4IP9A

Structure of native human serum amyloid a1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of serum amyloid A-mediated inflammatory amyloidosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Serum amyloid A-1 protein
total genus 41
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00277 SAA Serum amyloid A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.110 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4ip9A00
4IP9A 4IP8A 4Q5GA
chains in the Genus database with same CATH superfamily
4FYDA 3HKZA 4C2MA 1SEUA 3GTJA 4KB4A 2NVYA 3P9AA 1RRJA 4IP8A 1IS1A 4NOKA 4EJ3A 2E2HA 1WCMA 4F3EA 4KC6A 3MAQA 1GE9A 1R49A 1R9TA 1HQMD 4NOMA 1ISEA 2A6ED 1NH3A 1IW7D 1TGOA 3DU5A 1Y1VA 4O26A 3K5LA 3GTKA 2NVXA 4H3TA 1EK8A 1WQFA 2JA5A 1A35A 2R93A 3DU6A 3FKIA 1I50A 1DD5A 2VUMA 5CQGA 2R7ZA 1RR8C 3M4AA 3IAYA 3GTQA 4FXDA 2JA6A 3GTGA 1ZYRD 4KDDA 1YNJD 1TWHA 1T8IA 2R92A 1TWFA 3K58A 4GFQA 5JSNB 4KB2A 1TWCA 2WB1A 1A31A 4NOLA 3K59A 1MIUA 3GTMA 3K57A 1Q8IA 1EJ9A 4IP9A 3K5MA 2PMZA 3CQZA 2JA7A 4Q5VA 1K4TA 1TL8A 1EH1A 1SC7A 1I3QA 1TWAA 2Y0SA 2WAQA 4QIWA 3LF9A 4OYDB 3SJRA 1K83A 3WVOA 1Y698 2B63A 2A69D 3LHPS 2BE5D 1WQGA 4QCLA 1LPQA 4AYBA 2B9SB 2R4GA 5MLC9 3KYLA 1A36A 1WQHA 2A68D 4AN8A 4D3YA 2YU9A 3H0GA 1K4SA 4FGUA 4LMOA 2O5JD 4D3ZA 2E2IA 3GTLA 5C9HA 4L8IA 4AHCA 1YNND 1V9MA 1TWGA 3K5NA 1I6VD 3GTPA 3K5OA 4Q5GA 5JSBB 4JLRC 4KAWX 1R5ZA 1Y1WA 1SMYD 3GTOA 2F4QA 1SFOA 2A6HD 2CW0D
chains in the Genus database with same CATH topology
4FYDA 3HKZA 4C2MA 1SEUA 3GTJA 4KB4A 2NVYA 3P9AA 1RRJA 4IP8A 1IS1A 4NOKA 4EJ3A 2E2HA 1WCMA 4F3EA 4KC6A 3MAQA 1GE9A 1R49A 1R9TA 1HQMD 4NOMA 1ISEA 2A6ED 1NH3A 1IW7D 1TGOA 3DU5A 1Y1VA 4O26A 3K5LA 3GTKA 2NVXA 4H3TA 1EK8A 1WQFA 2JA5A 1A35A 2R93A 3DU6A 3FKIA 1I50A 1DD5A 2VUMA 5CQGA 2R7ZA 1RR8C 3M4AA 3IAYA 3GTQA 4FXDA 2JA6A 3GTGA 1ZYRD 4KDDA 1YNJD 1TWHA 1T8IA 2R92A 1TWFA 3K58A 4GFQA 5JSNB 4KB2A 1TWCA 2WB1A 1A31A 4NOLA 3K59A 1MIUA 3GTMA 3K57A 1Q8IA 1EJ9A 4IP9A 3K5MA 2PMZA 3CQZA 2JA7A 4Q5VA 1K4TA 1TL8A 1EH1A 1SC7A 1I3QA 1TWAA 2Y0SA 2WAQA 4QIWA 3LF9A 4OYDB 3SJRA 1K83A 3WVOA 1Y698 2B63A 2A69D 3LHPS 2BE5D 1WQGA 4QCLA 1LPQA 4AYBA 2B9SB 2R4GA 5MLC9 3KYLA 1A36A 1WQHA 2A68D 4AN8A 4D3YA 2YU9A 3H0GA 1K4SA 4FGUA 4LMOA 2O5JD 4D3ZA 2E2IA 3GTLA 5C9HA 4L8IA 4AHCA 1YNND 1V9MA 1TWGA 3K5NA 1I6VD 3GTPA 3K5OA 4Q5GA 5JSBB 4JLRC 4KAWX 1R5ZA 1Y1WA 1SMYD 3GTOA 2F4QA 1SFOA 2A6HD 2CW0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IP9 A;  4IP8 A;  4Q5G A; 
#chains in the Genus database with same CATH topology
 4FYD A;  3HKZ A;  4C2M A;  1SEU A;  3GTJ A;  4KB4 A;  2NVY A;  3P9A A;  1RRJ A;  4IP8 A;  1IS1 A;  4NOK A;  4EJ3 A;  2E2H A;  1WCM A;  4F3E A;  4KC6 A;  3MAQ A;  1GE9 A;  1R49 A;  1R9T A;  1HQM D;  4NOM A;  1ISE A;  2A6E D;  1NH3 A;  1IW7 D;  1TGO A;  3DU5 A;  1Y1V A;  4O26 A;  3K5L A;  3GTK A;  2NVX A;  4H3T A;  1EK8 A;  1WQF A;  2JA5 A;  1A35 A;  2R93 A;  3DU6 A;  3FKI A;  1I50 A;  1DD5 A;  2VUM A;  5CQG A;  2R7Z A;  1RR8 C;  3M4A A;  3IAY A;  3GTQ A;  4FXD A;  2JA6 A;  3GTG A;  1ZYR D;  4KDD A;  1YNJ D;  1TWH A;  1T8I A;  2R92 A;  1TWF A;  3K58 A;  4GFQ A;  5JSN B;  4KB2 A;  1TWC A;  2WB1 A;  1A31 A;  4NOL A;  3K59 A;  1MIU A;  3GTM A;  3K57 A;  1Q8I A;  1EJ9 A;  4IP9 A;  3K5M A;  2PMZ A;  3CQZ A;  2JA7 A;  4Q5V A;  1K4T A;  1TL8 A;  1EH1 A;  1SC7 A;  1I3Q A;  1TWA A;  2Y0S A;  2WAQ A;  4QIW A;  3LF9 A;  4OYD B;  3SJR A;  1K83 A;  3WVO A;  1Y69 8;  2B63 A;  2A69 D;  3LHP S;  2BE5 D;  1WQG A;  4QCL A;  1LPQ A;  4AYB A;  2B9S B;  2R4G A;  5MLC 9;  3KYL A;  1A36 A;  1WQH A;  2A68 D;  4AN8 A;  4D3Y A;  2YU9 A;  3H0G A;  1K4S A;  4FGU A;  4LMO A;  2O5J D;  4D3Z A;  2E2I A;  3GTL A;  5C9H A;  4L8I A;  4AHC A;  1YNN D;  1V9M A;  1TWG A;  3K5N A;  1I6V D;  3GTP A;  3K5O A;  4Q5G A;  5JSB B;  4JLR C;  4KAW X;  1R5Z A;  1Y1W A;  1SMY D;  3GTO A;  2F4Q A;  1SFO A;  2A6H D;  2CW0 D; 
#chains in the Genus database with same CATH homology
 4FYD A;  3HKZ A;  4C2M A;  1SEU A;  3GTJ A;  4KB4 A;  2NVY A;  3P9A A;  1RRJ A;  4IP8 A;  1IS1 A;  4NOK A;  4EJ3 A;  2E2H A;  1WCM A;  4F3E A;  4KC6 A;  3MAQ A;  1GE9 A;  1R49 A;  1R9T A;  1HQM D;  4NOM A;  1ISE A;  2A6E D;  1NH3 A;  1IW7 D;  1TGO A;  3DU5 A;  1Y1V A;  4O26 A;  3K5L A;  3GTK A;  2NVX A;  4H3T A;  1EK8 A;  1WQF A;  2JA5 A;  1A35 A;  2R93 A;  3DU6 A;  3FKI A;  1I50 A;  1DD5 A;  2VUM A;  5CQG A;  2R7Z A;  1RR8 C;  3M4A A;  3IAY A;  3GTQ A;  4FXD A;  2JA6 A;  3GTG A;  1ZYR D;  4KDD A;  1YNJ D;  1TWH A;  1T8I A;  2R92 A;  1TWF A;  3K58 A;  4GFQ A;  5JSN B;  4KB2 A;  1TWC A;  2WB1 A;  1A31 A;  4NOL A;  3K59 A;  1MIU A;  3GTM A;  3K57 A;  1Q8I A;  1EJ9 A;  4IP9 A;  3K5M A;  2PMZ A;  3CQZ A;  2JA7 A;  4Q5V A;  1K4T A;  1TL8 A;  1EH1 A;  1SC7 A;  1I3Q A;  1TWA A;  2Y0S A;  2WAQ A;  4QIW A;  3LF9 A;  4OYD B;  3SJR A;  1K83 A;  3WVO A;  1Y69 8;  2B63 A;  2A69 D;  3LHP S;  2BE5 D;  1WQG A;  4QCL A;  1LPQ A;  4AYB A;  2B9S B;  2R4G A;  5MLC 9;  3KYL A;  1A36 A;  1WQH A;  2A68 D;  4AN8 A;  4D3Y A;  2YU9 A;  3H0G A;  1K4S A;  4FGU A;  4LMO A;  2O5J D;  4D3Z A;  2E2I A;  3GTL A;  5C9H A;  4L8I A;  4AHC A;  1YNN D;  1V9M A;  1TWG A;  3K5N A;  1I6V D;  3GTP A;  3K5O A;  4Q5G A;  5JSB B;  4JLR C;  4KAW X;  1R5Z A;  1Y1W A;  1SMY D;  3GTO A;  2F4Q A;  1SFO A;  2A6H D;  2CW0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...