1WQHA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome recycling factor
publication title X-ray structural studies of Mycobacterium Tuberculosis RRF and a comparative study of RRFS of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 58
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqhA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqhA02
1WQGA 3OREA 2RGRA 1F9NA 4DDQA 3FOEA 3ERED 4FM9A 1WIHA 1B4AA 3LF9A 5JSBB 3OPFA 1BGWA 3NUHA 2KWAA 3LPXA 1GE9A 1XXBA 2Y3PA 1B4BA 1EK8A 2XCRB 1IS1A 2ZFZA 3BUEA 3MMLB 3VA7A 2XCQA 4J3NA 4KC6A 4JLRC 4OYDB 1ISEA 4GFQA 3LAJA 4G0UA 3LAPA 4KB2A 5MLC9 3L4KA 1WQHA 4G0VA 1DD5A 5JVOA 3L4JA 1BJTA 4KDDA 3LHPS 1XXCA 1ZVUA 2PHCB 2XCOA 1XXAA 1EH1A 3OEPA 3QX3A 1AB4A 3V4GA 4KB4A 5JSNB 3CAGA 4G0WA 4L8IA 1Y698 3FHZA 5CJ9A 2P5MA 4KAWX 3FOFA 1WQFA
chains in the Genus database with same CATH superfamily
3OREA 2R7ZC 2GAGC 1WIHA 4XLNA 1TWHC 3S17C 4M1XA 4LLGA 1TWCK 4A3JK 2E2HK 4J3NA 1SC7A 2A69D 4O26A 1J6VA 4GTCA 2R92C 3HOXC 4KMHA 5IP7K 2JA8K 4FGUA 3SZYA 1USOA 2GSUA 2V6UA 1HQMA 3GTGK 4LR2A 1K4SA 2D6FC 3AD8C 4C3HK 4A3FK 4KAWX 4A3CK 1YX2A 4KMAA 3TFHA 1WOOA 4Y7NK 1WCMA 4BBRK 1TL8A 1TWFK 3LF9A 3M4AA 2JA7C 4KMUA 1SFOA 3GSIA 4P9SA 5IYCC 1YCLA 3GTQC 1EK8A 4A3IK 3GTMC 1TWHK 1INNA 3S14K 1VRQC 5M3FK 5CQGA 4RMFA 3GTOA 1SMYA 2JH3A 3N3YA 5JSNB 4QIWA 3T02A 1EJ9A 2PMZA 2B63K 3H0GC 5JFEA 3SJRA 4LK0A 2CFAB 2ZUFA 5IOQA 3GTPC 1I50C 4P5BA 1F7UA 1L0WA 5C4JC 3G4AA 4A3LC 4GTAA 1K83A 2JA6A 1TWGA 5IYCK 4QJVA 4OIQA 3RZDC 3HOUK 3DXJA 4XCHA 4BLBA 3N0CA 5M5YK 1YNNA 4MEYA 1EFWA 4WJ3M 3QX3A 3GEIA 1TWAA 3HOYK 3HOVC 2NVQC 1O2BA 1A35A 5TMCA 4BY1C 1IW7A 3K5NA 3K59A 3K5MA 3S2HC 5JSBB 4OIOA 4G7HA 1R9TA 5IYDC 1EQRA 3FKIA 1XZPB 3S2DK 2E2JC 3IAYA 4JLRC 1O29A 4GFQA 2VUMA 2E2IK 3RZDK 3AD7C 2Y0SA 2YU9C 3RZOC 2WAQD 4C2MC 3S15C 1Y1WK 4OIRA 3HOVK 5IOSA 3S16K 4GZYA 3AQOA 4BY1K 2CW0A 4LK1A 3GTKC 1BGWA 1MIUA 4WJ4A 4YFKA 1TWCC 4A3JC 2E2HC 2XCRB 2ZFZA 3BUEA 4ILDA 1VH2A 3GTJA 2A6EA 5EGEA 4A3GK 3A8IA 1X31C 5IP7C 2JA8C 2JA5A 1O26A 3S0XA 4A3BC 1USMA 3GTGC 3RZOK 1VGXA 2A68D 4C3HC 3FHZA 4A3CC 4YFNA 4G7OA 4D3YA 2P5MA 4Y7NC 4BBRC 1F9NA 1O27A 4DDQA 3FOEA 3S1MK 4Y52K 5IOTA 2V6TA 3DU6A 4C3JC 4A3IC 3GTKK 1WCMK 4PABA 4GT9A 1YNJD 3MAQA 1SFOK 1JOEA 1KQ4A 2GSOA 3LAPA 3S14C 1I3QC 4OIPA 1WQHA 4A3BK 1DCHA 3CQZA 1WORA 1ZVUA 2A69A 4BXXK 4BKWA 2NVYA 4G0WA 2O5JD 2B63C 4QJVB 1VJEA 2WAQL 3T00A 3GTOK 5EGHA 1ZYRD 3H3VD 1WOSA 3S1RK 2FQOA 4AN8A 2NVXA 4C3JK 3HOUC 5TJ3A 4C3IK 2V6SA 2ZUEA 4A3KK 4IP9A 4EJ3A 1IE0A 3L4KA 1K83K 4MQ9A 2JA6K 1DD5A 1TWGK 1I3QK 3I4MK 1XXCA 3HOYC 2GAHC 3HOZK 2R93A 1BDFA 1TWAK 3A8KA 1Y1VA 1SEUA 1A36A 4A3MC 3S2DC 1B4BA 1XZQB 1O24A 1JVIA 2E2IC 3GTLA 1R9TK 3DU5A 1WSVA 3FKIK 4LQYA 4NOIA 4AH6A 1V5VA 4FYDA 1Y1WC 2XCOA 2JA5C 1TWFA 2VUMK 3AQPA 2R7ZA 3A8JA 4BY7K 4KMDA 4KB4A 1BS2A 1I6HK 4KN4A 3S16C 5L46A 3ADAC 3P9AA 2BE5D 1TWHA 2EBBA 3ERED 4KARA 3I4NK 3LPXA 2R92A 4A3MK 3H3VL 4NOLA 4Q5SA 4Q5GA 4A3GC 3GIRA 1NH3A 1J6XA 4GTEA 4D3ZA 4XSXA 4A3EK 4GTDA 4LMOA 3BP8C 3TFIA 2WB1D 3WVOA 4AYBD 1O2AA 2A6HD 3CAGA 2JA5K 1T8IA 3PO2K 2JA7A 3K5LA 3AH5A 1HI9A 4NOKA 4FZBA 4PAAA 2WAQA 3TTGA 3S1MC 3AD9C 3GTQA 3HKZD 4Y52C 3GTMA 4H3TA 1IBAA 4BBSK 2KWAA 2NVTK 4MEXA 1WCMC 2Y0SD 2Y3PA 3G4CA 3T01A 2XCQA 2GSNA 2CFAA 4KASA 1SFOC 1ISEA 2NVXC 1UV7A 4A93K 1O2FB 1O25A 4YG2A 5M5WK 5FJ8K 5C3EK 5M5XK 3HOWC 1ZXOA 4BXXC 3H0GA 4XLPA 3K58A 1G51A 4A3DK 3GTPA 1I50A 3N0BA 3GTOC 3CQZK 4Q4ZA 1A31A 4FM9A 1IQ0A 1B4AA 2A68A 1V9MA 1ZQ1C 3S1RC 3K7AK 1WOPA 3M3YK 4F3EA 3MMLB 4C3IC 5C4XK 4KC6A 2F4QA 3S1NK 4A3KC 1O28A 5FLMK 3GDZA 1K83C 2JA6C 1TWGC 4AHCA 1I6VD 5MLC9 2NVXK 3I4MC 1YNJA 1BJTA 1XZPA 5D4DA 1R5ZA 3HOWK 1XXAA 3HOZC 4XSZA 3V4GA 2PA8D 2O5IA 4Q5VA 1TWAC 2WB1L 1C0AA 4FXDA 4AYBL 2O5JA 4KM9A 3PO3C 3M4OK 4O2DA 1GE9A 2R93K 1F93A 3HXAA 3EQLA 1IS1A 3HKZL 5C9HA 1ZYRA 1Y1VK 1WSRA 2YU9A 1R9TC 1HQMD 3FKIC 4C2MA 5IP9K 2Y0SL 2VUMC 2PHCB 3LHPS 4NOMA 3OEPA 4GTFA 3GTLK 4BY7C 1I6HC 4BLAA 5CJ9A 4LOWA 3GTKA 1PJ6A 3WODA 1TWCA 2E2HA 2R7ZK 3I4NC 1PJ7A 1JQWA 3S1QC 3PO3K 3SZZA 3S17K 4QCLA 2R4GA 3VA7A 1VLOA 4GTBA 1SMYD 3Q3QA 3GTGA 4ZH4A 4KB2A 4QIWD 2R92K 4A3EC 3HOXK 2PMZD 1K4TA 3GTJC 1EH1A 1J98A 4L8IA 3PO2C 3IPJA 3BP3A 3FOFA 1WQFA 1DCPA 1WQGA 2RGRA 4BBSC 4KM8A 2PA8L 3NUHA 2NVTC 2JA7K 2RH6A 1XXBA 2BE5A 1YNND 1I3QA 3S1QK 3GTQK 5C44C 3GTMK 4A93C 3LAJA 4G0UA 5C3EC 3TFJA 2W7VA 2B63A 3K5OA 3L4JA 1IW7D 4A3DC 4X6AC 3GTJK 1AB4A 2P8TA 3CQZC 1RR8C 4GTLA 4KATA 4OINA 1DCOA 5CHPA 2NVYC 2WB1A 3H0GK 4WILA 4AYBA 3K7AC 4KN7A 1XPPA 2A6HA 3GTPK 1I50K 3JSTA 3M3YC 2PPBA 4C45A 1LPQA 4JK1A 5C4JK 5C4XC 4A3LK 3S1NC 1RRJA 3HKZA 4OYDB 1RU0A 5FLMC 3GEHA 3KYLA 5C44K 4G0VA 1Q8IA 5JVOA 4KDDA 1XZQA 5TMFA 2CW0D 4QIWL 5IYBC 3K57A 4X6AK 1Y698 2NVQK 2PMZL 2B9SB 1J6WA 4LJZA 1F7VA 2FQTA 3M4OC 4P5AA 2A6ED 2NVYK 1ZBSA 3OPFA 3S2HK 2R93C 2E2IA 5HL8A 5IYDK 1Y1VC 1PJ5A 4YFXA 2E2JK 1TGOA 5IORA 5IP9C 3GEEA 1Y1WA 3GTLC 2YU9K 1IL2A 5M3MK 1EI6A 4C2MK 4G7ZA 4A3FC 3S15K 4IP8A 1R49A 5E68A 1I6VA 5IYBK 1TWFC
chains in the Genus database with same CATH topology
3OREA 1TWHA 3AQOA 1TWCA 2E2HA 3ERED 4KARA 1WIHA 1BGWA 1MIUA 3LPXA 2R92A 4M1XA 2XCRB 4QCLA 2R4GA 2ZFZA 3BUEA 4ILDA 3VA7A 4J3NA 4NOLA 4GTBA 4Q5GA 1SC7A 3GTJA 2A69D 1SMYD 4O26A 5EGEA 1NH3A 3GTGA 3Q3QA 4GTCA 4KB2A 4D3ZA 4GTEA 2JA5A 1O26A 3S0XA 4KMHA 1K4TA 4GTDA 4LMOA 4FGUA 2GSUA 3WVOA 1EH1A 1O2AA 2A68D 2A6HD 4LR2A 1K4SA 3CAGA 4L8IA 4C3HC 3FHZA 1T8IA 4D3YA 2P5MA 2JA7A 4KAWX 3FOFA 1WQFA 3K5LA 1WQGA 4NOKA 3AH5A 1F9NA 2WAQA 1O27A 1WCMA 4FZBA 4KMAA 1TL8A 3GTQA 4KM8A 4DDQA 3FOEA 3GTMA 4H3TA 3LF9A 3M4AA 3NUHA 5IOTA 1SFOA 3DU6A 2KWAA 4C3JC 2RH6A 1XXBA 2Y3PA 3G4CA 1EK8A 1YNND 1I3QA 4GT9A 1YNJD 2XCQA 2GSNA 2CFAA 4KASA 3MAQA 1ISEA 3LAJA 4G0UA 3LAPA 1KQ4A 2GSOA 1O25A 1WQHA 2B63A 3K5OA 3L4JA 3CQZA 1IW7D 5CQGA 1ZXOA 3GTOA 3H0GA 1ZVUA 4BKWA 1AB4A 3K58A 2NVYA 2JH3A 5JSNB 3N3YA 4QIWA 2O5JD 3GTPA 1I50A 3N0BA 4G0WA 1EJ9A 2RGRA 4GTLA 1RR8C 2PMZA 4KATA 5JFEA 5CHPA 3SJRA 2CFAB 2WB1A 1A31A 5EGHA 5IOQA 4AYBA 4FM9A 1ZYRD 1B4AA 1V9MA 4P5BA 3G4AA 4GTAA 1LPQA 4AN8A 4F3EA 1K83A 1RRJA 2NVXA 2JA6A 1TWGA 3MMLB 4C3IC 5TJ3A 3HKZA 4KC6A 2F4QA 4OYDB 1O28A 3KYLA 4IP9A 4EJ3A 4AHCA 3N0CA 1I6VD 5MLC9 4BLBA 3L4KA 4G0VA 1DD5A 1Q8IA 5JVOA 1BJTA 4KDDA 1R5ZA 1XXCA 3QX3A 1XXAA 1TWAA 2CW0D 3V4GA 1O2BA 3K57A 1Y698 1A35A 2B9SB 4Q5VA 2R93A 3K5NA 3K59A 4FXDA 3K5MA 1Y1VA 5JSBB 1SEUA 2A6ED 3OPFA 1ZBSA 4KM9A 1R9TA 1A36A 2E2IA 4P5AA 1GE9A 3FKIA 1B4BA 1IS1A 1O24A 5C9HA 3IAYA 4JLRC 2YU9A 1TGOA 1O29A 5IORA 3GTLA 1HQMD 3DU5A 4GFQA 2VUMA 1Y1WA 4C2MA 4LQYA 2Y0SA 2PHCB 3LHPS 4NOMA 4FYDA 3OEPA 2XCOA 4GTFA 1TWFA 4C2MC 3AQPA 2R7ZA 4KMDA 4KB4A 4BLAA 4IP8A 1R49A 5CJ9A 3GTKA 5IOSA 3P9AA 2BE5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQG A;  3ORE A;  2RGR A;  1F9N A;  4DDQ A;  3FOE A;  3ERE D;  4FM9 A;  1WIH A;  1B4A A;  3LF9 A;  5JSB B;  3OPF A;  1BGW A;  3NUH A;  2KWA A;  3LPX A;  1GE9 A;  1XXB A;  2Y3P A;  1B4B A;  1EK8 A;  2XCR B;  1IS1 A;  2ZFZ A;  3BUE A;  3MML B;  3VA7 A;  2XCQ A;  4J3N A;  4KC6 A;  4JLR C;  4OYD B;  1ISE A;  4GFQ A;  3LAJ A;  4G0U A;  3LAP A;  4KB2 A;  5MLC 9;  3L4K A;  1WQH A;  4G0V A;  1DD5 A;  5JVO A;  3L4J A;  1BJT A;  4KDD A;  3LHP S;  1XXC A;  1ZVU A;  2PHC B;  2XCO A;  1XXA A;  1EH1 A;  3OEP A;  3QX3 A;  1AB4 A;  3V4G A;  4KB4 A;  5JSN B;  3CAG A;  4G0W A;  4L8I A;  1Y69 8;  3FHZ A;  5CJ9 A;  2P5M A;  4KAW X;  3FOF A;  1WQF A; 
#chains in the Genus database with same CATH topology
 3ORE A;  2R7Z C;  2GAG C;  1WIH A;  4XLN A;  1TWH C;  3S17 C;  4M1X A;  4LLG A;  1TWC K;  4A3J K;  2E2H K;  4J3N A;  1SC7 A;  2A69 D;  4O26 A;  1J6V A;  4GTC A;  2R92 C;  3HOX C;  4KMH A;  5IP7 K;  2JA8 K;  4FGU A;  3SZY A;  1USO A;  2GSU A;  2V6U A;  1HQM A;  3GTG K;  4LR2 A;  1K4S A;  2D6F C;  3AD8 C;  4C3H K;  4A3F K;  4KAW X;  4A3C K;  1YX2 A;  4KMA A;  3TFH A;  1WOO A;  4Y7N K;  1WCM A;  4BBR K;  1TL8 A;  1TWF K;  3LF9 A;  3M4A A;  2JA7 C;  4KMU A;  1SFO A;  3GSI A;  4P9S A;  5IYC C;  1YCL A;  3GTQ C;  1EK8 A;  4A3I K;  3GTM C;  1TWH K;  1INN A;  3S14 K;  1VRQ C;  5M3F K;  5CQG A;  4RMF A;  3GTO A;  1SMY A;  2JH3 A;  3N3Y A;  5JSN B;  4QIW A;  3T02 A;  1EJ9 A;  2PMZ A;  2B63 K;  3H0G C;  5JFE A;  3SJR A;  4LK0 A;  2CFA B;  2ZUF A;  5IOQ A;  3GTP C;  1I50 C;  4P5B A;  1F7U A;  1L0W A;  5C4J C;  3G4A A;  4A3L C;  4GTA A;  1K83 A;  2JA6 A;  1TWG A;  5IYC K;  4QJV A;  4OIQ A;  3RZD C;  3HOU K;  3DXJ A;  4XCH A;  4BLB A;  3N0C A;  5M5Y K;  1YNN A;  4MEY A;  1EFW A;  4WJ3 M;  3QX3 A;  3GEI A;  1TWA A;  3HOY K;  3HOV C;  2NVQ C;  1O2B A;  1A35 A;  5TMC A;  4BY1 C;  1IW7 A;  3K5N A;  3K59 A;  3K5M A;  3S2H C;  5JSB B;  4OIO A;  4G7H A;  1R9T A;  5IYD C;  1EQR A;  3FKI A;  1XZP B;  3S2D K;  2E2J C;  3IAY A;  4JLR C;  1O29 A;  4GFQ A;  2VUM A;  2E2I K;  3RZD K;  3AD7 C;  2Y0S A;  2YU9 C;  3RZO C;  2WAQ D;  4C2M C;  3S15 C;  1Y1W K;  4OIR A;  3HOV K;  5IOS A;  3S16 K;  4GZY A;  3AQO A;  4BY1 K;  2CW0 A;  4LK1 A;  3GTK C;  1BGW A;  1MIU A;  4WJ4 A;  4YFK A;  1TWC C;  4A3J C;  2E2H C;  2XCR B;  2ZFZ A;  3BUE A;  4ILD A;  1VH2 A;  3GTJ A;  2A6E A;  5EGE A;  4A3G K;  3A8I A;  1X31 C;  5IP7 C;  2JA8 C;  2JA5 A;  1O26 A;  3S0X A;  4A3B C;  1USM A;  3GTG C;  3RZO K;  1VGX A;  2A68 D;  4C3H C;  3FHZ A;  4A3C C;  4YFN A;  4G7O A;  4D3Y A;  2P5M A;  4Y7N C;  4BBR C;  1F9N A;  1O27 A;  4DDQ A;  3FOE A;  3S1M K;  4Y52 K;  5IOT A;  2V6T A;  3DU6 A;  4C3J C;  4A3I C;  3GTK K;  1WCM K;  4PAB A;  4GT9 A;  1YNJ D;  3MAQ A;  1SFO K;  1JOE A;  1KQ4 A;  2GSO A;  3LAP A;  3S14 C;  1I3Q C;  4OIP A;  1WQH A;  4A3B K;  1DCH A;  3CQZ A;  1WOR A;  1ZVU A;  2A69 A;  4BXX K;  4BKW A;  2NVY A;  4G0W A;  2O5J D;  2B63 C;  4QJV B;  1VJE A;  2WAQ L;  3T00 A;  3GTO K;  5EGH A;  1ZYR D;  3H3V D;  1WOS A;  3S1R K;  2FQO A;  4AN8 A;  2NVX A;  4C3J K;  3HOU C;  5TJ3 A;  4C3I K;  2V6S A;  2ZUE A;  4A3K K;  4IP9 A;  4EJ3 A;  1IE0 A;  3L4K A;  1K83 K;  4MQ9 A;  2JA6 K;  1DD5 A;  1TWG K;  1I3Q K;  3I4M K;  1XXC A;  3HOY C;  2GAH C;  3HOZ K;  2R93 A;  1BDF A;  1TWA K;  3A8K A;  1Y1V A;  1SEU A;  1A36 A;  4A3M C;  3S2D C;  1B4B A;  1XZQ B;  1O24 A;  1JVI A;  2E2I C;  3GTL A;  1R9T K;  3DU5 A;  1WSV A;  3FKI K;  4LQY A;  4NOI A;  4AH6 A;  1V5V A;  4FYD A;  1Y1W C;  2XCO A;  2JA5 C;  1TWF A;  2VUM K;  3AQP A;  2R7Z A;  3A8J A;  4BY7 K;  4KMD A;  4KB4 A;  1BS2 A;  1I6H K;  4KN4 A;  3S16 C;  5L46 A;  3ADA C;  3P9A A;  2BE5 D;  1TWH A;  2EBB A;  3ERE D;  4KAR A;  3I4N K;  3LPX A;  2R92 A;  4A3M K;  3H3V L;  4NOL A;  4Q5S A;  4Q5G A;  4A3G C;  3GIR A;  1NH3 A;  1J6X A;  4GTE A;  4D3Z A;  4XSX A;  4A3E K;  4GTD A;  4LMO A;  3BP8 C;  3TFI A;  2WB1 D;  3WVO A;  4AYB D;  1O2A A;  2A6H D;  3CAG A;  2JA5 K;  1T8I A;  3PO2 K;  2JA7 A;  3K5L A;  3AH5 A;  1HI9 A;  4NOK A;  4FZB A;  4PAA A;  2WAQ A;  3TTG A;  3S1M C;  3AD9 C;  3GTQ A;  3HKZ D;  4Y52 C;  3GTM A;  4H3T A;  1IBA A;  4BBS K;  2KWA A;  2NVT K;  4MEX A;  1WCM C;  2Y0S D;  2Y3P A;  3G4C A;  3T01 A;  2XCQ A;  2GSN A;  2CFA A;  4KAS A;  1SFO C;  1ISE A;  2NVX C;  1UV7 A;  4A93 K;  1O2F B;  1O25 A;  4YG2 A;  5M5W K;  5FJ8 K;  5C3E K;  5M5X K;  3HOW C;  1ZXO A;  4BXX C;  3H0G A;  4XLP A;  3K58 A;  1G51 A;  4A3D K;  3GTP A;  1I50 A;  3N0B A;  3GTO C;  3CQZ K;  4Q4Z A;  1A31 A;  4FM9 A;  1IQ0 A;  1B4A A;  2A68 A;  1V9M A;  1ZQ1 C;  3S1R C;  3K7A K;  1WOP A;  3M3Y K;  4F3E A;  3MML B;  4C3I C;  5C4X K;  4KC6 A;  2F4Q A;  3S1N K;  4A3K C;  1O28 A;  5FLM K;  3GDZ A;  1K83 C;  2JA6 C;  1TWG C;  4AHC A;  1I6V D;  5MLC 9;  2NVX K;  3I4M C;  1YNJ A;  1BJT A;  1XZP A;  5D4D A;  1R5Z A;  3HOW K;  1XXA A;  3HOZ C;  4XSZ A;  3V4G A;  2PA8 D;  2O5I A;  4Q5V A;  1TWA C;  2WB1 L;  1C0A A;  4FXD A;  4AYB L;  2O5J A;  4KM9 A;  3PO3 C;  3M4O K;  4O2D A;  1GE9 A;  2R93 K;  1F93 A;  3HXA A;  3EQL A;  1IS1 A;  3HKZ L;  5C9H A;  1ZYR A;  1Y1V K;  1WSR A;  2YU9 A;  1R9T C;  1HQM D;  3FKI C;  4C2M A;  5IP9 K;  2Y0S L;  2VUM C;  2PHC B;  3LHP S;  4NOM A;  3OEP A;  4GTF A;  3GTL K;  4BY7 C;  1I6H C;  4BLA A;  5CJ9 A;  4LOW A;  3GTK A;  1PJ6 A;  3WOD A;  1TWC A;  2E2H A;  2R7Z K;  3I4N C;  1PJ7 A;  1JQW A;  3S1Q C;  3PO3 K;  3SZZ A;  3S17 K;  4QCL A;  2R4G A;  3VA7 A;  1VLO A;  4GTB A;  1SMY D;  3Q3Q A;  3GTG A;  4ZH4 A;  4KB2 A;  4QIW D;  2R92 K;  4A3E C;  3HOX K;  2PMZ D;  1K4T A;  3GTJ C;  1EH1 A;  1J98 A;  4L8I A;  3PO2 C;  3IPJ A;  3BP3 A;  3FOF A;  1WQF A;  1DCP A;  1WQG A;  2RGR A;  4BBS C;  4KM8 A;  2PA8 L;  3NUH A;  2NVT C;  2JA7 K;  2RH6 A;  1XXB A;  2BE5 A;  1YNN D;  1I3Q A;  3S1Q K;  3GTQ K;  5C44 C;  3GTM K;  4A93 C;  3LAJ A;  4G0U A;  5C3E C;  3TFJ A;  2W7V A;  2B63 A;  3K5O A;  3L4J A;  1IW7 D;  4A3D C;  4X6A C;  3GTJ K;  1AB4 A;  2P8T A;  3CQZ C;  1RR8 C;  4GTL A;  4KAT A;  4OIN A;  1DCO A;  5CHP A;  2NVY C;  2WB1 A;  3H0G K;  4WIL A;  4AYB A;  3K7A C;  4KN7 A;  1XPP A;  2A6H A;  3GTP K;  1I50 K;  3JST A;  3M3Y C;  2PPB A;  4C45 A;  1LPQ A;  4JK1 A;  5C4J K;  5C4X C;  4A3L K;  3S1N C;  1RRJ A;  3HKZ A;  4OYD B;  1RU0 A;  5FLM C;  3GEH A;  3KYL A;  5C44 K;  4G0V A;  1Q8I A;  5JVO A;  4KDD A;  1XZQ A;  5TMF A;  2CW0 D;  4QIW L;  5IYB C;  3K57 A;  4X6A K;  1Y69 8;  2NVQ K;  2PMZ L;  2B9S B;  1J6W A;  4LJZ A;  1F7V A;  2FQT A;  3M4O C;  4P5A A;  2A6E D;  2NVY K;  1ZBS A;  3OPF A;  3S2H K;  2R93 C;  2E2I A;  5HL8 A;  5IYD K;  1Y1V C;  1PJ5 A;  4YFX A;  2E2J K;  1TGO A;  5IOR A;  5IP9 C;  3GEE A;  1Y1W A;  3GTL C;  2YU9 K;  1IL2 A;  5M3M K;  1EI6 A;  4C2M K;  4G7Z A;  4A3F C;  3S15 K;  4IP8 A;  1R49 A;  5E68 A;  1I6V A;  5IYB K;  1TWF C; 
#chains in the Genus database with same CATH homology
 3ORE A;  1TWH A;  3AQO A;  1TWC A;  2E2H A;  3ERE D;  4KAR A;  1WIH A;  1BGW A;  1MIU A;  3LPX A;  2R92 A;  4M1X A;  2XCR B;  4QCL A;  2R4G A;  2ZFZ A;  3BUE A;  4ILD A;  3VA7 A;  4J3N A;  4NOL A;  4GTB A;  4Q5G A;  1SC7 A;  3GTJ A;  2A69 D;  1SMY D;  4O26 A;  5EGE A;  1NH3 A;  3GTG A;  3Q3Q A;  4GTC A;  4KB2 A;  4D3Z A;  4GTE A;  2JA5 A;  1O26 A;  3S0X A;  4KMH A;  1K4T A;  4GTD A;  4LMO A;  4FGU A;  2GSU A;  3WVO A;  1EH1 A;  1O2A A;  2A68 D;  2A6H D;  4LR2 A;  1K4S A;  3CAG A;  4L8I A;  4C3H C;  3FHZ A;  1T8I A;  4D3Y A;  2P5M A;  2JA7 A;  4KAW X;  3FOF A;  1WQF A;  3K5L A;  1WQG A;  4NOK A;  3AH5 A;  1F9N A;  2WAQ A;  1O27 A;  1WCM A;  4FZB A;  4KMA A;  1TL8 A;  3GTQ A;  4KM8 A;  4DDQ A;  3FOE A;  3GTM A;  4H3T A;  3LF9 A;  3M4A A;  3NUH A;  5IOT A;  1SFO A;  3DU6 A;  2KWA A;  4C3J C;  2RH6 A;  1XXB A;  2Y3P A;  3G4C A;  1EK8 A;  1YNN D;  1I3Q A;  4GT9 A;  1YNJ D;  2XCQ A;  2GSN A;  2CFA A;  4KAS A;  3MAQ A;  1ISE A;  3LAJ A;  4G0U A;  3LAP A;  1KQ4 A;  2GSO A;  1O25 A;  1WQH A;  2B63 A;  3K5O A;  3L4J A;  3CQZ A;  1IW7 D;  5CQG A;  1ZXO A;  3GTO A;  3H0G A;  1ZVU A;  4BKW A;  1AB4 A;  3K58 A;  2NVY A;  2JH3 A;  5JSN B;  3N3Y A;  4QIW A;  2O5J D;  3GTP A;  1I50 A;  3N0B A;  4G0W A;  1EJ9 A;  2RGR A;  4GTL A;  1RR8 C;  2PMZ A;  4KAT A;  5JFE A;  5CHP A;  3SJR A;  2CFA B;  2WB1 A;  1A31 A;  5EGH A;  5IOQ A;  4AYB A;  4FM9 A;  1ZYR D;  1B4A A;  1V9M A;  4P5B A;  3G4A A;  4GTA A;  1LPQ A;  4AN8 A;  4F3E A;  1K83 A;  1RRJ A;  2NVX A;  2JA6 A;  1TWG A;  3MML B;  4C3I C;  5TJ3 A;  3HKZ A;  4KC6 A;  2F4Q A;  4OYD B;  1O28 A;  3KYL A;  4IP9 A;  4EJ3 A;  4AHC A;  3N0C A;  1I6V D;  5MLC 9;  4BLB A;  3L4K A;  4G0V A;  1DD5 A;  1Q8I A;  5JVO A;  1BJT A;  4KDD A;  1R5Z A;  1XXC A;  3QX3 A;  1XXA A;  1TWA A;  2CW0 D;  3V4G A;  1O2B A;  3K57 A;  1Y69 8;  1A35 A;  2B9S B;  4Q5V A;  2R93 A;  3K5N A;  3K59 A;  4FXD A;  3K5M A;  1Y1V A;  5JSB B;  1SEU A;  2A6E D;  3OPF A;  1ZBS A;  4KM9 A;  1R9T A;  1A36 A;  2E2I A;  4P5A A;  1GE9 A;  3FKI A;  1B4B A;  1IS1 A;  1O24 A;  5C9H A;  3IAY A;  4JLR C;  2YU9 A;  1TGO A;  1O29 A;  5IOR A;  3GTL A;  1HQM D;  3DU5 A;  4GFQ A;  2VUM A;  1Y1W A;  4C2M A;  4LQY A;  2Y0S A;  2PHC B;  3LHP S;  4NOM A;  4FYD A;  3OEP A;  2XCO A;  4GTF A;  1TWF A;  4C2M C;  3AQP A;  2R7Z A;  4KMD A;  4KB4 A;  4BLA A;  4IP8 A;  1R49 A;  5CJ9 A;  3GTK A;  5IOS A;  3P9A A;  2BE5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...