4O26A

Crystal structure of the trbd domain of tert and the cr4/5 of tr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
257
structure length
240
Chain Sequence
GSGFLYGGRGMHGFCLNRKRRTAAGPRRLQGQDLVRLVFFEGLKPKKLPLRYFNMVPVFGRLLQRHRKCRYSSVLHRMCPVVELSRAAQGELSSLIPQHCAPHRVYLFVRECLTAVVPEELWGSDHNRLQFFSRVRGFLKSGSVAELMWKIKVMDCDWLKLRRTAGRFPPSELAYRTRILSQFLTWLLDGFVVGLVRACFYATESNAIRFYRQEVWSKLQDLAFRRHIAKGEMEELSPAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for protein-RNA recognition in telomerase.
pubmed doi rcsb
source organism Oryzias latipes
molecule tags Rna binding protein/rna
molecule keywords Telomerase reverse transcriptase
total genus 76
structure length 240
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.70 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4o26A00
2R4GA 5CQGA 4O26A 5C9HA 3DU5A 3KYLA 4LMOA 3DU6A
chains in the Genus database with same CATH superfamily
2NVXA 3GTLA 4FGUA 3WVOA 4KAWX 2B9SB 1A36A 1TWGA 3MAQA 1WQHA 2A68D 2A69D 1K4SA 4QCLA 3KYLA 3IAYA 4IP9A 1SFOA 1LPQA 3LF9A 2A6HD 4FXDA 3GTMA 4D3ZA 1NH3A 4NOMA 1ZYRD 2Y0SA 1HQMD 1K4TA 1A35A 2WAQA 1A31A 1MIUA 3K5LA 4IP8A 1TGOA 5CQGA 2WB1A 3DU6A 1TWHA 1TWCA 4EJ3A 1YNJD 1DD5A 4D3YA 1EJ9A 5JSBB 4Q5VA 2PMZA 1TWFA 4QIWA 1Y1WA 2JA7A 3HKZA 2R7ZA 1Y1VA 4KDDA 1V9MA 4Q5GA 4O26A 1WCMA 1Y698 5JSNB 1ISEA 1TL8A 1T8IA 2F4QA 1RR8C 2NVYA 3K5OA 4JLRC 4LMOA 2E2HA 4OYDB 2VUMA 4L8IA 4C2MA 2R4GA 3K5MA 2JA6A 4NOKA 4KB4A 3K58A 1SMYD 3H0GA 3GTKA 5MLC9 3GTGA 2O5JD 1GE9A 1WQFA 1R5ZA 4GFQA 3CQZA 1R9TA 1EK8A 1SC7A 3FKIA 1K83A 1I50A 2B63A 3P9AA 2JA5A 3SJRA 1TWAA 4F3EA 4KB2A 3K59A 3GTQA 4KC6A 1IS1A 1Q8IA 1YNND 2R92A 4NOLA 3GTPA 2YU9A 3GTOA 1IW7D 3GTJA 1RRJA 4FYDA 3K5NA 2E2IA 1SEUA 1EH1A 4H3TA 4AYBA 2A6ED 3LHPS 3DU5A 3M4AA 1R49A 4AN8A 2R93A 2CW0D 1I3QA 5C9HA 2BE5D 1I6VD 3K57A 1WQGA 4AHCA
chains in the Genus database with same CATH topology
2NVXA 3GTLA 4FGUA 3WVOA 4KAWX 2B9SB 1A36A 1TWGA 3MAQA 1WQHA 2A68D 2A69D 1K4SA 4QCLA 3KYLA 3IAYA 4IP9A 1SFOA 1LPQA 3LF9A 2A6HD 4FXDA 3GTMA 4D3ZA 1NH3A 4NOMA 1ZYRD 2Y0SA 1HQMD 1K4TA 1A35A 2WAQA 1A31A 1MIUA 3K5LA 4IP8A 1TGOA 5CQGA 2WB1A 3DU6A 1TWHA 1TWCA 4EJ3A 1YNJD 1DD5A 4D3YA 1EJ9A 5JSBB 4Q5VA 2PMZA 1TWFA 4QIWA 1Y1WA 2JA7A 3HKZA 2R7ZA 1Y1VA 4KDDA 1V9MA 4Q5GA 4O26A 1WCMA 1Y698 5JSNB 1ISEA 1TL8A 1T8IA 2F4QA 1RR8C 2NVYA 3K5OA 4JLRC 4LMOA 2E2HA 4OYDB 2VUMA 4L8IA 4C2MA 2R4GA 3K5MA 2JA6A 4NOKA 4KB4A 3K58A 1SMYD 3H0GA 3GTKA 5MLC9 3GTGA 2O5JD 1GE9A 1WQFA 1R5ZA 4GFQA 3CQZA 1R9TA 1EK8A 1SC7A 3FKIA 1K83A 1I50A 2B63A 3P9AA 2JA5A 3SJRA 1TWAA 4F3EA 4KB2A 3K59A 3GTQA 4KC6A 1IS1A 1Q8IA 1YNND 2R92A 4NOLA 3GTPA 2YU9A 3GTOA 1IW7D 3GTJA 1RRJA 4FYDA 3K5NA 2E2IA 1SEUA 1EH1A 4H3TA 4AYBA 2A6ED 3LHPS 3DU5A 3M4AA 1R49A 4AN8A 2R93A 2CW0D 1I3QA 5C9HA 2BE5D 1I6VD 3K57A 1WQGA 4AHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4G A;  5CQG A;  4O26 A;  5C9H A;  3DU5 A;  3KYL A;  4LMO A;  3DU6 A; 
#chains in the Genus database with same CATH topology
 2NVX A;  3GTL A;  4FGU A;  3WVO A;  4KAW X;  2B9S B;  1A36 A;  1TWG A;  3MAQ A;  1WQH A;  2A68 D;  2A69 D;  1K4S A;  4QCL A;  3KYL A;  3IAY A;  4IP9 A;  1SFO A;  1LPQ A;  3LF9 A;  2A6H D;  4FXD A;  3GTM A;  4D3Z A;  1NH3 A;  4NOM A;  1ZYR D;  2Y0S A;  1HQM D;  1K4T A;  1A35 A;  2WAQ A;  1A31 A;  1MIU A;  3K5L A;  4IP8 A;  1TGO A;  5CQG A;  2WB1 A;  3DU6 A;  1TWH A;  1TWC A;  4EJ3 A;  1YNJ D;  1DD5 A;  4D3Y A;  1EJ9 A;  5JSB B;  4Q5V A;  2PMZ A;  1TWF A;  4QIW A;  1Y1W A;  2JA7 A;  3HKZ A;  2R7Z A;  1Y1V A;  4KDD A;  1V9M A;  4Q5G A;  4O26 A;  1WCM A;  1Y69 8;  5JSN B;  1ISE A;  1TL8 A;  1T8I A;  2F4Q A;  1RR8 C;  2NVY A;  3K5O A;  4JLR C;  4LMO A;  2E2H A;  4OYD B;  2VUM A;  4L8I A;  4C2M A;  2R4G A;  3K5M A;  2JA6 A;  4NOK A;  4KB4 A;  3K58 A;  1SMY D;  3H0G A;  3GTK A;  5MLC 9;  3GTG A;  2O5J D;  1GE9 A;  1WQF A;  1R5Z A;  4GFQ A;  3CQZ A;  1R9T A;  1EK8 A;  1SC7 A;  3FKI A;  1K83 A;  1I50 A;  2B63 A;  3P9A A;  2JA5 A;  3SJR A;  1TWA A;  4F3E A;  4KB2 A;  3K59 A;  3GTQ A;  4KC6 A;  1IS1 A;  1Q8I A;  1YNN D;  2R92 A;  4NOL A;  3GTP A;  2YU9 A;  3GTO A;  1IW7 D;  3GTJ A;  1RRJ A;  4FYD A;  3K5N A;  2E2I A;  1SEU A;  1EH1 A;  4H3T A;  4AYB A;  2A6E D;  3LHP S;  3DU5 A;  3M4A A;  1R49 A;  4AN8 A;  2R93 A;  2CW0 D;  1I3Q A;  5C9H A;  2BE5 D;  1I6V D;  3K57 A;  1WQG A;  4AHC A; 
#chains in the Genus database with same CATH homology
 2NVX A;  3GTL A;  4FGU A;  3WVO A;  4KAW X;  2B9S B;  1A36 A;  1TWG A;  3MAQ A;  1WQH A;  2A68 D;  2A69 D;  1K4S A;  4QCL A;  3KYL A;  3IAY A;  4IP9 A;  1SFO A;  1LPQ A;  3LF9 A;  2A6H D;  4FXD A;  3GTM A;  4D3Z A;  1NH3 A;  4NOM A;  1ZYR D;  2Y0S A;  1HQM D;  1K4T A;  1A35 A;  2WAQ A;  1A31 A;  1MIU A;  3K5L A;  4IP8 A;  1TGO A;  5CQG A;  2WB1 A;  3DU6 A;  1TWH A;  1TWC A;  4EJ3 A;  1YNJ D;  1DD5 A;  4D3Y A;  1EJ9 A;  5JSB B;  4Q5V A;  2PMZ A;  1TWF A;  4QIW A;  1Y1W A;  2JA7 A;  3HKZ A;  2R7Z A;  1Y1V A;  4KDD A;  1V9M A;  4Q5G A;  4O26 A;  1WCM A;  1Y69 8;  5JSN B;  1ISE A;  1TL8 A;  1T8I A;  2F4Q A;  1RR8 C;  2NVY A;  3K5O A;  4JLR C;  4LMO A;  2E2H A;  4OYD B;  2VUM A;  4L8I A;  4C2M A;  2R4G A;  3K5M A;  2JA6 A;  4NOK A;  4KB4 A;  3K58 A;  1SMY D;  3H0G A;  3GTK A;  5MLC 9;  3GTG A;  2O5J D;  1GE9 A;  1WQF A;  1R5Z A;  4GFQ A;  3CQZ A;  1R9T A;  1EK8 A;  1SC7 A;  3FKI A;  1K83 A;  1I50 A;  2B63 A;  3P9A A;  2JA5 A;  3SJR A;  1TWA A;  4F3E A;  4KB2 A;  3K59 A;  3GTQ A;  4KC6 A;  1IS1 A;  1Q8I A;  1YNN D;  2R92 A;  4NOL A;  3GTP A;  2YU9 A;  3GTO A;  1IW7 D;  3GTJ A;  1RRJ A;  4FYD A;  3K5N A;  2E2I A;  1SEU A;  1EH1 A;  4H3T A;  4AYB A;  2A6E D;  3LHP S;  3DU5 A;  3M4A A;  1R49 A;  4AN8 A;  2R93 A;  2CW0 D;  1I3Q A;  5C9H A;  2BE5 D;  1I6V D;  3K57 A;  1WQG A;  4AHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...