TWAA 4PAAA 4MEYA 4XSXA 1IS1A 3IAYA 1EI6A 2R93K 2PMZL 4AYBL 3K5LA 3GDZA 1SC7A 4FM9A 3S2DK 4A3LC 4A3MK 3S15C 4EJ3A 3Q3QA 5L46A 3PO3C 3GTMC 1ZVUA 4BBSC 3HOVC 2A69D 1KQ4A 3CQZC 4A3EC 3WODA 1TWGA 1XPPA 4LK0A 3S1MC 3N0CA 1J6VA 1IW7A 1EQRA 4FXDA 1VH2A 1I6VD 3GTKK 1ISEA 4BBRK 4PABA 4C3IK 3GTPA 2JA6K 4BY1K 4D3ZA 4Q4ZA 2E2IC 5C4XK 3HOWK 1JVIA 2WAQD 1VLOA 2BE5A 2PA8L 5JVOA 3AH5A 4Q5GA 4YFNA 1DD5A 5IORA 1F93A 1WIHA 1R9TA 2JA8K 4RMFA 3IPJA 3RZDK 1VRQC 5IOTA 2Y0SL 1TL8A 4MQ9A 2W7VA 1YNJA 1WQGA 1TWFK 4KARA 2PA8D 4XSZA 5IOQA 4A3JC 1I3QC 2WB1A 4Y52K 4QJVA 2Y3PA 3QX3A 5FLMK 5IP9C 3T02A 2JA5C 4P5BA 2PPBA 4KB4A 2VUMA 3GTMK 4BY7K 1USMA 4C3HC 2B9SB 3N0BA 3CQZA 4KASA 3LPXA 2NVYA 3CQZK 1XXAA 5EGHA 3S14K 3GTMA 3N3YA 2RGRA 1DCOA 4QIWA 3GTPC 1DCPA 5M3MK 4C2MC 4O2DA 5CQGA 3AQOA 5IP7K 4GTBA 5C4JC 1Q8IA 4JLRC 2XCRB 4KB2A 1G51A 4ILDA 3GTJA 1ZBSA 5CJ9A 1SMYA 4A3MC 4FYDA 3S15K 1DCHA 2A6ED 1ZQ1C 2NVQC 2B63K 3WVOA 4D3YA 4A3JK 1AB4A 2A68A 3TFJA 5CHPA 2YU9K 5FLMC 1TWHK 4BXXC 1I50A 3A8IA 1PJ6A 1F7VA 4A3IC 1Y1VA 4NOIA 5IOSA 2NVXK 2NVXA 3DXJA 3GSIA 1PJ7A 1YX2A 1I50K 1SFOC 4IP9A 4KMUA 1F7UA 3BP8C 3DU5A 4MEXA 3HOUC 2R92K 4BBRC 3S17K 1SEUA 3DU6A 4NOKA 1K4SA 4BLAA 2WB1L 4KATA 1VGXA 1O26A 1USOA 1HQMD 4A3KC 4AHCA 4XLPA 4LOWA 1VJEA 2V6SA 4BKWA 3G4AA 2PMZD 4AYBD 5IP9K 3H3VD 1B4BA 1YNJD 1EK8A 3PO2C 1TWFC 1R49A 3BUEA 4DDQA 4OYDB 3EQLA 1R9TK 1Y1WK 2F4QA 1INNA 5FJ8K 5IYDK 3I4MC 4X6AK 1XXCA 5JSBB 4YFXA 2KWAA 5C9HA 2GSUA 1ZYRD 4A93C 4KN4A 1GE9A 3S16K 2R92A 4IP8A 1J6WA 3HOWC 1K4TA 3GTPK 2JA6C 4A3FC 3ERED 3SZZA 4OINA 2WB1D 2JA8C 1TWGK 1A31A 4QJVB 3HOXK 1O2AA 4G0UA 4C3JK 2R92C 5TMCA 1TWCC 2E2JK 2FQOA 4G7OA 4KM8A 3I4NC 4YG2A 4WJ4A 3LAPA 2R93A 3K5OA 4LQYA 4GTCA 1YCLA 2R7ZC 3A8KA 5M5YK 3GTOC 1TWAK 1TWCA 1B4AA 5C3EC 4C3IC 3S1NK 3NUHA 4P5AA 2CFAB 4JK1A 4KAWX 3S1RK 2A68D 1ZYRA 3H3VL 4GT9A 1X31C 3AD8C 4OIOA 5TMFA 3HOUK 3K57A 1XZQB 3H0GA 4F3EA 1O27A 4BLBA 1F9NA 3CAGA 5TJ3A 1I6HC 2E2HC 2RH6A 1WQFA 4WJ3M 4LLGA 1SMYD 4Y52C 2VUMK 4NOMA 2NVTC 3PO3K 2P5MA 3HOVK 5JFEA 1YNND 3M4AA 1TGOA 2PHCB 2JH3A 1WSRA 2WAQA 1IL2A 1XXBA 1IW7D 4XLNA 2A6EA 1Y1VC 1EJ9A 3I4MK 4X6AC 1R5ZA 1JQWA 2YU9C 3S14C 1WORA 2B63A 3S16C 1WQHA 1TWAC 2GSNA 1O2FB 4ZH4A 3AD7C 4LMOA 3RZOK 3GTOA 3AD9C 1JOEA 5IYCC 3HKZA 1WCMK 4KC6A 4LR2A 1IBAA 3G4CA 2E2HA 1I3QK 2E2HK 3I4NK 2BE5D 3H0GC 3JSTA 5C44C 3FOEA 4FGUA 1O24A 2Y0SA 3FHZA 4XCHA 2GSOA 3A8JA 3GTGA 3K59A 4GZYA 3PO2K 3GTOK 5IYBC 1LPQA 1TWCK 1I6VA 4A3CC 3GTQC 3S2HC 1BJTA 3S1NC 4A3DK 3S1RC 2PMZA 4AYBA 4QIWL 3GTJK 1EFWA 4BBSK 5IYDC 3M4OK 4P9SA 2R4GA 3VA7A 1HQMA 4H3TA 4AH6A 3SJRA 3GTLC 3FKIK 5JSNB 5MLC9 2CFAA 2A69A 4G7ZA 3HOYK 3GEIA 4G0WA 3GEEA 2O5IA 2NVYC 3ADAC 1K83A 1C0AA 4G0VA 1HI9A 4GTLA 3GTGK 2VUMC 4C3JC 3K5NA 4AN8A 2R7ZA 3RZDC 3MAQA 2E2JC 1IE0A 1Y1WC 3OEPA 4O26A 3K7AK 3H0GK 5C44K 1Y1VK 4YFKA 2R93C 3K58A 1TWHA 2O5JA 1BS2A 4M1XA 4A3LK 2CW0D 5IYBK 3K5MA 4FZBA 4A3FK 4KMAA 2FQTA 1IQ0A 3M3YC 4NOLA 4GTAA 4C45A 3RZOC 3LAJA 1O29A 1WOPA 4GTEA 4KDDA 2E2IA 2V6UA 4QIWD 3SZYA 4A3KK 4LK1A 4GTDA 4BY1C 5M3FK 1I6HK 2P8TA 5IYCK 3P9AA 2CW0A 1O28A 5M5WK 4KN7A 4WILA 1WCMC 1SFOA 3TTGA 1L0WA 2ZUFA 3BP3A 1V9MA 4OIQA 1V5VA 3T00A 1NH3A 1K83C 3HOZC 4A3BK 1T8IA 3L4JA 3S1QK 3GTQK 3S0XA 2NVQK 1ZXOA 1BGWA 1XZPB 1MIUA 3S1MK 2A6HD 4A3GK 1WOOA 1Y1WA 2EBBA 2JA7C 3FKIA 1A36A 4C3HK 1XZQA 5M5XK 1TWFA 4Y7NK 4GFQA 4OIRA 4LJZA 1EH1A 2NVTK 1Y698 3OREA 4C2MA 3S2DC 5HL8A 2D6FC 1BDFA 3HOYC 4OIPA 3GTGC 4KMDA 2JA6A 3GTQA 2NVYK 3TFIA 1RRJA 3KYLA 3LF9A 1RU0A 2JA5K 1PJ5A 1WSVA 4GTFA 3K7AC 5C3EK 3GTKA 1I3QA 3L4KA 2GAHC 3HOZK 3HXAA 1XZPA 1WCMA 2B63C 4A3DC 3HKZD 2JA5A 4BY7C 1UV7A 1J98A 3M3YK 1A35A 1O25A 2E2IK 3GTKC 3S1QC 2WAQL 4A93K 2JA7A 3GTLK 4C2MK 3GTLA 3FKIC 3AQPA 3HKZL 4Q5VA 2JA7K 2V6TA 4L8IA 4J3NA 4G7HA 2A6HA 1RR8C 5E68A 4QCLA 4A3BC 1TWGC 3HOXC 4A3CK 4KM9A 3V4GA 3TFHA 3FOFA 3S2HK 5EGEA 4A3EK 4Q5SA 1J6XA 2ZUEA 3OPFA 3GTJC 3M4OC 3T01A 4KMHA 1WOSA 2XCOA 3GIRA 2XCQA 5D4DA 1O2BA 2R7ZK 2GAGC 4A3IK 2O5JD 1TWHC 4BXXK 2NVXC 1K83K 5C4XC
chains in the Genus database with same CATH topology
3MMLB 4GTDA 5CHPA 2P5MA 5JFEA 1YNND 3M4AA 3P9AA 1TGOA 1O28A 2PHCB 1I50A 2JH3A 2ZFZA 1Y1VA 3LHPS 2WAQA 5IOSA 1XXBA 1IW7D 2NVXA 1SFOA 2YU9A 1EJ9A 1R5ZA 1TWAA 1V9MA 4IP9A 2B63A 3DU5A 1NH3A 1IS1A 1WQHA 1T8IA 2GSNA 3IAYA 3L4JA 1SEUA 3S0XA 3DU6A 3K5LA 4LMOA 4NOKA 1K4SA 1BGWA 1SC7A 1ZXOA 4KATA 4BLAA 3GTOA 1O26A 4FM9A 1MIUA 4EJ3A 3Q3QA 1HQMD 4AHCA 1ZVUA 2A6HD 2A69D 4BKWA 1Y1WA 1KQ4A 3G4AA 3HKZA 3FKIA 1TWGA 4KC6A 1A36A 4LR2A 3N0CA 1TWFA 3G4CA 4GFQA 2E2HA 1B4BA 4FXDA 1YNJD 1EK8A 1EH1A 1I6VD 2BE5D 1R49A 1ISEA 3BUEA 3FOEA 4DDQA 4FGUA 4OYDB 1Y698 1O24A 3GTPA 2F4QA 2Y0SA 4D3ZA 3FHZA 3OREA 4C2MA 2GSOA 3GTGA 3K59A 2E2IA 1XXCA 5JSBB 1LPQA 5JVOA 2KWAA 3AH5A 4Q5GA 5C9HA 2GSUA 1DD5A 1ZYRD 4KMDA 5IORA 1GE9A 1BJTA 2R92A 1WIHA 4IP8A 3GTQA 2JA6A 1R9TA 1RRJA 2PMZA 4AYBA 3KYLA 1K4TA 3LF9A 5IOTA 4GTFA 3ERED 2R4GA 1TL8A 3GTKA 3VA7A 1I3QA 3L4KA 1WQGA 4KARA 4H3TA 5IOQA 1A31A 2WB1A 3SJRA 1O2AA 1WCMA 2Y3PA 4G0UA 5JSNB 2JA5A 3QX3A 5MLC9 2CFAA 1A35A 4P5BA 1O25A 4G0WA 4KM8A 4KB4A 2VUMA 3LAPA 2R93A 3K5OA 4LQYA 4GTCA 1K83A 4C3HC 2B9SB 3N0BA 4G0VA 3CQZA 2JA7A 4GTLA 2NVYA 3LPXA 3GTLA 4KASA 1XXAA 3AQPA 4Q5VA 3K5NA 5EGHA 4C3JC 4AN8A 2R7ZA 4L8IA 3MAQA 1TWCA 1B4AA 3GTMA 3N3YA 4J3NA 4C3IC 2RGRA 3OEPA 4O26A 3NUHA 4P5AA 2CFAB 1RR8C 4KAWX 2A68D 4QIWA 4QCLA 3K58A 4GT9A 4KM9A 3V4GA 3FOFA 4C2MC 1TWHA 4M1XA 5EGEA 2CW0D 5CQGA 3AQOA 4GTBA 3K5MA 3K57A 1Q8IA 3H0GA 4F3EA 1O27A 3OPFA 4FZBA 4BLBA 1F9NA 4JLRC 3CAGA 5TJ3A 4KMAA 2XCRB 4KB2A 4KMHA 4ILDA 2XCOA 3GTJA 1ZBSA 2XCQA 1O2BA 4NOLA 4FYDA 2RH6A 5CJ9A 1WQFA 4GTAA 2A6ED 3LAJA 2O5JD 1SMYD 3WVOA 1O29A 4GTEA 4KDDA 4NOMA 4D3YA 1AB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MML B;  3LF9 A;  1B4A A;  1ZVU A;  4J3N A;  2P5M A;  2RGR A;  3OEP A;  3ERE D;  3VA7 A;  3NUH A;  3L4K A;  4KAW X;  1WQG A;  2PHC B;  4KC6 A;  2ZFZ A;  3V4G A;  4GFQ A;  3FOF A;  3LHP S;  1B4B A;  2Y3P A;  1XXB A;  4G0U A;  1EK8 A;  5JSN B;  3QX3 A;  1EH1 A;  5MLC 9;  3BUE A;  3FOE A;  1ISE A;  4DDQ A;  4OYD B;  3OPF A;  1Y69 8;  1AB4 A;  1F9N A;  4JLR C;  3CAG A;  3FHZ A;  2XCR B;  4KB2 A;  3ORE A;  4G0W A;  2XCO A;  1IS1 A;  4KB4 A;  1WQH A;  5JSB B;  1WIH A;  1XXC A;  2XCQ A;  5CJ9 A;  5JVO A;  1WQF A;  2KWA A;  3LAP A;  3L4J A;  4G0V A;  3LAJ A;  1BGW A;  1DD5 A;  3LPX A;  1GE9 A;  1BJT A;  1XXA A;  4FM9 A;  4KDD A;  4L8I A; 
#chains in the Genus database with same CATH topology
 3MML B;  1R9T C;  4A3G C;  1SFO K;  1I50 C;  2Y0S D;  5IP7 C;  4Y7N C;  2ZFZ A;  3GEH A;  3S17 C;  3LHP S;  2YU9 A;  1YNN A;  5C4J K;  1TWA A;  4PAA A;  4MEY A;  4XSX A;  1IS1 A;  3IAY A;  1EI6 A;  2R93 K;  2PMZ L;  4AYB L;  3K5L A;  3GDZ A;  1SC7 A;  4FM9 A;  3S2D K;  4A3L C;  4A3M K;  3S15 C;  4EJ3 A;  3Q3Q A;  5L46 A;  3PO3 C;  3GTM C;  1ZVU A;  4BBS C;  3HOV C;  2A69 D;  1KQ4 A;  3CQZ C;  4A3E C;  3WOD A;  1TWG A;  1XPP A;  4LK0 A;  3S1M C;  3N0C A;  1J6V A;  1IW7 A;  1EQR A;  4FXD A;  1VH2 A;  1I6V D;  3GTK K;  1ISE A;  4BBR K;  4PAB A;  4C3I K;  3GTP A;  2JA6 K;  4BY1 K;  4D3Z A;  4Q4Z A;  2E2I C;  5C4X K;  3HOW K;  1JVI A;  2WAQ D;  1VLO A;  2BE5 A;  2PA8 L;  5JVO A;  3AH5 A;  4Q5G A;  4YFN A;  1DD5 A;  5IOR A;  1F93 A;  1WIH A;  1R9T A;  2JA8 K;  4RMF A;  3IPJ A;  3RZD K;  1VRQ C;  5IOT A;  2Y0S L;  1TL8 A;  4MQ9 A;  2W7V A;  1YNJ A;  1WQG A;  1TWF K;  4KAR A;  2PA8 D;  4XSZ A;  5IOQ A;  4A3J C;  1I3Q C;  2WB1 A;  4Y52 K;  4QJV A;  2Y3P A;  3QX3 A;  5FLM K;  5IP9 C;  3T02 A;  2JA5 C;  4P5B A;  2PPB A;  4KB4 A;  2VUM A;  3GTM K;  4BY7 K;  1USM A;  4C3H C;  2B9S B;  3N0B A;  3CQZ A;  4KAS A;  3LPX A;  2NVY A;  3CQZ K;  1XXA A;  5EGH A;  3S14 K;  3GTM A;  3N3Y A;  2RGR A;  1DCO A;  4QIW A;  3GTP C;  1DCP A;  5M3M K;  4C2M C;  4O2D A;  5CQG A;  3AQO A;  5IP7 K;  4GTB A;  5C4J C;  1Q8I A;  4JLR C;  2XCR B;  4KB2 A;  1G51 A;  4ILD A;  3GTJ A;  1ZBS A;  5CJ9 A;  1SMY A;  4A3M C;  4FYD A;  3S15 K;  1DCH A;  2A6E D;  1ZQ1 C;  2NVQ C;  2B63 K;  3WVO A;  4D3Y A;  4A3J K;  1AB4 A;  2A68 A;  3TFJ A;  5CHP A;  2YU9 K;  5FLM C;  1TWH K;  4BXX C;  1I50 A;  3A8I A;  1PJ6 A;  1F7V A;  4A3I C;  1Y1V A;  4NOI A;  5IOS A;  2NVX K;  2NVX A;  3DXJ A;  3GSI A;  1PJ7 A;  1YX2 A;  1I50 K;  1SFO C;  4IP9 A;  4KMU A;  1F7U A;  3BP8 C;  3DU5 A;  4MEX A;  3HOU C;  2R92 K;  4BBR C;  3S17 K;  1SEU A;  3DU6 A;  4NOK A;  1K4S A;  4BLA A;  2WB1 L;  4KAT A;  1VGX A;  1O26 A;  1USO A;  1HQM D;  4A3K C;  4AHC A;  4XLP A;  4LOW A;  1VJE A;  2V6S A;  4BKW A;  3G4A A;  2PMZ D;  4AYB D;  5IP9 K;  3H3V D;  1B4B A;  1YNJ D;  1EK8 A;  3PO2 C;  1TWF C;  1R49 A;  3BUE A;  4DDQ A;  4OYD B;  3EQL A;  1R9T K;  1Y1W K;  2F4Q A;  1INN A;  5FJ8 K;  5IYD K;  3I4M C;  4X6A K;  1XXC A;  5JSB B;  4YFX A;  2KWA A;  5C9H A;  2GSU A;  1ZYR D;  4A93 C;  4KN4 A;  1GE9 A;  3S16 K;  2R92 A;  4IP8 A;  1J6W A;  3HOW C;  1K4T A;  3GTP K;  2JA6 C;  4A3F C;  3ERE D;  3SZZ A;  4OIN A;  2WB1 D;  2JA8 C;  1TWG K;  1A31 A;  4QJV B;  3HOX K;  1O2A A;  4G0U A;  4C3J K;  2R92 C;  5TMC A;  1TWC C;  2E2J K;  2FQO A;  4G7O A;  4KM8 A;  3I4N C;  4YG2 A;  4WJ4 A;  3LAP A;  2R93 A;  3K5O A;  4LQY A;  4GTC A;  1YCL A;  2R7Z C;  3A8K A;  5M5Y K;  3GTO C;  1TWA K;  1TWC A;  1B4A A;  5C3E C;  4C3I C;  3S1N K;  3NUH A;  4P5A A;  2CFA B;  4JK1 A;  4KAW X;  3S1R K;  2A68 D;  1ZYR A;  3H3V L;  4GT9 A;  1X31 C;  3AD8 C;  4OIO A;  5TMF A;  3HOU K;  3K57 A;  1XZQ B;  3H0G A;  4F3E A;  1O27 A;  4BLB A;  1F9N A;  3CAG A;  5TJ3 A;  1I6H C;  2E2H C;  2RH6 A;  1WQF A;  4WJ3 M;  4LLG A;  1SMY D;  4Y52 C;  2VUM K;  4NOM A;  2NVT C;  3PO3 K;  2P5M A;  3HOV K;  5JFE A;  1YNN D;  3M4A A;  1TGO A;  2PHC B;  2JH3 A;  1WSR A;  2WAQ A;  1IL2 A;  1XXB A;  1IW7 D;  4XLN A;  2A6E A;  1Y1V C;  1EJ9 A;  3I4M K;  4X6A C;  1R5Z A;  1JQW A;  2YU9 C;  3S14 C;  1WOR A;  2B63 A;  3S16 C;  1WQH A;  1TWA C;  2GSN A;  1O2F B;  4ZH4 A;  3AD7 C;  4LMO A;  3RZO K;  3GTO A;  3AD9 C;  1JOE A;  5IYC C;  3HKZ A;  1WCM K;  4KC6 A;  4LR2 A;  1IBA A;  3G4C A;  2E2H A;  1I3Q K;  2E2H K;  3I4N K;  2BE5 D;  3H0G C;  3JST A;  5C44 C;  3FOE A;  4FGU A;  1O24 A;  2Y0S A;  3FHZ A;  4XCH A;  2GSO A;  3A8J A;  3GTG A;  3K59 A;  4GZY A;  3PO2 K;  3GTO K;  5IYB C;  1LPQ A;  1TWC K;  1I6V A;  4A3C C;  3GTQ C;  3S2H C;  1BJT A;  3S1N C;  4A3D K;  3S1R C;  2PMZ A;  4AYB A;  4QIW L;  3GTJ K;  1EFW A;  4BBS K;  5IYD C;  3M4O K;  4P9S A;  2R4G A;  3VA7 A;  1HQM A;  4H3T A;  4AH6 A;  3SJR A;  3GTL C;  3FKI K;  5JSN B;  5MLC 9;  2CFA A;  2A69 A;  4G7Z A;  3HOY K;  3GEI A;  4G0W A;  3GEE A;  2O5I A;  2NVY C;  3ADA C;  1K83 A;  1C0A A;  4G0V A;  1HI9 A;  4GTL A;  3GTG K;  2VUM C;  4C3J C;  3K5N A;  4AN8 A;  2R7Z A;  3RZD C;  3MAQ A;  2E2J C;  1IE0 A;  1Y1W C;  3OEP A;  4O26 A;  3K7A K;  3H0G K;  5C44 K;  1Y1V K;  4YFK A;  2R93 C;  3K58 A;  1TWH A;  2O5J A;  1BS2 A;  4M1X A;  4A3L K;  2CW0 D;  5IYB K;  3K5M A;  4FZB A;  4A3F K;  4KMA A;  2FQT A;  1IQ0 A;  3M3Y C;  4NOL A;  4GTA A;  4C45 A;  3RZO C;  3LAJ A;  1O29 A;  1WOP A;  4GTE A;  4KDD A;  2E2I A;  2V6U A;  4QIW D;  3SZY A;  4A3K K;  4LK1 A;  4GTD A;  4BY1 C;  5M3F K;  1I6H K;  2P8T A;  5IYC K;  3P9A A;  2CW0 A;  1O28 A;  5M5W K;  4KN7 A;  4WIL A;  1WCM C;  1SFO A;  3TTG A;  1L0W A;  2ZUF A;  3BP3 A;  1V9M A;  4OIQ A;  1V5V A;  3T00 A;  1NH3 A;  1K83 C;  3HOZ C;  4A3B K;  1T8I A;  3L4J A;  3S1Q K;  3GTQ K;  3S0X A;  2NVQ K;  1ZXO A;  1BGW A;  1XZP B;  1MIU A;  3S1M K;  2A6H D;  4A3G K;  1WOO A;  1Y1W A;  2EBB A;  2JA7 C;  3FKI A;  1A36 A;  4C3H K;  1XZQ A;  5M5X K;  1TWF A;  4Y7N K;  4GFQ A;  4OIR A;  4LJZ A;  1EH1 A;  2NVT K;  1Y69 8;  3ORE A;  4C2M A;  3S2D C;  5HL8 A;  2D6F C;  1BDF A;  3HOY C;  4OIP A;  3GTG C;  4KMD A;  2JA6 A;  3GTQ A;  2NVY K;  3TFI A;  1RRJ A;  3KYL A;  3LF9 A;  1RU0 A;  2JA5 K;  1PJ5 A;  1WSV A;  4GTF A;  3K7A C;  5C3E K;  3GTK A;  1I3Q A;  3L4K A;  2GAH C;  3HOZ K;  3HXA A;  1XZP A;  1WCM A;  2B63 C;  4A3D C;  3HKZ D;  2JA5 A;  4BY7 C;  1UV7 A;  1J98 A;  3M3Y K;  1A35 A;  1O25 A;  2E2I K;  3GTK C;  3S1Q C;  2WAQ L;  4A93 K;  2JA7 A;  3GTL K;  4C2M K;  3GTL A;  3FKI C;  3AQP A;  3HKZ L;  4Q5V A;  2JA7 K;  2V6T A;  4L8I A;  4J3N A;  4G7H A;  2A6H A;  1RR8 C;  5E68 A;  4QCL A;  4A3B C;  1TWG C;  3HOX C;  4A3C K;  4KM9 A;  3V4G A;  3TFH A;  3FOF A;  3S2H K;  5EGE A;  4A3E K;  4Q5S A;  1J6X A;  2ZUE A;  3OPF A;  3GTJ C;  3M4O C;  3T01 A;  4KMH A;  1WOS A;  2XCO A;  3GIR A;  2XCQ A;  5D4D A;  1O2B A;  2R7Z K;  2GAG C;  4A3I K;  2O5J D;  1TWH C;  4BXX K;  2NVX C;  1K83 K;  5C4X C; 
#chains in the Genus database with same CATH homology
 3MML B;  4GTD A;  5CHP A;  2P5M A;  5JFE A;  1YNN D;  3M4A A;  3P9A A;  1TGO A;  1O28 A;  2PHC B;  1I50 A;  2JH3 A;  2ZFZ A;  1Y1V A;  3LHP S;  2WAQ A;  5IOS A;  1XXB A;  1IW7 D;  2NVX A;  1SFO A;  2YU9 A;  1EJ9 A;  1R5Z A;  1TWA A;  1V9M A;  4IP9 A;  2B63 A;  3DU5 A;  1NH3 A;  1IS1 A;  1WQH A;  1T8I A;  2GSN A;  3IAY A;  3L4J A;  1SEU A;  3S0X A;  3DU6 A;  3K5L A;  4LMO A;  4NOK A;  1K4S A;  1BGW A;  1SC7 A;  1ZXO A;  4KAT A;  4BLA A;  3GTO A;  1O26 A;  4FM9 A;  1MIU A;  4EJ3 A;  3Q3Q A;  1HQM D;  4AHC A;  1ZVU A;  2A6H D;  2A69 D;  4BKW A;  1Y1W A;  1KQ4 A;  3G4A A;  3HKZ A;  3FKI A;  1TWG A;  4KC6 A;  1A36 A;  4LR2 A;  3N0C A;  1TWF A;  3G4C A;  4GFQ A;  2E2H A;  1B4B A;  4FXD A;  1YNJ D;  1EK8 A;  1EH1 A;  1I6V D;  2BE5 D;  1R49 A;  1ISE A;  3BUE A;  3FOE A;  4DDQ A;  4FGU A;  4OYD B;  1Y69 8;  1O24 A;  3GTP A;  2F4Q A;  2Y0S A;  4D3Z A;  3FHZ A;  3ORE A;  4C2M A;  2GSO A;  3GTG A;  3K59 A;  2E2I A;  1XXC A;  5JSB B;  1LPQ A;  5JVO A;  2KWA A;  3AH5 A;  4Q5G A;  5C9H A;  2GSU A;  1DD5 A;  1ZYR D;  4KMD A;  5IOR A;  1GE9 A;  1BJT A;  2R92 A;  1WIH A;  4IP8 A;  3GTQ A;  2JA6 A;  1R9T A;  1RRJ A;  2PMZ A;  4AYB A;  3KYL A;  1K4T A;  3LF9 A;  5IOT A;  4GTF A;  3ERE D;  2R4G A;  1TL8 A;  3GTK A;  3VA7 A;  1I3Q A;  3L4K A;  1WQG A;  4KAR A;  4H3T A;  5IOQ A;  1A31 A;  2WB1 A;  3SJR A;  1O2A A;  1WCM A;  2Y3P A;  4G0U A;  5JSN B;  2JA5 A;  3QX3 A;  5MLC 9;  2CFA A;  1A35 A;  4P5B A;  1O25 A;  4G0W A;  4KM8 A;  4KB4 A;  2VUM A;  3LAP A;  2R93 A;  3K5O A;  4LQY A;  4GTC A;  1K83 A;  4C3H C;  2B9S B;  3N0B A;  4G0V A;  3CQZ A;  2JA7 A;  4GTL A;  2NVY A;  3LPX A;  3GTL A;  4KAS A;  1XXA A;  3AQP A;  4Q5V A;  3K5N A;  5EGH A;  4C3J C;  4AN8 A;  2R7Z A;  4L8I A;  3MAQ A;  1TWC A;  1B4A A;  3GTM A;  3N3Y A;  4J3N A;  4C3I C;  2RGR A;  3OEP A;  4O26 A;  3NUH A;  4P5A A;  2CFA B;  1RR8 C;  4KAW X;  2A68 D;  4QIW A;  4QCL A;  3K58 A;  4GT9 A;  4KM9 A;  3V4G A;  3FOF A;  4C2M C;  1TWH A;  4M1X A;  5EGE A;  2CW0 D;  5CQG A;  3AQO A;  4GTB A;  3K5M A;  3K57 A;  1Q8I A;  3H0G A;  4F3E A;  1O27 A;  3OPF A;  4FZB A;  4BLB A;  1F9N A;  4JLR C;  3CAG A;  5TJ3 A;  4KMA A;  2XCR B;  4KB2 A;  4KMH A;  4ILD A;  2XCO A;  3GTJ A;  1ZBS A;  2XCQ A;  1O2B A;  4NOL A;  4FYD A;  2RH6 A;  5CJ9 A;  1WQF A;  4GTA A;  2A6E D;  3LAJ A;  2O5J D;  1SMY D;  3WVO A;  1O29 A;  4GTE A;  4KDD A;  4NOM A;  4D3Y A;  1AB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...