4O26A

Crystal structure of the trbd domain of tert and the cr4/5 of tr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
257
structure length
240
Chain Sequence
b'GSGFLYGGRGMHGFCLNRKRRTAAGPRRLQGQDLVRLVFFEGLKPKKLPLRYFNMVPVFGRLLQRHRKCRYSSVLHRMCPVVELSRAAQGELSSLIPQHCAPHRVYLFVRECLTAVVPEELWGSDHNRLQFFSRVRGFLKSGSVAELMWKIKVMDCDWLKLRRTAGRFPPSELAYRTRILSQFLTWLLDGFVVGLVRACFYATESNAIRFYRQEVWSKLQDLAFRRHIAKGEMEELSPAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase reverse transcriptase
molecule tags Rna binding protein/rna
source organism Oryzias latipes
publication title Structural basis for protein-RNA recognition in telomerase.
pubmed doi rcsb
total genus 76
structure length 240
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.70 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4o26A00
3DU6A 4O26A 3DU5A 5CQGA 5C9HA 3KYLA 2R4GA 4LMOA
chains in the Genus database with same CATH superfamily
4H3TA 3H0GA 2A68D 1SFOA 4KB4A 2JA5A 3GTQA 1TWGA 3IAYA 2WAQA 2R7ZA 1A35A 1EK8A 1SMYD 3K5MA 4KDDA 1I3QA 1IW7D 1TWAA 4OYDB 1MIUA 4FGUA 3GTPA 4Q5VA 1DD5A 4QCLA 2NVXA 2E2IA 2B63A 1EH1A 2CW0D 2VUMA 2BE5D 2WB1A 3MAQA 2B9SB 4LMOA 4D3YA 4NOKA 2E2HA 3K57A 1K4SA 4O26A 1SC7A 5JSNB 4IP9A 1I6VD 1Q8IA 1GE9A 4AN8A 1ISEA 2YU9A 4JLRC 3SJRA 1LPQA 3K5OA 4L8IA 1WQHA 3GTOA 2JA6A 4NOMA 3K5LA 4KB2A 3CQZA 3K58A 1NH3A 2A6ED 4FYDA 2A6HD 5CQGA 3GTLA 2R92A 1HQMD 4KAWX 1WQGA 1RRJA 1TWCA 4QIWA 1YNJD 1WQFA 3DU6A 4Q5GA 4KC6A 1K83A 4EJ3A 3GTJA 1R49A 2PMZA 1TWHA 5MLC9 3FKIA 3K59A 1V9MA 1IS1A 3HKZA 3LHPS 4IP8A 3K5NA 3M4AA 2F4QA 2JA7A 4F3EA 1R5ZA 1WCMA 1TL8A 1T8IA 1Y1WA 1Y1VA 1RR8C 2R93A 1ZYRD 1SEUA 5C9HA 1TGOA 3KYLA 3GTKA 2A69D 2NVYA 3LF9A 3P9AA 4C2MA 5JSBB 1A36A 4FXDA 4GFQA 2R4GA 3WVOA 2Y0SA 1TWFA 4D3ZA 2O5JD 3GTGA 3DU5A 1YNND 3GTMA 4AHCA 1EJ9A 1R9TA 1A31A 1I50A 1Y698 4AYBA 4NOLA 1K4TA
chains in the Genus database with same CATH topology
4H3TA 3H0GA 2A68D 1SFOA 4KB4A 2JA5A 3GTQA 1TWGA 3IAYA 2WAQA 2R7ZA 1A35A 1EK8A 1SMYD 3K5MA 4KDDA 1I3QA 1IW7D 1TWAA 4OYDB 1MIUA 4FGUA 3GTPA 4Q5VA 1DD5A 4QCLA 2NVXA 2E2IA 2B63A 1EH1A 2CW0D 2VUMA 2BE5D 2WB1A 3MAQA 2B9SB 4LMOA 4D3YA 4NOKA 2E2HA 3K57A 1K4SA 4O26A 1SC7A 5JSNB 4IP9A 1I6VD 1Q8IA 1GE9A 4AN8A 1ISEA 2YU9A 4JLRC 3SJRA 1LPQA 3K5OA 4L8IA 1WQHA 3GTOA 2JA6A 4NOMA 3K5LA 4KB2A 3CQZA 3K58A 1NH3A 2A6ED 4FYDA 2A6HD 5CQGA 3GTLA 2R92A 1HQMD 4KAWX 1WQGA 1RRJA 1TWCA 4QIWA 1YNJD 1WQFA 3DU6A 4Q5GA 4KC6A 1K83A 4EJ3A 3GTJA 1R49A 2PMZA 1TWHA 5MLC9 3FKIA 3K59A 1V9MA 1IS1A 3HKZA 3LHPS 4IP8A 3K5NA 3M4AA 2F4QA 2JA7A 4F3EA 1R5ZA 1WCMA 1TL8A 1T8IA 1Y1WA 1Y1VA 1RR8C 2R93A 1ZYRD 1SEUA 5C9HA 1TGOA 3KYLA 3GTKA 2A69D 2NVYA 3LF9A 3P9AA 4C2MA 5JSBB 1A36A 4FXDA 4GFQA 2R4GA 3WVOA 2Y0SA 1TWFA 4D3ZA 2O5JD 3GTGA 3DU5A 1YNND 3GTMA 4AHCA 1EJ9A 1R9TA 1A31A 1I50A 1Y698 4AYBA 4NOLA 1K4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DU6 A;  4O26 A;  3DU5 A;  5CQG A;  5C9H A;  3KYL A;  2R4G A;  4LMO A; 
#chains in the Genus database with same CATH topology
 4H3T A;  3H0G A;  2A68 D;  1SFO A;  4KB4 A;  2JA5 A;  3GTQ A;  1TWG A;  3IAY A;  2WAQ A;  2R7Z A;  1A35 A;  1EK8 A;  1SMY D;  3K5M A;  4KDD A;  1I3Q A;  1IW7 D;  1TWA A;  4OYD B;  1MIU A;  4FGU A;  3GTP A;  4Q5V A;  1DD5 A;  4QCL A;  2NVX A;  2E2I A;  2B63 A;  1EH1 A;  2CW0 D;  2VUM A;  2BE5 D;  2WB1 A;  3MAQ A;  2B9S B;  4LMO A;  4D3Y A;  4NOK A;  2E2H A;  3K57 A;  1K4S A;  4O26 A;  1SC7 A;  5JSN B;  4IP9 A;  1I6V D;  1Q8I A;  1GE9 A;  4AN8 A;  1ISE A;  2YU9 A;  4JLR C;  3SJR A;  1LPQ A;  3K5O A;  4L8I A;  1WQH A;  3GTO A;  2JA6 A;  4NOM A;  3K5L A;  4KB2 A;  3CQZ A;  3K58 A;  1NH3 A;  2A6E D;  4FYD A;  2A6H D;  5CQG A;  3GTL A;  2R92 A;  1HQM D;  4KAW X;  1WQG A;  1RRJ A;  1TWC A;  4QIW A;  1YNJ D;  1WQF A;  3DU6 A;  4Q5G A;  4KC6 A;  1K83 A;  4EJ3 A;  3GTJ A;  1R49 A;  2PMZ A;  1TWH A;  5MLC 9;  3FKI A;  3K59 A;  1V9M A;  1IS1 A;  3HKZ A;  3LHP S;  4IP8 A;  3K5N A;  3M4A A;  2F4Q A;  2JA7 A;  4F3E A;  1R5Z A;  1WCM A;  1TL8 A;  1T8I A;  1Y1W A;  1Y1V A;  1RR8 C;  2R93 A;  1ZYR D;  1SEU A;  5C9H A;  1TGO A;  3KYL A;  3GTK A;  2A69 D;  2NVY A;  3LF9 A;  3P9A A;  4C2M A;  5JSB B;  1A36 A;  4FXD A;  4GFQ A;  2R4G A;  3WVO A;  2Y0S A;  1TWF A;  4D3Z A;  2O5J D;  3GTG A;  3DU5 A;  1YNN D;  3GTM A;  4AHC A;  1EJ9 A;  1R9T A;  1A31 A;  1I50 A;  1Y69 8;  4AYB A;  4NOL A;  1K4T A; 
#chains in the Genus database with same CATH homology
 4H3T A;  3H0G A;  2A68 D;  1SFO A;  4KB4 A;  2JA5 A;  3GTQ A;  1TWG A;  3IAY A;  2WAQ A;  2R7Z A;  1A35 A;  1EK8 A;  1SMY D;  3K5M A;  4KDD A;  1I3Q A;  1IW7 D;  1TWA A;  4OYD B;  1MIU A;  4FGU A;  3GTP A;  4Q5V A;  1DD5 A;  4QCL A;  2NVX A;  2E2I A;  2B63 A;  1EH1 A;  2CW0 D;  2VUM A;  2BE5 D;  2WB1 A;  3MAQ A;  2B9S B;  4LMO A;  4D3Y A;  4NOK A;  2E2H A;  3K57 A;  1K4S A;  4O26 A;  1SC7 A;  5JSN B;  4IP9 A;  1I6V D;  1Q8I A;  1GE9 A;  4AN8 A;  1ISE A;  2YU9 A;  4JLR C;  3SJR A;  1LPQ A;  3K5O A;  4L8I A;  1WQH A;  3GTO A;  2JA6 A;  4NOM A;  3K5L A;  4KB2 A;  3CQZ A;  3K58 A;  1NH3 A;  2A6E D;  4FYD A;  2A6H D;  5CQG A;  3GTL A;  2R92 A;  1HQM D;  4KAW X;  1WQG A;  1RRJ A;  1TWC A;  4QIW A;  1YNJ D;  1WQF A;  3DU6 A;  4Q5G A;  4KC6 A;  1K83 A;  4EJ3 A;  3GTJ A;  1R49 A;  2PMZ A;  1TWH A;  5MLC 9;  3FKI A;  3K59 A;  1V9M A;  1IS1 A;  3HKZ A;  3LHP S;  4IP8 A;  3K5N A;  3M4A A;  2F4Q A;  2JA7 A;  4F3E A;  1R5Z A;  1WCM A;  1TL8 A;  1T8I A;  1Y1W A;  1Y1V A;  1RR8 C;  2R93 A;  1ZYR D;  1SEU A;  5C9H A;  1TGO A;  3KYL A;  3GTK A;  2A69 D;  2NVY A;  3LF9 A;  3P9A A;  4C2M A;  5JSB B;  1A36 A;  4FXD A;  4GFQ A;  2R4G A;  3WVO A;  2Y0S A;  1TWF A;  4D3Z A;  2O5J D;  3GTG A;  3DU5 A;  1YNN D;  3GTM A;  4AHC A;  1EJ9 A;  1R9T A;  1A31 A;  1I50 A;  1Y69 8;  4AYB A;  4NOL A;  1K4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...