4IP9A

Structure of native human serum amyloid a1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
b'RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serum amyloid A-1 protein
publication title Structural mechanism of serum amyloid A-mediated inflammatory amyloidosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 41
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00277 SAA Serum amyloid A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.110 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4ip9A00
4Q5GA 4IP8A 4IP9A
chains in the Genus database with same CATH superfamily
2NVXA 3LHPS 4AYBA 1RR8C 1R49A 2R4GA 3FKIA 3DU5A 3K5MA 2JA5A 3DU6A 4KB2A 5JSNB 4FYDA 1DD5A 1EK8A 4D3YA 1I3QA 1HQMD 3LF9A 1T8IA 3GTQA 3HKZA 2E2IA 1WQFA 1ISEA 1TWFA 1WQHA 5MLC9 4F3EA 3GTGA 1Y698 3K5OA 3K58A 5C9HA 2F4QA 1V9MA 3K57A 1K83A 4EJ3A 1SMYD 2B9SB 1LPQA 1SEUA 1TL8A 3GTJA 2WB1A 1A31A 1WCMA 3SJRA 4C2MA 3GTLA 1I50A 2A69D 2E2HA 1A36A 3M4AA 4GFQA 1YNJD 1EH1A 3CQZA 2R93A 1EJ9A 1SFOA 2VUMA 3K5LA 4IP8A 1TWAA 1TWCA 3GTOA 1K4SA 4OYDB 4NOMA 1SC7A 4NOKA 4Q5GA 4NOLA 2CW0D 2O5JD 1IW7D 2NVYA 3KYLA 4IP9A 1RRJA 4QCLA 2Y0SA 4L8IA 2PMZA 1Q8IA 1I6VD 3K59A 1TGOA 3GTPA 4AHCA 4O26A 4KDDA 2A6HD 2JA6A 1Y1WA 2JA7A 1TWHA 1GE9A 1R5ZA 3IAYA 1Y1VA 4KB4A 4FGUA 1MIUA 1ZYRD 2WAQA 4LMOA 1NH3A 4FXDA 4KAWX 1IS1A 1A35A 1YNND 3GTKA 2A6ED 4D3ZA 4QIWA 4H3TA 1K4TA 2R7ZA 3GTMA 2A68D 1TWGA 2R92A 2B63A 2BE5D 3H0GA 3WVOA 5JSBB 1WQGA 4JLRC 3K5NA 4AN8A 5CQGA 4Q5VA 4KC6A 3MAQA 2YU9A 1R9TA 3P9AA
chains in the Genus database with same CATH topology
2NVXA 3LHPS 4AYBA 1RR8C 1R49A 2R4GA 3FKIA 3DU5A 3K5MA 2JA5A 3DU6A 4KB2A 5JSNB 4FYDA 1DD5A 1EK8A 4D3YA 1I3QA 1HQMD 3LF9A 1T8IA 3GTQA 3HKZA 2E2IA 1WQFA 1ISEA 1TWFA 1WQHA 5MLC9 4F3EA 3GTGA 1Y698 3K5OA 3K58A 5C9HA 2F4QA 1V9MA 3K57A 1K83A 4EJ3A 1SMYD 2B9SB 1LPQA 1SEUA 1TL8A 3GTJA 2WB1A 1A31A 1WCMA 3SJRA 4C2MA 3GTLA 1I50A 2A69D 2E2HA 1A36A 3M4AA 4GFQA 1YNJD 1EH1A 3CQZA 2R93A 1EJ9A 1SFOA 2VUMA 3K5LA 4IP8A 1TWAA 1TWCA 3GTOA 1K4SA 4OYDB 4NOMA 1SC7A 4NOKA 4Q5GA 4NOLA 2CW0D 2O5JD 1IW7D 2NVYA 3KYLA 4IP9A 1RRJA 4QCLA 2Y0SA 4L8IA 2PMZA 1Q8IA 1I6VD 3K59A 1TGOA 3GTPA 4AHCA 4O26A 4KDDA 2A6HD 2JA6A 1Y1WA 2JA7A 1TWHA 1GE9A 1R5ZA 3IAYA 1Y1VA 4KB4A 4FGUA 1MIUA 1ZYRD 2WAQA 4LMOA 1NH3A 4FXDA 4KAWX 1IS1A 1A35A 1YNND 3GTKA 2A6ED 4D3ZA 4QIWA 4H3TA 1K4TA 2R7ZA 3GTMA 2A68D 1TWGA 2R92A 2B63A 2BE5D 3H0GA 3WVOA 5JSBB 1WQGA 4JLRC 3K5NA 4AN8A 5CQGA 4Q5VA 4KC6A 3MAQA 2YU9A 1R9TA 3P9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5G A;  4IP8 A;  4IP9 A; 
#chains in the Genus database with same CATH topology
 2NVX A;  3LHP S;  4AYB A;  1RR8 C;  1R49 A;  2R4G A;  3FKI A;  3DU5 A;  3K5M A;  2JA5 A;  3DU6 A;  4KB2 A;  5JSN B;  4FYD A;  1DD5 A;  1EK8 A;  4D3Y A;  1I3Q A;  1HQM D;  3LF9 A;  1T8I A;  3GTQ A;  3HKZ A;  2E2I A;  1WQF A;  1ISE A;  1TWF A;  1WQH A;  5MLC 9;  4F3E A;  3GTG A;  1Y69 8;  3K5O A;  3K58 A;  5C9H A;  2F4Q A;  1V9M A;  3K57 A;  1K83 A;  4EJ3 A;  1SMY D;  2B9S B;  1LPQ A;  1SEU A;  1TL8 A;  3GTJ A;  2WB1 A;  1A31 A;  1WCM A;  3SJR A;  4C2M A;  3GTL A;  1I50 A;  2A69 D;  2E2H A;  1A36 A;  3M4A A;  4GFQ A;  1YNJ D;  1EH1 A;  3CQZ A;  2R93 A;  1EJ9 A;  1SFO A;  2VUM A;  3K5L A;  4IP8 A;  1TWA A;  1TWC A;  3GTO A;  1K4S A;  4OYD B;  4NOM A;  1SC7 A;  4NOK A;  4Q5G A;  4NOL A;  2CW0 D;  2O5J D;  1IW7 D;  2NVY A;  3KYL A;  4IP9 A;  1RRJ A;  4QCL A;  2Y0S A;  4L8I A;  2PMZ A;  1Q8I A;  1I6V D;  3K59 A;  1TGO A;  3GTP A;  4AHC A;  4O26 A;  4KDD A;  2A6H D;  2JA6 A;  1Y1W A;  2JA7 A;  1TWH A;  1GE9 A;  1R5Z A;  3IAY A;  1Y1V A;  4KB4 A;  4FGU A;  1MIU A;  1ZYR D;  2WAQ A;  4LMO A;  1NH3 A;  4FXD A;  4KAW X;  1IS1 A;  1A35 A;  1YNN D;  3GTK A;  2A6E D;  4D3Z A;  4QIW A;  4H3T A;  1K4T A;  2R7Z A;  3GTM A;  2A68 D;  1TWG A;  2R92 A;  2B63 A;  2BE5 D;  3H0G A;  3WVO A;  5JSB B;  1WQG A;  4JLR C;  3K5N A;  4AN8 A;  5CQG A;  4Q5V A;  4KC6 A;  3MAQ A;  2YU9 A;  1R9T A;  3P9A A; 
#chains in the Genus database with same CATH homology
 2NVX A;  3LHP S;  4AYB A;  1RR8 C;  1R49 A;  2R4G A;  3FKI A;  3DU5 A;  3K5M A;  2JA5 A;  3DU6 A;  4KB2 A;  5JSN B;  4FYD A;  1DD5 A;  1EK8 A;  4D3Y A;  1I3Q A;  1HQM D;  3LF9 A;  1T8I A;  3GTQ A;  3HKZ A;  2E2I A;  1WQF A;  1ISE A;  1TWF A;  1WQH A;  5MLC 9;  4F3E A;  3GTG A;  1Y69 8;  3K5O A;  3K58 A;  5C9H A;  2F4Q A;  1V9M A;  3K57 A;  1K83 A;  4EJ3 A;  1SMY D;  2B9S B;  1LPQ A;  1SEU A;  1TL8 A;  3GTJ A;  2WB1 A;  1A31 A;  1WCM A;  3SJR A;  4C2M A;  3GTL A;  1I50 A;  2A69 D;  2E2H A;  1A36 A;  3M4A A;  4GFQ A;  1YNJ D;  1EH1 A;  3CQZ A;  2R93 A;  1EJ9 A;  1SFO A;  2VUM A;  3K5L A;  4IP8 A;  1TWA A;  1TWC A;  3GTO A;  1K4S A;  4OYD B;  4NOM A;  1SC7 A;  4NOK A;  4Q5G A;  4NOL A;  2CW0 D;  2O5J D;  1IW7 D;  2NVY A;  3KYL A;  4IP9 A;  1RRJ A;  4QCL A;  2Y0S A;  4L8I A;  2PMZ A;  1Q8I A;  1I6V D;  3K59 A;  1TGO A;  3GTP A;  4AHC A;  4O26 A;  4KDD A;  2A6H D;  2JA6 A;  1Y1W A;  2JA7 A;  1TWH A;  1GE9 A;  1R5Z A;  3IAY A;  1Y1V A;  4KB4 A;  4FGU A;  1MIU A;  1ZYR D;  2WAQ A;  4LMO A;  1NH3 A;  4FXD A;  4KAW X;  1IS1 A;  1A35 A;  1YNN D;  3GTK A;  2A6E D;  4D3Z A;  4QIW A;  4H3T A;  1K4T A;  2R7Z A;  3GTM A;  2A68 D;  1TWG A;  2R92 A;  2B63 A;  2BE5 D;  3H0G A;  3WVO A;  5JSB B;  1WQG A;  4JLR C;  3K5N A;  4AN8 A;  5CQG A;  4Q5V A;  4KC6 A;  3MAQ A;  2YU9 A;  1R9T A;  3P9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...