4IP9A

Structure of native human serum amyloid a1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serum amyloid A-1 protein
publication title Structural mechanism of serum amyloid A-mediated inflammatory amyloidosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 41
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00277 SAA Serum amyloid A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.110 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4ip9A00
4Q5GA 4IP9A 4IP8A
chains in the Genus database with same CATH superfamily
4F3EA 3H0GA 3LHPS 4EJ3A 1A31A 2F4QA 2JA5A 2E2HA 3GTGA 1K4TA 4LMOA 3DU6A 2NVXA 2Y0SA 1EH1A 4OYDB 3CQZA 4IP9A 3IAYA 2B63A 2R92A 1K83A 1YNJD 3P9AA 1A35A 2B9SB 2WAQA 4H3TA 4GFQA 4IP8A 4Q5VA 3GTKA 2E2IA 1ISEA 4C2MA 5C9HA 1R49A 2R93A 2YU9A 1K4SA 1T8IA 4QCLA 3GTMA 4FGUA 4Q5GA 3M4AA 2R7ZA 4AN8A 1Y1VA 4AYBA 1WQHA 4QIWA 1MIUA 1IW7D 2A6HD 2JA7A 3KYLA 1SC7A 2BE5D 3K58A 3SJRA 1TWAA 3K5MA 1TWGA 1TL8A 1I3QA 1EK8A 3K59A 3DU5A 4KDDA 1A36A 3K5NA 3GTPA 4KB4A 4D3YA 2VUMA 1WQGA 5CQGA 5JSBB 1EJ9A 1HQMD 1RR8C 2A6ED 4O26A 1SFOA 1WQFA 2NVYA 3GTLA 3MAQA 3WVOA 4D3ZA 2JA6A 2A69D 3GTQA 4NOMA 1GE9A 4FXDA 2O5JD 1SMYD 2WB1A 1NH3A 1TWHA 4NOKA 3FKIA 1IS1A 4KC6A 3LF9A 2CW0D 4KB2A 4NOLA 2PMZA 1TWCA 1TWFA 2A68D 1WCMA 3K5LA 3K57A 4FYDA 1R9TA 1I6VD 4JLRC 1SEUA 3K5OA 4L8IA 5JSNB 4AHCA 1ZYRD 2R4GA 3GTOA 1YNND 1TGOA 1Y698 1RRJA 1DD5A 5MLC9 1LPQA 4KAWX 1V9MA 3GTJA 1R5ZA 3HKZA 1I50A 1Q8IA 1Y1WA
chains in the Genus database with same CATH topology
4F3EA 3H0GA 3LHPS 4EJ3A 1A31A 2F4QA 2JA5A 2E2HA 3GTGA 1K4TA 4LMOA 3DU6A 2NVXA 2Y0SA 1EH1A 4OYDB 3CQZA 4IP9A 3IAYA 2B63A 2R92A 1K83A 1YNJD 3P9AA 1A35A 2B9SB 2WAQA 4H3TA 4GFQA 4IP8A 4Q5VA 3GTKA 2E2IA 1ISEA 4C2MA 5C9HA 1R49A 2R93A 2YU9A 1K4SA 1T8IA 4QCLA 3GTMA 4FGUA 4Q5GA 3M4AA 2R7ZA 4AN8A 1Y1VA 4AYBA 1WQHA 4QIWA 1MIUA 1IW7D 2A6HD 2JA7A 3KYLA 1SC7A 2BE5D 3K58A 3SJRA 1TWAA 3K5MA 1TWGA 1TL8A 1I3QA 1EK8A 3K59A 3DU5A 4KDDA 1A36A 3K5NA 3GTPA 4KB4A 4D3YA 2VUMA 1WQGA 5CQGA 5JSBB 1EJ9A 1HQMD 1RR8C 2A6ED 4O26A 1SFOA 1WQFA 2NVYA 3GTLA 3MAQA 3WVOA 4D3ZA 2JA6A 2A69D 3GTQA 4NOMA 1GE9A 4FXDA 2O5JD 1SMYD 2WB1A 1NH3A 1TWHA 4NOKA 3FKIA 1IS1A 4KC6A 3LF9A 2CW0D 4KB2A 4NOLA 2PMZA 1TWCA 1TWFA 2A68D 1WCMA 3K5LA 3K57A 4FYDA 1R9TA 1I6VD 4JLRC 1SEUA 3K5OA 4L8IA 5JSNB 4AHCA 1ZYRD 2R4GA 3GTOA 1YNND 1TGOA 1Y698 1RRJA 1DD5A 5MLC9 1LPQA 4KAWX 1V9MA 3GTJA 1R5ZA 3HKZA 1I50A 1Q8IA 1Y1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5G A;  4IP9 A;  4IP8 A; 
#chains in the Genus database with same CATH topology
 4F3E A;  3H0G A;  3LHP S;  4EJ3 A;  1A31 A;  2F4Q A;  2JA5 A;  2E2H A;  3GTG A;  1K4T A;  4LMO A;  3DU6 A;  2NVX A;  2Y0S A;  1EH1 A;  4OYD B;  3CQZ A;  4IP9 A;  3IAY A;  2B63 A;  2R92 A;  1K83 A;  1YNJ D;  3P9A A;  1A35 A;  2B9S B;  2WAQ A;  4H3T A;  4GFQ A;  4IP8 A;  4Q5V A;  3GTK A;  2E2I A;  1ISE A;  4C2M A;  5C9H A;  1R49 A;  2R93 A;  2YU9 A;  1K4S A;  1T8I A;  4QCL A;  3GTM A;  4FGU A;  4Q5G A;  3M4A A;  2R7Z A;  4AN8 A;  1Y1V A;  4AYB A;  1WQH A;  4QIW A;  1MIU A;  1IW7 D;  2A6H D;  2JA7 A;  3KYL A;  1SC7 A;  2BE5 D;  3K58 A;  3SJR A;  1TWA A;  3K5M A;  1TWG A;  1TL8 A;  1I3Q A;  1EK8 A;  3K59 A;  3DU5 A;  4KDD A;  1A36 A;  3K5N A;  3GTP A;  4KB4 A;  4D3Y A;  2VUM A;  1WQG A;  5CQG A;  5JSB B;  1EJ9 A;  1HQM D;  1RR8 C;  2A6E D;  4O26 A;  1SFO A;  1WQF A;  2NVY A;  3GTL A;  3MAQ A;  3WVO A;  4D3Z A;  2JA6 A;  2A69 D;  3GTQ A;  4NOM A;  1GE9 A;  4FXD A;  2O5J D;  1SMY D;  2WB1 A;  1NH3 A;  1TWH A;  4NOK A;  3FKI A;  1IS1 A;  4KC6 A;  3LF9 A;  2CW0 D;  4KB2 A;  4NOL A;  2PMZ A;  1TWC A;  1TWF A;  2A68 D;  1WCM A;  3K5L A;  3K57 A;  4FYD A;  1R9T A;  1I6V D;  4JLR C;  1SEU A;  3K5O A;  4L8I A;  5JSN B;  4AHC A;  1ZYR D;  2R4G A;  3GTO A;  1YNN D;  1TGO A;  1Y69 8;  1RRJ A;  1DD5 A;  5MLC 9;  1LPQ A;  4KAW X;  1V9M A;  3GTJ A;  1R5Z A;  3HKZ A;  1I50 A;  1Q8I A;  1Y1W A; 
#chains in the Genus database with same CATH homology
 4F3E A;  3H0G A;  3LHP S;  4EJ3 A;  1A31 A;  2F4Q A;  2JA5 A;  2E2H A;  3GTG A;  1K4T A;  4LMO A;  3DU6 A;  2NVX A;  2Y0S A;  1EH1 A;  4OYD B;  3CQZ A;  4IP9 A;  3IAY A;  2B63 A;  2R92 A;  1K83 A;  1YNJ D;  3P9A A;  1A35 A;  2B9S B;  2WAQ A;  4H3T A;  4GFQ A;  4IP8 A;  4Q5V A;  3GTK A;  2E2I A;  1ISE A;  4C2M A;  5C9H A;  1R49 A;  2R93 A;  2YU9 A;  1K4S A;  1T8I A;  4QCL A;  3GTM A;  4FGU A;  4Q5G A;  3M4A A;  2R7Z A;  4AN8 A;  1Y1V A;  4AYB A;  1WQH A;  4QIW A;  1MIU A;  1IW7 D;  2A6H D;  2JA7 A;  3KYL A;  1SC7 A;  2BE5 D;  3K58 A;  3SJR A;  1TWA A;  3K5M A;  1TWG A;  1TL8 A;  1I3Q A;  1EK8 A;  3K59 A;  3DU5 A;  4KDD A;  1A36 A;  3K5N A;  3GTP A;  4KB4 A;  4D3Y A;  2VUM A;  1WQG A;  5CQG A;  5JSB B;  1EJ9 A;  1HQM D;  1RR8 C;  2A6E D;  4O26 A;  1SFO A;  1WQF A;  2NVY A;  3GTL A;  3MAQ A;  3WVO A;  4D3Z A;  2JA6 A;  2A69 D;  3GTQ A;  4NOM A;  1GE9 A;  4FXD A;  2O5J D;  1SMY D;  2WB1 A;  1NH3 A;  1TWH A;  4NOK A;  3FKI A;  1IS1 A;  4KC6 A;  3LF9 A;  2CW0 D;  4KB2 A;  4NOL A;  2PMZ A;  1TWC A;  1TWF A;  2A68 D;  1WCM A;  3K5L A;  3K57 A;  4FYD A;  1R9T A;  1I6V D;  4JLR C;  1SEU A;  3K5O A;  4L8I A;  5JSN B;  4AHC A;  1ZYR D;  2R4G A;  3GTO A;  1YNN D;  1TGO A;  1Y69 8;  1RRJ A;  1DD5 A;  5MLC 9;  1LPQ A;  4KAW X;  1V9M A;  3GTJ A;  1R5Z A;  3HKZ A;  1I50 A;  1Q8I A;  1Y1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...