4NOKA

Crystal structure of proenzyme asparaginyl endopeptidase (aep)/legumain at ph 7.5
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
404
structure length
404
Chain Sequence
KHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Legumain
publication title Structural analysis of asparaginyl endopeptidase reveals the activation mechanism and a reversible intermediate maturation stage.
pubmed doi rcsb
source organism Mus musculus
total genus 150
structure length 404
sequence length 404
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4nokA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nokA01
4NOLA 2HBZA 1QDUA 1GQFA 3GJRA 3KJNA 1I3OA 4N6OA 2FQQA 3EDRA 4I1PA 3GJSA 3K7EA 1PAUA 5IAGA 1NW9B 2NN3C 2HBYA 4QUDA 4EHLA 2QLFA 3R6LA 2C2MA 3P45A 2XZTA 2CJXA 2CNLA 3H13A 3R6GA 2C2KA 5LU8A 3UO8B 1RWNA 2XYPA 4NBLA 4QU9A 1K88A 3PD1A 2C1EA 1RE1A 4QTYA 2CNNA 3GJTA 2FUNB 4QUHA 3V55A 1I51A 3QNWA 4JR1A 2XYGA 4AWBA 4FDLA 1RWVA 4N7JA 1RHUA 3H11B 4JJ8A 2CNKA 2QLJA 1K86A 2QL7A 5IAKA 3PCXA 1QTNA 3H11A 1RHMA 1QX3A 2H48A 3DEHA 4JJ7A 2Y1LA 4DCPA 5IANA 1M72A 3D6FA 2H4WA 3D6MA 4EHDA 5LU9A 1SC3A 1I4EB 4NBNA 3R5KA 5I9TA 3V6LA 1SC4A 4NOKA 4HVAA 1F9EA 4QUGA 1NMQA 2J30A 2HBQA 3OD5A 4IEFB 5JFTA 3SIPA 4PS1A 5IBPA 2H54A 4PS0A 2H51A 4EHKA 3IBFA 3BIJA 3DEKA 2H4YA 4DCJA 4NBKA 4D3XA 1PYOA 4QUEA 4QTXA 4JR0A 4QUJA 4N6NA 5H0IA 3R5JA 2QL5A 5LUAA 4AW9A 1RWMA 4ZVTA 1SC1A 4JQZA 2DKOA 1SHLA 1GFWA 4N6GA 1JXQA 4QUAA 4ZVPA 4ZVUA 4FXOA 5IABA 4IYRA 2P2CA 4NOJA 4EHAA 2XZDA 4ZVQA 1RWKA 5LUBA 3S70A 5IC4A 2J32A 3EDQA 1CP3A 4HQRA 4AWAA 4DCOA 4EJFA 3H1PA 3R7NA 5IC6A 2HBRA 4PRZA 5IAJA 1RWXA 2K7ZA 3GJQA 5IASA 2FP3A 3NKFA 4JJEA 3S8EA 4FGUA 4QULA 3SIRA 3V4LA 4JR2A 4M9RA 1RHJA 1I4OA 4JB8A 1RWWA 2H65A 4QUBA 2CJYA 3PD0A 3UOAB 1RWOA 3R7SA 2CNOA 4ZVRA 3V4OA 4N5DA 4EHNA 1RHKA 4N7MA 4EHHA 4D3YA 3R7BA 4QU0A 5IAEA 1SHJA 1KMCA 1IBCA 1ICEA 4D3ZA 1RWPA 1RHRA 2J31A 4NOMA 2C2ZA 3NS7A 4JQYA 4QUIA 5I9BA 4I1RA 1BMQA 1NMEA 3DEIA 5IARA 4LSZA 4QU8A 3KJQA 2CDRA 3NR2A 4ZVOA 2C2OA 3DEJA 2WDPA 3E4CA 1NMSA 1RHQA 2H5IA 4FEAA 4PRYA 3V3KA 2J33A 2QLBA 1CVRA 3RJMA 3H0EA 3V6MA 3P4UA 5IBRA 5IBCA 3KJFA 2H5JA 4EHFA 4QU5A 2AR9A 4HQ0A 4ZVSA 2QL9A 2XYHA 3ITNA 2Y0BA 1F1JA 5K20A 3IBCA 3D6HA
chains in the Genus database with same CATH superfamily
4LXYA 2XEXA 1BOOA 4Z9YA 1Y33E 3LHPS 1CY2A 1VL2A 1MC1A 1JFVA 2ENUA 4FQ8A 4HSGA 3NU1A 4OSOA 1Z13A 3OU6A 2GN9A 2PRYA 3CGWA 3RJTA 3VAZA 1U9YA 4B4DA 1H4QA 1UDXA 2XF8A 2RG7A 4ED9A 4HZUB 3MJCA 3DQPA 2AKEA 1WXXA 1YU6A 3JR3A 3L43A 3UQZA 2WTMA 1MA3A 3WTBA 4V0SA 4CDRA 3A11A 2QWXA 1BVYF 2BMJA 5KX5F 1P45A 2HHAA 2FSHA 2RGYA 2IDJA 3PNBA 2GN1A 4B45A 3VHXB 5KNDD 3Q1LA 4OHZA 4DV0B 4C4OA 1VSBA 5LOVF 2BBOA 2DFKB 2ZLBA 1K6EA 3NTVA 5CDFA 3BD8A 1JB9A 4FBGA 4BVJA 4G5SA 3WYFA 4CM3A 1CUXA 1DMSA 5B4UA 5K0ZA 1J2JA 2ZI6A 5BSHA 1P0FA 4D3DA 3AEZA 2C9ZA 2HC9A 3WX0A 5IANA 1P5JA 4HY3A 4NPCA 4GWLA 1N25A 1GKUB 4Q7EA 1URPA 4EI7A 2WZDA 3O8CA 1XZQA 1HL3A 2AVDA 1EXNA 4KBGA 3OJLA 2YFHA 1F8XA 2P4QA 2FZ4A 3TE6A 3GCXA 4WY8A 1S7GA 4E32A 3CVXA 3VA7A 3UK7A 3A1WA 4N49A 1JEYA 2A0UA 1E3LA 1BJTA 3R0ZA 1PBTA 4LJSA 4UHCA 2IYZA 1E1YA 2RJNA 1OCEA 4I1IA 1G0NA 3AR4A 3FWHA 4UMVA 4FCWA 4ZVTA 4B0OA 3CX4A 4HR7A 1L7QA 2P79A 5EJ6A 1J20A 2WAQA 5JPDA 4JLMA 4PAGA 1I3CA 1HE8B 2PJDA 4BP9A 3C4VA 3FI0A 1AZSC 2FLKA 3TDKA 3RHZA 1ULHA 4GI2A 2GVDC 1NUTA 4MR7A 2WD7B 1BE6A 1PR4A 3S70A 4AZ0A 1A7UA 4COKA 2E2WA 5B5SA 2IHTA 1IN5A 1OKKD 3GBSA 3KX2A 4NZZA 1UPBA 3AY3A 4BUCA 3Q8XB 4KXLA 3QVXA 4Z3DA 1AO0A 1E2PA 1C3OA 4EO9A 3DC7A 4BO4A 1WUJS 1ZHHA 3P2MA 3Q2IA 4IV0A 3NHZA 3GVPA 1XVTA 5LDGA 3ERCA 1RWWA 3WI7A 1Z7BA 3GK3A 3K32A 1ETHA 2XXBA 3BMNB 4K9LA 4TMWA 4V24A 2QN2A 3B6MA 1V9LA 4CUZA 1NRIA 3HKEB 3F8WA 3FTCA 3EZGA 3PPIA 4XTCS 5TXGA 3UJDA 2C20A 1TF5A 1ZI6A 2DR2A 1UPFA 3IAHA 4ROSA 1PJCA 1EWYA 1XJQA 4ND6A 4NH0A 4UM8B 3W2FA 3UKJA 4BWVA 3G88A 4YP6A 4D0NA 3B8HA 4PLCA 3LP6A 5CK4A 1LPQA 1H2HA 3HI4A 3O3NB 4E2WA 3ZUPA 3A1FA 4OBWA 4UNPA 4ROTA 4M1SA 4YDRA 1RHQA 2HDOA 3EEIA 5AW2A 3U44A 2PZJA 3ZCRA 1B3BA 3ZGOA 1OFTA 3RJMA 4IDCA 4F6RA 4FCTA 4DY4A 3KYDA 5DNUA 1GQQA 2X0NA 1NJ2A 3P0FA 3I6ZA 4N7BA 1ZGZA 2I6XA 2X8JA 4GGMX 2RHOA 2AUTA 5GM1A 2V8OA 2B0CA 2GEDA 3WGLA 3I5MA 4RA6B 3T1NA 4PGGA 4BNYA 2XKAA 2E7ZA 3K0KA 3ZLJA 5KSPA 1SVOA 4X41A 4NBWA 1Z18A 4Y18A 5B2ZA 2FQWA 4O33A 1Q12A 2OD7A 3BFJA 2I3GA 1QQBA 4UMEA 4X20A 4EGCB 2QSYA 3F0TA 1GGFA 3KTFA 2A6HD 4FR5A 4I55A 5K09A 3U6BA 4TQGA 1Q1ZA 4V0LA 2YNMC 1ISJA 5A7HA 1WB9A 2GA8A 2GHIA 5KPDA 1JA0A 1O95A 1POXA 1UBSB 2G6BA 3DA8A 1XQ6A 3MCWA 4Q6WA 2P9QA 4ZQEA 3RYFA 3K9LA 1NE7A 2OYSA 4JLJA 2Q5QA 3E3AA 3JZFA 4DR6B 2XNCA 3FYUC 4GM0A 4V3CA 3ZNQA 2BGWA 3UHAA 2GJ9A 4U1RA 2JHGA 2YJZA 4LTMA 2JK1A 3HCCA 4MCAA 4U4AA 3FLBA 3HU5A 2ZUFA 5A71A 4FNMA 1VG9B 4EWLA 1CCWA 3MWDA 4TS4A 1DG3A 4UNQA 4RHUA 1MIOB 3PD7A 4O1IA 4QRIA 3ZQ4A 1VMKA 1ZG3A 4RF3A 1L1FA 3FOFC 1Q20A 5AXAA 3PF9A 5L3VA 5JOQA 3OKAA 3I4LA 2FPGA 3GCWA 3PBKA 2OR3A 3CIOA 4HEJA 3E9RA 1XFDA 1EESA 3D3WA 4K9PA 4QTXA 1PVOA 1CULC 4XYGA 2EXXA 4L72A 1J8MF 1NH3A 1V5WA 2AK3A 3BWEA 3ZV4A 2OXEA 4YIHA 1UDCA 3LYAA 4L8FA 3CPEA 3GGGA 3DLPX 4G24A 3SS7X 3V33A 2O59A 2J3QA 1O3YA 1W581 4CG3A 3OTIA 2BGJA 2IF2A 3EEBA 1J2EA 4PZ0A 3BICA 2Q45A 3EY9A 5CIWA 5DM70 5BSFA 1DKRA 2NW6A 2TMKA 4KAJA 4OLJA 4QOIA 4EL5A 4P98A 1WVGA 1J90A 1IB0A 4DY6A 1WR8A 3D7RA 3S1AA 1NBIA 3N9IA 4UBNA 5IKOA 3CG4A 2AMFA 4JGBA 2D06A 1MGPA 2Q50A 4LV5B 3WLPA 1Z29A 3WKDA 4FDVA 3A25A 3JYQA 2V45A 4GFQA 1HV8A 1Z4JA 1M6VB 4UOQA 2JBAB 4C0AC 4W6ZA 4YAKA 1BDBA 1IJFA 1WXWA 2Z95A 2PUWA 3MCZA 4D43A 5L7TA 4A0GA 4QPCA 2I7TA 1ENOA 2X0EA 1FXWA 4MW6A 3FCAA 3AHDA 2XMCA 1II0A 1YK1A 3WYNA 2CHQA 1MENA 3L8MA 1GYPA 4GICA 1N5DA 1Y8QA 1T6XA 3EUWA 1V7PC 4L07A 2HA7A 1K68A 3RYTC 4D57A 4E12A 4RTRA 1X1AA 5DBFA 5KCZA 3ROTA 3P96A 3RUPA 3ZH9B 4B6GA 4TGLA 3ZU2A 3QSGA 1ORHA 3PK0A 4P4SB 3HU1A 4PGFA 3CX8A 2R8ZA 5HE8A 4QREA 1Z6YA 4O2BF 3EZXA 2W42A 2XWQA 4GSKA 4CF7A 1XLWA 2IY8A 2ON6A 3Q0IA 4GPZA 4RIEA 2F8LA 1MJFA 3GAAA 4QQFA 2FSVA 3MINB 1I30A 3R23A 3O92A 3GVCA 4AULA 4WZBB 1VTKA 1N0WA 2Y92A 4Z4IA 3MAAC 1CVLA 1RW4A 2EBHX 1A96A 4QRHA 3V1YA 5JCOC 3ECCA 5AVUA 4PZUA 2G07A 4LECA 1T3TA 4W5OA 1NF8A 2YV4A 3ST7A 2OMEA 3HGTA 4AMVA 5JAUA 3FKIA 4R01A 2C9BA 2GLUA 3RFFA 3TRIA 1Q74A 3IX7A 4F4FA 5BR1A 5I7UA 4Z4QA 3MEQA 4WXEA 1VSQA 4ZN6A 2QVGA 4FYMA 3F6BX 4RJ2A 1NXOA 4JZKA 4KB2A 2AYZA 4BNNA 1IOWA 2I4LA 3I37X 3PICA 4A16A 3I1FA 3UV6A 2R751 2RKOA 4JIMA 2D1YA 3BZUA 2BFPA 4JCOA 4ZEXA 1FJXA 4LIPD 4C6RA 4IICA 1BHJA 2A14A 1GPH1 3FZEA 1TYDE 2MMGA 3RS5A 4ML3A 1AM4D 2ZSIA 3GCZA 3JPYA 4FE3A 5F5NA 3MCUA 4LZZA 2HGZA 3BDIA 4ZANA 2QM7A 1A4UA 1PFYA 3G8YA 5FBRB 2VCHA 3RJ5A 5I9IA 1IEQA 1O95D 2PKRA 3SE7A 3EF3A 3GDHA 3CNBA 2PFGA 1J0DA 2B36A 4J1TA 4JOBA 4L4UA 3VC1A 2A78A 3PEEA 1CJTC 4F56A 1VSTA 5BO5A 1WHTB 2DSTA 4FTWA 4B7ZA 4BC1A 3KVOA 1TLLA 4US1R 4R71A 4YUAA 3GP5A 4MEJA 4YCNA 3BK2A 3LWNA 2B98A 4LRWA 1E6LA 1SG9A 3H8VA 5CBKA 2WKRA 3G9TA 3AM1A 3HKBB 1JDJA 2I1WA 4UMDA 1XD2A 1JLLB 2QL5A 4LYHA 3EDOA 3FN4A 4O4JA 1E1NA 4X95A 3WGQA 1RRMA 1Y6FA 2ZXFA 1YXMA 3GPCA 4IP0A 2LPMA 3OIFA 1WZCA 2PPVA 1N6IA 4EECA 1Z2AA 4C0XA 5A3QA 3OSUA 3M89A 4NL4H 3LBHA 4C5CA 5B7QA 4MW7A 2AJTA 5JXIA 3C70A 4K9KA 3PHHA 2EJCA 2NTVA 4DWOA 2FX3A 1G8JA 4CW7A 4DRXB 2QD2A 4P08A 3HWWA 3PVCA 4KLRA 1YVDA 3RSFA 1M1YE 1G20A 1CUAA 2OENG 4LDRA 5HVNA 1B26A 1I8TA 5ALNA 1KYTA 2I7XA 3AR9A 5K6TA 3OQVA 5J5AA 1IULA 2AF4C 2ZQYA 2PUCA 2IZOA 4JBHA 1AK1A 3SPXA 3KLNA 1U9IC 4GL2A 4FIDA 2IJGX 1PFWA 1USKA 5T6MA 2A57A 3BA1A 1PJZA 2WOJA 3R7BA 1AC5A 1I1OA 5KSYA 2HSEA 2NPIA 1IMOA 5TRTA 1HQYE 3ZNNA 4KE8A 5AHOA 3Q7IA 3ILYA 5AI5A 3S0JA 4BB9A 4GMXA 1KIMA 4B79A 4CWAA 4RHTA 5I45A 3LPDA 4MWSA 3LX4A 4JLVA 2IITA 1R66A 1IEWA 2YNMA 3B1KA 2O52A 4M0PA 4HNUA 1PF7E 5EQTA 5GIPE 4HPWA 4K1XA 1RAEA 3SM9A 2IYXA 5D85A 1QZXA 1IK4A 5DYYA 1RM5A 2BFEA 1A4XA 1OBOA 3FYUA 2BFCB 3KSZO 1L8OA 3OZFA 3BHIA 2YJTD 4AMYA 5HRUA 1PDOA 1L5YA 2C1ZA 4H6PA 5TJHA 2C7BA 3M33A 4BN5A 4R0MA 5B3KA 2PUHA 2GDZA 3A9CA 4BFCA 3DPIA 4PPQA 1AV7A 2EGHA 1Z5WA 2JAOA 1NVVQ 2XQVA 4UUPA 5JC1A 3D0QA 1SXHA 3HFJA 2Q8QA 3FM9A 2WINI 4IJKA 4J0EA 1KMMA 4RVSA 2QDXA 1Y89A 5GIOE 2FMIA 2VP3A 3G7UA 1WXEA 3GJSA 4BFTA 3URMA 4BZXA 4RD1A 4OLHA 3DOJA 4RNDB 5G0TA 3WMWA 2MTBA 1VBKA 3JZIA 3GGPA 4IJQA 4P4LA 1HG0A 2WSLA 5ALKA 5FPQA 4LCJA 3LFUA 3V1MA 3K0AB 4BMNA 2ZIVB 3KUUA 2PDAA 4EJMA 4BKRA 2UUBB 5DTRA 4DV7B 1EHCA 3AY6A 4RVNA 4AQYB 4IXNA 3LGAA 2R00C 3KQMA 3QF7A 2K6GA 4HGYA 4I6GA 1DAKA 1NW7A 4WZ6A 4Q9JA 5TEVA 5EIFA 1YCFA 3BM5A 3CEAA 3KYCB 4AX8A 4ACAA 3A05A 4Q3CA 6CHYA 3B82A 2WKQA 2O3TA 3TE7A 2G1AA 2IOYA 3CFYA 3KXIA 2H07A 3GNTA 4ZV4A 4V0ME 4J7CA 3T7AA 1X2EA 5CVTA 1ZH4A 1U0EA 3O83A 4TXLA 4I8XA 1LD3A 1LNQA 1ZD9A 3ESYA 4HZGA 5LBUA 4Q9IA 5T67A 5LXTF 2ZBRA 4IBOA 4TZ6A 1HLFA 2GN0A 2ZM5A 5ICSA 4X7MA 3E7XA 1UZLA 2J08A 3DAOA 4EFKA 3A4VA 5TR9A 1X7YB 2HCRA 3L6OO 2JEYA 5TQ0A 2YY7A 4H18A 1PS0A 3QVVA 1L7MA 1CY8A 3EA5A 3JQ8A 3V5NA 2A35A 2FAXA 2O20A 2YHSA 5KS2A 1DHTA 1PO7A 1TX4B 1ZI9A 1XEAA 1ZXXA 4LMOA 3RVSA 4RTLA 2R7LA 1SHLA 1SKYE 2VFAA 3BAZA 1YL6A 4XE5A 4F3CA 2KX7A 4YCAA 4DG5A 1NFRA 2PE5A 3TOVA 1ZD3A 3QLUC 1EPUA 2QMQA 5CUQA 4B35A 3NZEA 4C08A 2FW6A 3GPLA 4EJSB 1G63A 3EIHA 5CAEB 3QBEA 1P1FA 1DQZA 4G1FA 1O4VA 1IIRA 2C31A 3WOHA 2CL5A 5K9ZA 1J07A 2JFZA 5LYYA 2WFLB 3VPSA 4FHEA 2G3YA 1J25A 2WUGA 1LK5A 3UAYA 4QBHA 2SICE 1VCNA 5C52B 2OFXA 4TYMA 2WVGA 4OY3A 3MTEA 1GCIA 1N9GB 3HBLA 4YRGA 4MXDA 3KT0A 3F6PA 1X1RA 5EUBA 1LLFA 3VMMA 4F1WA 4U7DA 1H3EA 4Z3KA 1EGAA 1YI0A 1NURA 4TLMB 1IHXA 1TNDA 2JRLA 2FEMA 2ZIXB 2AX3A 1IBCA 4XKJA 2PD6A 1R8JA 5IEBA 4DXDA 1GV1A 4B7CA 2WWHA 5KWIA 2Q0QA 3R9XA 3O6VA 4M0KA 4QJBA 5H59A 1KI6A 1WPRA 1UT5A 1KK0A 1GD1O 2BWJA 2ZE5A 4R41A 3B53X 2LCIA 3U3MA 1XXHB 4ZYXA 4J2TA 1DO2A 3T3MB 2QJFA 5A4DA 1R4MB 1CE8B 3NIWA 4M1TA 2A7QA 2C95A 1GA6A 4BQFA 2VPZA 2AFHE 3IUJA 3AEKB 3SMVA 2JARA 4MYHA 3T8YA 1CUUA 3DUFA 5HKKD 4JYZA 4PPGA 1BH2A 3IA7A 4WW0A 1R6UA 3ISVA 1BU8A 1BGVA 4MQUA 1CJBA 1YNND 1XEFA 4UHDA 4UXIA 2FPPA 1X86B 3DS8A 5C9HA 4KFUA 5CT9A 4ZRMA 1C4OA 3UMRA 5F7OA 3A1SA 1FZQA 2G80A 1JUDA 2PGAA 2WVJA 4IMIB 2XV1A 4K86A 4YJ3B 5EGNA 4RZ2A 3TCKA 4B3SB 2ASVA 2HAEA 5AHRA 2PX6A 4JLWA 1VB3A 3R44A 3O47A 4II3A 4D6PA 4KNWA 3TRDA 2JA5A 3RVPA 3EAQA 4UVGA 2G9QA 3RBXA 4CKCB 3PX7A 4C7OA 1Y9JA 2VAWA 4JK3A 3WWYA 1DAFA 4HMQA 4KU4A 5DHSA 4F4CA 3ECSA 2FW7A 3GT7A 2IPLA 2J4CA 2JD1A 3DF7A 1Q22A 4RPHA 1SBNE 5CTJA 4BNVA 1O5TA 1QGOA 1D2MA 3M7IA 1KYYA 4O08A 1B0UA 3UTCA 1NDUA 5IT5A 1G21A 1ZPDA 2HKIA 3E5HA 3PG5A 3F9CA 4IIBA 4JU9A 3GLIB 1KHTA 3OTHA 3AR6A 3TFQA 3EWNA 2COKA 4KK3A 4Q24A 3T15A 3H7AA 5C34B 2OCBA 2WA2A 3HCWA 3BKWA 3WLOA 1TIBA 3FAZA 2B3TA 4IHJA 4Y7DA 5T4BA 5AK3A 1E9FA 1XTPA 2AD1A 1Q1GA 3DCJA 3K2EA 1S3FA 3TXYA 2QW0X 3A70A 3GROA 4FR0A 5E2AA 3MD9A 4D42A 4GRAA 2P35A 1KYXA 3KQNA 1SBYA 3UHPA 4KWHA 4EUEA 3C85A 5JANA 4IMPA 4NMWA 3SIXA 2RH5A 2W4MA 4P7JA 5C7LO 3U0VA 4FYVA 3Q7RA 3QKTA 2RH8A 3I92A 4IDQA 4OQDA 4HDAA 3ADDA 4OM7A 3O1HB 3QUCA 4JU8A 4ZAGA 3ZV7A 1TPZA 3EA0A 1SCBA 1G6OA 5TX7A 2RGDA 3DBRB 5T4EA 3BEDA 1R6AA 3SHWA 4CQMB 4LRUA 5FOTA 1IAVA 4TWZA 1M8JA 2IY9A 4UAJA 4FE7A 3P9NA 1OX4A 1N7JA 3AL2A 5HKBA 2CHEA 5HDQA 3IJ5A 2WJ4A 1PK8A 3EF0A 4EKIA 1QX4A 1SD2A 2UAGA 4E2YA 1JLRA 1A2OA 3C15C 5J23A 1GLGA 1SHJA 2PM8A 2HSDA 2X0RA 1PJ8A 3BGDA 1RWPA 1E1CB 1ZONA 3AMVA 4QRDA 3K20A 2VWPA 4FEEA 1N2EA 1JJVA 1ZMOA 1CHNA 1ZUNA 4I1YA 5SYAA 1N7GA 2LIPA 2O8DB 2OBMA 4MNTA 3DDOA 1USWA 4MV9A 4MA0A 2XH8A 4QLBA 1CC1S 2E21A 3B51X 1OI4A 3L46A 2MCFA 4BQPA 1QYWA 1OZFA 3WLSA 3GFVA 6NULA 9ABPA 1R88A 5HM8A 5J3JA 3IBSA 1VKRA 3CS3A 2BTQA 1RKXA 1X3LA 1XKLA 2H16A 2ZYHA 1CUCA 5H4GA 2PMCA 5JY6A 5LSAA 1K4MA 2GO7A 2X2EA 2BBWA 2KB0A 4C87A 5BWCA 2P11A 3VJKA 3L9XA 4PIPA 3PJRA 1PS9A 1PDWA 1NONA 1US8B 2Q21A 3EDRA 1T36A 1ZCFA 4RLQA 2GXUA 5AUNB 3QFFA 4MQEB 2QTHA 3A4YA 3CW9A 3LYUA 4ARZA 2R4GA 4DYDA 5DRYA 2ZE6A 3G1TA 2G06A 1JKIA 4K3UA 5BW8A 3AEUB 3VH1A 4RTNA 2C83A 1P75A 2QLFA 2FI1A 3R2JA 2UYYA 3O74A 4DCUA 1G98A 4G01B 2OCGA 2YZKA 1JIVA 3DVSX 1C1XB 4J6EA 5F4ZA 3PNQA 5JJCA 3WGIA 3UB2A 1JQLB 1TVKB 4LC9A 5DI3B 4GKKB 1RE1A 4MSUA 5C1DA 3LK6A 1LU9A 1OLUA 1P5HA 2QUJA 2C2YA 4YI3A 4EYQA 1WY5A 1UADA 2Q4OA 1ZY2A 2H1VA 1GNLA 4X84A 1DIHA 1LK7A 4C7BA 4GL4A 2UUCB 4LGVA 1I94B 2WA1A 3QVWA 5AOVA 4G26A 1TQ8A 5ALSA 1P7VA 1YQUA 4IXDA 5HGXA 3AKCA 2IYSA 3D43A 4RGQA 3IQZA 3WKBA 4C4ZA 1GRVA 2N46A 4E09A 3ZDCA 2NO7A 3OY2A 2NGRA 3OLYA 1E98A 2A59A 1I2MA 3S7TA 1DCKA 3BSWA 4I5DA 3M4YA 1ZIPA 5TPZD 1BDMA 4I4NA 1EFVB 1NWCA 4EJ0A 3BH7A 4PTYA 5K3EA 4YXWA 2FSPA 4G8CA 4RX1A 8LDHA 1QIDA 4N3CA 4U0KA 2Y9MB 4UJ3A 2WJHA 1Z7GA 3DLBA 4DRZA 2AW5A 3DAGA 5H0IA 3U17A 4TLAA 5K8IA 3C5EA 3MIIA 2UXCB 5AQEA 2O19A 1D9ZA 1WWKA 3D7KA 1G19A 3EIUA 5FTJA 5TSDA 1R9NA 2P6UA 4QG7A 2APJA 1L6IA 3RG2A 3K5WA 3RSLA 5FOQA 5HGJA 1EFHA 4MEBA 1L5MA 1UMDB 4DDVA 3AT1A 1E7SA 3HJHA 5EKTA 1ZGAA 1OFGA 4JVOA 3WK6A 3LTNC 3WWPA 3WTCA 4A36A 3QBTA 3IT0A 4DZRA 4WESA 4IDPA 2CFIA 2G5TA 5CM2Z 3I01M 1CWUA 3SSMA 3U40A 4EX7A 1MEJA 1UPTA 4YI5A 2XXAB 2EZ8A 1YA6A 2J5RA 4YONB 4PCLA 3NVMB 2QUZA 6ADHA 5GONB 3KFVA 1C8LA 1YB1A 1UFKA 4JUBA 3NHLA 4KGXA 4ZYVA 2DPLA 5KJEA 5BN4B 3U7IA 5C31A 2C9DA 3UJ7A 3RSSA 3OEEA 4RKFA 4UE3S 4M9SA 4ZOCA 2CYAA 4PNEA 6REQB 2GZRA 3H3XA 3VSCA 5T64A 4F5EA 2I4OA 2CL7X 1PCXA 3PC8C 4DM4A 5DNWA 1ZN8A 4FNAA 5D51S 3ZWYA 2Q1XA 2OB1A 5L3SB 3L1UA 2ACVA 4AKTA 2C8JA 1T10A 3FOWA 2H1WA 1ZM3A 1AXRA 1PSDA 4V39A 5DDIP 2DFNA 4PPYA 2YWDA 5HEKA 5LA6A 4HH0A 4Z8YA 4A1FA 3UJPA 1O9BA 1R0LA 4L5IA 3TD6A 4BQOA 3CKYA 1R0WA 1S2OA 2A8YA 4KR9A 4GXNA 1F4LA 1MF7A 3TQCA 1AKQA 2P7HA 2FSSA 2R8EA 4MPPA 1E8NA 2HMWA 3BGOS 3D0KA 4YUXA 1YNSA 1YB6A 1SEVA 2H63A 2WWRA 4HUQA 5TV2A 4MQMA 1I6KA 3BIXA 1OI3A 3N2YA 3A2KA 3MT0A 1TZMA 1LSOA 2I1VB 2P77A 4A7PA 4Z5XA 4C3OB 5GJVC 4DRYA 4KSBA 1J70A 2PKQO 4XM0A 1QONA 5EIAA 1OASA 3OMXA 4MLPA 2W37A 4QXRA 5BPFA 1W29A 3FPJA 2XOXA 4UMFA 1PG0A 4KYIB 3ZU5A 5C35A 1NSYA 3C3WA 4A10A 1UF9A 1VCIA 2R6AA 3IV9A 1AQYA 2D0OB 4Y2YA 3RARA 4CM9A 3IJRA 4YEDA 3LF9A 2IZ0A 3GELA 3MLEA 2ZDGA 3AVPA 1Y1WA 4A92A 2NXEA 3MJRA 1E5VA 2B82A 1ZJ5A 1Y4ZA 2WAXA 2HU7A 1K83A 1UQRA 2ZZKA 3LQ1A 3NW9A 3PITA 5TMPA 3P9ZA 2FPIB 3SLRA 2F7SA 3RTDA 3ZIDA 4A03A 3C8MA 3K9NA 2OBFA 1RC8A 2WAMA 2GWRA 3GZNA 3NDBB 2JKZA 2GKSA 3E9EA 3ADPA 4MQLA 5DTJA 1L4HA 1QIFA 3D2BA 3FIUA 3OT5A 1DT3A 2KW5A 3MW8A 1IN4A 3QVUA 3W9SA 4AN0A 2I03A 4TLBA 5JATA 3EG9A 2HM7A 1FYVA 1C3XA 4MP8A 4MH0R 3B12A 1XZEA 4HQFA 1I2ZA 4XYBA 4B8YA 4OJNA 4Q1DA 4KPUA 4E5PA 4DUGA 3HDQA 4M7PA 2XYRA 3E0XA 4U2CA 3WBBA 4CV0A 3GFQA 3OO1A 4GR4A 4XQ0A 3HBFA 3X1ZA 1HNZB 3WZLA 2FW9A 1PHRA 4Q4HA 4WZZA 3MS4A 5FL7A 3NALA 1A5AB 4OXXA 3CBGA 3SQXA 3R5JA 1R7RA 2GF2A 1MABA 3BJMA 4MV5A 1Z38A 2PWBA 4KQWA 4NEGA 4YXWD 4GQIA 2WJPA 2ZTUA 5C7OO 1W96A 3HN7A 521PA 2QRKA 4NCNA 5F3RA 2WU0A 1P1HA 1SFRA 4JI3B 4AY4A 4L9RA 1ESDA 1FL9A 2QV7A 4WFJA 1GPLA 4BKQA 1BMDA 1XF9A 2ZREA 3PIIA 4BQQA 4AS1A 1M2EA 1H3NA 1U2EA 1VHTA 2AOVA 1Z17A 1L4BA 5DM2A 1S96A 4G8DA 4ALIA 2DETA 2GMWA 3DD5A 1KJWA 3BFVA 4AZ3B 4P3NA 1KSFX 2OP1A 3A1CA 4L7QA 3K0FB 4TYQA 4ZHQA 3VSEA 3NWOA 3SIRA 1DX4A 4MKXA 3QU7A 4RDHA 2O4UX 3TEMA 5KTTA 4H7PA 1ZCBA 3HHPA 3P19A 2WSBA 2DECA 1YR8A 4LOJA 4AXBA 1ECCA 2Q2WA 3V8MA 5A0VA 2IPXA 4NARA 1G8HA 4OGGA 1QG6A 2P3OA 3FMGA 4XGIA 4XRGA 3EGDA 2VQSA 4KDFA 1APBA 2A9RA 3GFFA 5EHNA 5CLFA 4Z1OA 3CIFA 1I0LA 2QSJA 5IAEA 1KMCA 5CJ2A 1LBSA 3OEED 2ODQA 5C0OE 1IHPA 2CLOB 1KFJB 2VZ0A 5JS6A 3PKZA 4MMYB 1Q0LA 3F74A 1DFHA 2AEEA 3A1VA 4CETA 3HXKA 4BNLA 1N2CB 3Q0TA 4CJXA 1NMEA 2IEDA 4JI4B 4DIFA 5JEDA 2OE2A 1H0KA 2FPXA 1ADCA 1T9BA 2CUTA 2ONZA 2YJ5A 1QIKA 2QNIA 1PL6A 3CUEF 1NYLA 2QLBA 3F5SA 1F60A 3LM8A 3LQ2A 4R83A 2HR1A 4MUKA 2BVNA 4DJEC 5ARCA 3NATA 4MQFA 4ZU3A 3L02A 5DP2A 2GNOA 1OI2A 4EYEA 4A0SA 5LDHA 3HYSA 4UPEA 1JKXA 5A2QA 3OA2A 2AXQA 4KE6A 4YCDA 4YJ2A 1T4BA 3B6EA 1MOPA 1XK6A 2OHIA 4FW9A 4DLLA 2GFHA 3N2GB 5K0JA 4OYDB 1EGVB 3A9UA 1EH5A 2PMEA 3NC4A 1BVHA 3KQQA 4JBNA 2OYRA 1PGQA 1N6HA 2X86A 4GX0A 5DFAA 5EMLA 4BB5A 1KAEA 4OI4A 3ZXYA 1BEUB 1RFLA 4NENA 4ER0A 2PK3A 1F7VA 2DERA 3NGMA 2ANCA 3T61A 2DUWA 3ILSA 5DYTA 5C1BA 4PBRA 2Q3LA 1XB2A 3WIUA 1T9CA 1K88A 2Z9CA 3TR0A 5GVSA 4HJRA 1XQWA 1E2LA 3L41A 2AXNA 3QTTA 3TW4A 2ZI4A 4F93B 5IJ0A 2WB1A 1TM5E 4JLDA 4OFBA 4UW9A 1L7RA 2QHXA 2Y0SA 1AGNA 3IQFA 4EB0A 4HAUA 2I34A 1S89A 1YJCA 2FPSA 2JI6A 4JJ7A 4B6RA 3ND8A 3GLVA 5CFZA 1EA7A 2I1LA 3HKDA 5SY4A 4HYEA 2H3HA 2PR2A 3MLAA 1COWD 1RYZA 1F9EA 4Q39A 1WW2A 3PE4A 3JWPA 4UFNA 1MJ5A 3WB0A 4N12A 3V46A 5JFTA 3N39C 5JLJA 1S2MA 1P1IA 2X4GA 5TT1A 4CT5A 4L4XA 1MLDA 3UKOA 2O2JA 3IKLA 3KU1A 1XNHA 2ORYA 3OHSX 4BN4A 1XYGA 1GUFA 5MN5A 3Q6IA 3AK4A 2IYRA 3G13A 3LBIA 1A9OA 2YZ7A 3V7YA 4ZHSA 1T0HB 4ZK2A 1E66A 2I65A 2HIHA 4AJKA 3JQFC 2IBTA 5FL7D 1NM5C 1UKYA 2YOGA 3OMWA 4NNJA 3RU2A 4EJ6A 5I7OA 3CLSC 3OTWA 1H5QA 5MDHA 5IVDA 4UXJA 4I3HA 1JKJA 2PPLA 3U7FB 1LC0A 2R4QA 2IC5A 3NHSA 4G97A 4LNUB 2F9LA 3RRBA 4CKWB 5AVZA 2QB5A 4JYCA 4R68A 5B37A 4WNYA 3ZPXA 4RPJA 4XQGA 3OPNA 3ELUA 2FUG1 4ZCSA 1AA6A 1PWYE 1YJ5A 2DUNA 1K6IA 3UAZA 2R8PA 3GD7A 3AZPA 4MICA 3BF8A 1RU3A 5DX8A 5HOEA 5I47A 2ODWA 3KKEA 1SOVA 3E81A 1F0KA 3CGGA 3HP1A 1I5OA 4KE9A 4URXR 2HLNA 4L6CA 1Q0PA 1FVHA 1MPTA 2P3SA 3KYLA 2XNJA 3ENZA 3OZWA 3U4IA 5IKEA 1HURA 3VDNB 5E1OA 5KHAA 4D82A 2PRIA 3IEVA 1QUEA 1KZ4A 3DHNA 2Y0PA 2F43A 3ITKA 3NS7A 3CW2A 1U2RA 2AC2A 1OD6A 5F9HA 3QPAA 2XCUA 4BC0A 1EYZA 2RHHA 1GCUA 1Y6RA 3B60A 4MA5A 4AICA 3IO5A 2QPTA 4DNQA 3COJA 3I2YX 3GTPA 3FGPA 2C0QA 4RGBA 3QMMA 2AN4A 1RBMA 3KHTA 3ZN2A 1W2GA 4EVSA 2CLLB 3ICQB 2ZSEA 3KOOA 3GQVA 1NQOA 1P72A 2R44A 3EA4A 1O03A 1YBVA 4GXQA 3TLKA 5EP4A 1C5KA 4HLUA 5GADl 2AOUA 3TZLA 1Q7RA 4JKYA 4WFQA 1KMHA 1MOSA 4EGAA 2GAIA 1TTTA 4JI5B 4LWZA 2E6UX 4AQDA 2QI9C 3QF4B 5DGIA 1D1TA 4HYQA 3VU9A 1UPCA 3G1UA 4FX2A 2NVWA 1F0NA 3BC1A 1ZW1A 4UEOA 3LPNA 3D6VA 4B84A 4LJ4A 4I5EA 5HF9A 1FSSA 2FCAA 4YT5A 4O1HA 4DSUA 4C4RA 4EVRA 821PA 1JDVA 3AJDA 1IBMB 3DCYA 1RBYA 3P45A 2X3UA 5J58A 2BSQA 1V71A 3K72B 1AU9A 1UP7A 2C5FA 3IV6A 1RWNA 5E4JA 4JJZA 5D86A 1W5AA 4YCJA 5AM4A 3VNAA 5CLJA 1SKBA 1NVWQ 4AN8A 2P90A 2QRNA 4PR0A 1RKBA 3Q3JB 1LRLA 1UMCA 3CSUA 3EQZA 3BYZA 5CH3A 3WA6A 3Q9UA 3RJ9A 3SJUA 1VYHA 5ENVA 2RGBA 2PX8A 4MUBA 2PFKA 1PR9A 2GB4A 2WAOA 1VB5A 1WZIA 3CB2A 4LF7B 1G8YA 4AJIA 1SVWA 3F5DA 5JJKA 5BNZA 4P0PB 4O1MA 1W87A 4BFUA 2DQZA 2C7OA 4BVAA 4P2BA 3L0OA 1B93A 4EZEA 5BN3A 4ZGGA 2ZAMA 2V1XA 2P1ZA 3K58A 1C9DB 1XDDA 2AVNA 3V7WA 2CFTA 2KQUA 4FLMA 1KSHA 1GNVA 4JCCA 4UQPA 3O91A 5DBEX 3MJSA 4KLNA 4CCAA 2P3LA 1V6CA 3AIKA 2X6TA 1A1VA 1A31A 1JEOA 2ZJ6A 2GCOA 1BWQA 1XA4A 4X1KB 1CIVA 1V7CA 2H6EA 2G4VA 4KYUA 5D1NA 3RVLA 1N1EA 3RSOA 2H7XA 4L0DA 1PR2A 3T4UA 1AX9A 3ZHYA 5H4HA 1XQVA 3TFWA 5EIWA 1HFKA 4QUAA 3IPYA 4Q9HA 4CQJA 2GD1O 4UOZA 1GZHB 1NPTO 4RIHA 2CHUA 4WN3A 1FRQA 1PNRA 1XWFA 3HUDA 5GAJA 3OIYA 3OX2A 1JIKA 3HV2A 4JVMA 2I76A 8GPBA 1OFUX 3IKTA 2NYAA 3LY9A 4I6EA 5K3SA 3IEMA 2OOSA 1XDGA 3DNMA 4ZAXA 2H2HA 2KM1A 4PG6A 1XAIA 3FB4A 4HH3C 3T7JA 1JR3A 3NEYA 4D98A 2ZJ1A 4AKSA 3EQ2A 3F78A 3K1AA 4G1EB 3G2KA 4Q16A 1HZJA 3WIVA 4QULA 1ZJWA 1SUBA 2B4KA 1O89A 4PC2A 3V7FA 4AP6A 1V37A 1XV5A 3REGA 2VJYA 3TSWA 1NY5A 1C3LA 3N6RA 4LOIA 4TV9A 2QVYX 4BO8A 4CCYB 4TMKA 3RREA 4EQ6A 3B6ZA 4BJ1A 4EHHA 4TKLA 2HWYA 1Z4QA 1NUSA 4PLZA 4Y6RA 5EERA 4CM1A 4XVRA 4TYYA 1W4RA 4G81A 5H1YA 2W48A 1DCMA 2ZB4A 5DSTA 5AUQA 2F48A 3BTSA 5DO9A 3K70B 1ONBA 2CWWA 3IURA 3P1JA 1OYWA 4G5QA 4OQZA 4TLDA 4JXXA 1DV1A 5CTAA 3K16A 4JUCA 3QUQA 4MIEA 4U2DA 3BJIC 3Q6MA 5DOZA 4LY9A 1DWQA 2WOOA 4MR9A 1QVAA 6YASA 4WDRA 5AM5A 2BR4A 3FSEA 1E3WA 3GAZA 4DQVA 1E3MA 4OV6B 2MR6A 3HDVA 2VSYA 3PR1A 2OT3B 3NT5A 4LWQA 4PNZA 1ULUA 2QRHA 3GJ8A 1W6RA 3DMYA 2I9KA 2UUOA 2L2QA 1JVBA 2VEDA 4HNAB 1RPZA 1XLVA 5EXDA 3JVVA 3BJZA 4YYEA 1GZ4A 3S44A 1QWOA 4UARA 5CFQA 1QR2A 4YALA 2ZRKA 4IS3A 3RSZA 3ZXIA 1JHVA 3G6WA 3N28A 4I3FA 3RQSA 5REQA 4DIBA 1FLAA 4NFYA 4YJ3F 1LV7A 3EEOA 3SD7A 4EKEA 2FZKA 5F52A 1RM0A 2LZ0A 5AHKA 5A9RA 4JV5B 1OZ0A 4LJKA 3BS4A 5LJIA 1OU4A 4ES6A 1NM5A 1TAGA 3M83A 1GPDG 2YXEA 1G16A 4MZXA 3AESB 2VUTA 4L8WB 2IEZA 2TSYB 3O84A 3AJEA 3PGLA 1ZAYA 1T0IA 1M0WA 4BGEA 1Z5GA 1ISIA 3TKYA 2OZKA 1AO3A 3DZJA 1EK1A 2B5WA 3UTDA 3EASA 3RUCA 4CIXA 2NU9B 2W2LA 3K96A 2RK6A 2PRKA 4RE5A 1ENZA 4C03A 2IYOA 4RD2A 1A8UA 5HJ7A 2J0SA 1BQEA 3UG7A 1U63A 4IKEA 1NXTA 1L5VA 3GLRA 1FRZA 3RYIB 3VUEA 4Z1MD 1ZJ4A 4QBKA 1BCSB 3CLRD 5HG0A 3MWFA 5ETJA 3WQBA 3OCJA 4BX8A 4H0FA 4P5PA 5AMXA 2NUTA 5DASA 3SEZA 4BMYA 3NJ4A 5KU7A 1KZ7B 1PFVA 1AKEA 4C4TA 2UZ3A 2DY1A 1G5PA 1N5IA 1V16B 4FFDA 5CA0B 2FHSA 2G71A 1JG1A 5IVKA 1QUFA 2R5FA 2BMDA 1CS0A 2C5HA 4CIDA 3LW7A 3HO6A 4GMGA 4GI1A 4RS4A 3RSQA 3UY4A 1NUQA 5B57C 4AWXA 4LZNA 4U6SA 3THWB 5IC4A 1L5FA 4I1OA 4ZIRB 3IP6A 2AEMA 5AVSA 4UJ5A 4RELA 3RTBA 5KYGA 1ZD2P 1KVQA 2RG1A 1VGQA 5LKAA 5F35A 5E7MA 3Q3IA 1KWGA 2GYYA 2W71A 3U4QB 4H1VA 2ZWOA 3M70A 1HX7A 1GPYA 2P4SA 3CWZA 5BYBA 3V8BA 3A10A 3RC3A 4B48A 5F1KA 3OCWA 1Z16A 2BZSA 2E1RA 4G86A 5JEEA 3AWIA 4JJKA 3WJ2A 2VDUE 2ZRCA 5AHWA 2Z04A 4UOEA 4MRVA 1XMQB 1C9MA 5DM0A 5C80A 1CW2B 2QNBA 4D4KA 3L05A 3ESDA 3PNKA 4KBYA 2EX0A 3AG6A 3OAAD 5B36A 1DRWA 1G2IA 4H15A 1G20E 2YY5A 3PFNA 4RM3A 1ZIYA 3WS7A 5JV5A 2BH2A 1M67A 4EMSA 5L6MB 2DBZA 3ZHVA 1Q1AA 5JJ5A 4F86A 4V1CB 1N1DA 2DU8A 2O5JD 3C3KA 3LDHA 5GPBA 5JALA 2EIXA 2VNAA 1E4EA 1UC9A 1F9AA 3STTA 3V6MA 2C9YA 2X6QA 1VJ0A 2GTPA 3KKNA 3O1JC 3OE7A 1BG6A 3JD3A 2BTEA 1XTJA 4RK5A 5LZ4A 2ZVPX 2ZYUX 3CZRA 3VRHA 3LECA 1EWKA 4FGZA 2HU5A 5DLPA 2QL9A 4ZVSA 1AB6A 4DGSA 9LDBA 2L82A 2Z6AA 1CG6A 1SUEA 5BSKA 5LVAA 2AX4A 5A6VA 2TRSB 4J16A 4XVQA 3DHVA 1P3DA 1VIYA 1OYOA 1PJQA 4PHCA 1E8DA 3DKKA 1J4AA 1JH8A 5CVDA 4A3SA 3U7EB 4MUEA 2VJQA 4LOHA 1VXOA 2PS1A 3OWHA 3PX3A 1ESEA 1JHMA 1N5JA 1SULA 2FVYA 2Z30A 3ET5A 4LRXA 4QGAA 4Z53A 3ZHUA 4U6QA 2WE7A 4BO5A 3AHCA 5KX5A 2XEDA 3PLAE 1GNQA 2YVLA 3R9IA 2WZBA 4QU9A 4QIWA 3D2AA 2NUAA 2V9CA 2Q3CA 1KIFA 2EJBA 3MJHA 4R8KA 2BKXA 5JNRA 1VECA 3VYSB 3DWEX 4QATA 1WABA 1QHHA 1M9NA 4G8BA 4O2RA 1NW6A 1RM4A 4XIGS 4YJFB 1E5TA 1WLYA 4HQ6A 1XHLA 2HJ9A 1HQKA 1WW8A 2EG9A 1GRRA 2ERYA 2G6TA 3TVDA 2JGDB 4TROA 3HGQA 4Y6LA 2C7RA 1OXVA 5ITWA 3GDFA 3OEHA 3H9CA 1RAIA 3A36A 4URHA 1AOXA 1C3EA 1O96A 4HADA 4N9WA 3BJEA 1IWOA 4JBIA 2QAGB 3L0IB 3VNVA 2EP7A 1OB2A 1GITA 3O4FA 2DEUA 2AQHA 5CGZA 2DE0X 2F8TA 3KNZA 3EODA 3T5MA 2ZJ5A 3HH8A 1MORA 2ZR9A 1RACA 3CURA 4H6XA 2JH8A 4NJMB 5TF0A 3WGYA 1Q50A 3QKIA 4HPJB 4QELA 3ZTYA 1JN0A 3M6IA 3B6KA 2SECE 4EHBA 1XZBA 3AEQA 1H94A 2WEKA 3HBAA 1IUOA 4MVJM 4D0RA 5FORA 2IH4A 1Y1LA 1Z73A 2PYIA 4WY5A 3OZUA 5IM4F 1D09A 1Q7CA 3A14A 4TKZA 3TG8A 3EY4A 4YVFA 4XWKA 4WWHA 1SUAA 3FOCA 5JSKA 4F3YA 4UTRA 3SYTA 2P27A 1EVKA 3D0RA 4XCXA 5CD9A 1L4YA 4J0HA 3U7QB 1J42A 2Z5GA 3CH5A 3QJGA 1BVRA 1L7OA 4NONA 4NIMA 3K1TA 2JLCA 4AF7A 5LIRA 1EXVA 3TTUA 5C18A 3JQAA 1AJEA 5GONF 2H65A 2CHFA 2XB2A 1PGJA 4ZJYA 3CTMA 4DEXA 3GL9A 3HO8A 2BLNA 3EJ6A 4X94A 1X3SA 3G0GA 4HDKA 2QZJA 3DD1A 1L5GB 2AJBA 3V80A 3SX4A 2GM4A 3L79A 1X9HA 4Q18A 3P2JA 1KZ1A 2QPLA 1E2MA 3K8QA 5IARA 3D6NB 2FZEA 1WO8A 4NU6A 1C30A 4FMPA 1TIPA 4FHFA 1XWIA 3DU5A 2FGJA 5DK4A 3W2EA 1UBNA 4RGVA 5B53A 3GLKA 3M9WA 3NHKA 3NG1A 3WL7A 4CEIA 2YCBA 1VCOA 4MWCA 1QYRA 1ZLXA 1GDTA 1CHDA 1KZYC 4URFA 4LFCB 2BTOA 3HB0A 4XIJA 5BNTA 1VE9A 3KP1A 1O4WA 2H7YA 3KOXA 4HDNA 5KYUB 1TL7C 1JNXX 3LF1A 1H9CA 1GN8A 3K2BA 4ASUD 3DE7X 3WLTA 2G9UA 4G5YA 1XKXA 5C8DA 2JGJA 2J9XB 3CXUA 3UV3A 1LTKA 3DZHA 4YRKA 1PVVA 4HF7A 5KNBA 1C9EA 1LBTA 1QTIA 3PGMA 1OVGA 5BYAA 2O0MA 2ZTHA 5HHTA 4WDQA 1TKBA 3LRPA 1JKFA 2ABWA 4B87A 4Y9DA 5MF6A 2W2VA 2O7RA 1T8WA 4MARA 1FJGB 3QE4A 3M82A 3CEMA 5BORA 3F2VA 1AS0A 1XI2A 2WJGA 3QRWA 5KTNA 3ME5A 3DVQX 1A7KA 1IXRC 2WUWE 3MXOA 4IKOA 4J4HA 5EFZA 5J59A 3Q7PA 4L6IA 3INRA 2IEAA 3VC3A 2JJ2A 3IQIX 1CJKC 1NG1A 2PZFA 3Q11A 4JN6B 3TIGA 3TLBA 4A8JC 4BYGA 2Z1MA 4BQEA 3Q8MA 1VGVA 3VC7A 2XIQA 1K0FA 4AYWA 2PCLA 2DULA 5LC1A 1R6DA 2OBNA 1DKOA 1PZXA 4BV8A 5FWAA 3TZKA 5CXSA 4DUYB 1FTGA 3ESCA 5JSZA 1RKQA 2D74A 4Q1CA 3RAFC 1GTRA 3OF2A 4POAA 4QUKA 1W30A 3QWFA 1CZHA 1MQSA 3OD5A 3S2IA 3ONVA 1R0CA 1ZC3A 3QTLA 2N9UA 1WSAA 1HLDA 3AUKA 4NMMA 5DKFA 3TSZA 2H92A 3E61A 5BNFA 1XNQB 1V7QA 4LYFA 1I2BA 1PK7A 3NCTA 3IHKA 1TMOA 1LH0A 3NGLA 3NORA 2Q3JA 1IPFA 1NUUA 2C2WA 1FPQA 4BMCA 2IX3A 3NPAA 5EINA 1M7BA 1DARA 3RTEA 4ZTUB 3COSA 4R40A 4PN7A 5DYIA 2P4HX 2ZUBA 1H22A 2HJRA 1IQUA 2WT4A 2WBLC 3KLMX 4KGVA 5KJ1A 1GUAA 2OBXA 4DLPA 4EX6A 3K09C 4DLTA 3RG8A 4QFBA 1E92A 1X0VA 4L7VA 2IU4A 5K3FB 4BBZA 2OO7A 1TFRA 4MV0A 4QYMA 3I5YA 1Z83A 5ADVA 5E0KB 3T7DA 5BW5A 2HFKA 1YS1X 4ZO4A 1EHIA 1WD7A 4OMCA 4U7HA 3BZBA 1VP3A 3AM3A 1RQLA 2B69A 1Z5PA 4IHAA 3ODPA 5ALIA 1XRJA 4MULA 2DBVO 1W75A 3JATA 4M1KA 5IP5A 1BWRA 3V9AA 1W5EA 1CZRA 4L15A 1Z3CA 1D2NA 4QBIA 2QTNA 1UKVY 1GGEA 3N2LA 1PI3A 4N8DA 3KAJA 1RZVA 4PQRA 1K0UA 2C3PA 1LTQA 1T8TA 1Y8RA 2LKDA 2XHZA 4B43A 3QJ5A 4MVYA 4AURA 5FWYB 3ZXXA 3KB1A 1K4KA 1P8JA 1Z0FA 2BBSA 3INGA 4HFNA 1QQAA 1ZBQA 3B9QA 3L7OA 4MWZA 5LD2C 2NT3A 4JEHA 3DXYA 3QE2A 1JZTA 4N65A 4OX9B 4D26A 4J7XA 3L5OA 4YAEA 2HW8A 2P41A 1CEXA 3LFHA 3PYLA 2EX1A 3NI2A 1PEKE 2ICAA 2QM0A 2Z8YM 1SBQA 3CRMA 4Z9FA 4O2BA 5JI3E 1WB4A 3OQBA 4I9NA 1SRRA 5JAOA 1H5UA 1L1EA 1YQEA 3KVNA 3ETNA 3SEAA 3G7SA 2BCJQ 4I7EA 2XMPA 5ALEA 2P9TA 2YC4C 1YVRA 3B1FA 3EGVA 5L51A 1EG2A 1TTPB 1MO5A 1L7DA 2WYOA 2Y0EA 4HG2A 4R5HA 4RL4A 4OBBA 1L5HA 2GEFA 4P93A 2IE8A 1EI9A 5BSRA 3AERA 3KZXA 1JVSA 4KLCA 4WOKA 5D8DA 5D5HA 1BJKA 2B9SB 1WBJB 2C5BA 3D8RA 4LXUA 5HXAA 3UMBA 1I14A 1V5FA 2DX7A 1CR4A 1G8MA 5ECDA 3GP8A 2GBCA 3PT9A 4YCBA 3QU2A 3QFSA 2M98A 1CUYA 3DBLA 1Y698 1XU9A 2C82A 2G8LA 2P9YA 3N6VA 1QRTA 1CUJA 3Q4GA 1DQPA 2ZT5A 2C54A 4QE3A 5IHPA 2KI5A 4LK3A 3V55A 5HK8A 2HYIC 3ZVKA 4OIMA 1LWOA 2BM1A 2I7CA 5IPFA 2QLMA 4JJ8A 2RGCA 3A1UA 3VYTB 4ZYUA 2GBPA 5KOIA 3T1VA 2H7VA 5HM6A 2M6SA 3TX2A 4TRNA 3UHJA 4AZ0B 4FWIB 1SPXA 4GRIA 4B3TB 1KVUA 2BF4A 1Z5ZA 2J5XA 3VPGA 5T5QA 3W5JA 1KKUA 3WSWA 4C3ZA 5C32A 5CB6A 2NZ2A 1Z6XA 3TQQA 2ZRIA 4R2MA 2Q3HA 1XZIA 4ZEMA 4BNDA 4R3NA 3PRYA 4B82A 1RR8C 2ACEA 4CM4B 2IEYA 1R5NA 1U3TA 1ZL2A 2Z5LA 2NU7A 4YWJA 1DC5A 1ECFA 2QD1A 3VYUB 1DKLA 1FMJA 5HJ2A 1M2NA 2Q6OA 2VUIB 4KO2S 2GPNA 2PUGA 1EGQA 2HA6A 4JQZA 5DHPA 3I76A 1Y48E 5IT0A 2HQSA 2G1KA 5JLAA 1KBOA 3PUKA 4AI6A 4OQNA 5C3UA 2IT1A 5E3HA 1C1DA 1V7ZA 4ETWA 2WSSD 1Z4KA 2WQZA 1KI9A 3CX7A 3GPIA 4MJLA 5JS7A 3KDAA 4PXSA 2NVXA 5G4LA 2IYTA 2A0WA 5LJLA 3GPBA 2XMDA 3ADBA 2GQ0A 1X80A 3D3QA 2ZAYA 1WZ2A 3RW9A 1FFSA 3REOA 5DI9A 2WDZA 4NFLA 1DC3A 2VH2A 2X8JB 4K6CA 3W3AA 2K2QB 3OO0A 4KZKA 2C58A 4PRLA 2W0SA 2V6MA 4CF4A 1ZVVA 2BHNA 3UGTA 3F49S 4URZR 3BG5A 2GPYA 2DT8A 2VOJA 1ACMA 5BT9A 3HMQA 1Q6YA 2V7GA 2YHIB 3PQ7A 1KRHA 1M8GA 4EUSA 1QFSA 5KYWA 2YINC 4AQ7A 3TNJA 1MN6A 1SELA 3SYRA 4DMMA 1XRLA 2DYKA 5DNEA 4UBJA 4EELA 4R0NA 3D7MA 5AICA 3M1IA 4PQYA 1CZLA 2H4JA 3IKVA 3N7TA 4HYTA 1IXYA 3SZOA 3QMWA 4I55B 1DAGA 3IHLA 1Z6TA 2OG2A 1OAKA 2OXCA 5HJ5A 4OOEA 1AQNA 1LX6A 3HC7A 1U02A 4J3NA 4A8JA 1CB7A 3LBYA 4QDTA 1WQ3A 2FWMX 5CK5A 3ICCA 4OOFA 2QP9X 2XNSA 3RYFB 2J3DA 1H2AS 3C43A 4JI2B 1T15A 3EEYA 5EUQB 1VG8A 1QRUA 4IUBS 2ZUTA 3RSCA 1M33A 1R0ZA 2Y4NA 3KLPX 5A6SB 3SFZA 3E9YA 2LGJA 3GXOA 5ALRA 5ICMA 5DU2A 5JT1A 1DBWA 3LPAA 3ZLVA 2ZWMA 1ARZA 1P1JA 3UJ8A 2B7LA 1TFUA 3EZLA 4KIUA 2AN1A 4KMMA 1M1ZA 2AJCA 5I5EA 5LP6B 1ZK4A 2YJGA 3RFVA 3K5PA 4Z7OB 3I64A 4P54A 3IMEA 3DVAA 3LUFA 1SY7A 1Z75A 4KITB 5FUQA 2RJOA 3DV0B 4IGFA 4DJTA 5KYKA 5DI3A 5EQDA 3K2IA 3OJFA 2XMBA 1FP4B 3JQ6A 5BVHB 1FLVA 1BRTA 1E4VA 1H6AA 3EXG1 5HFNA 1KEWA 4EY4A 4JSRA 3GTQA 1J9GA 1GADO 2JHAA 2X4IA 3DMPA 4G63A 4HFRA 4KO3S 5DRTA 4FDTA 4WGGA 2LTAA 2I6TA 4IDDA 4RGYA 1U2DC 4DDWA 3GTGA 5F78A 1Z3IX 3GZ4A 3M4ZA 2IHKA 2QM3A 3HB5X 1D4OA 3DEHA 3OJXA 5JHGB 2HPAA 5LXTA 4LI0A 3QV1A 1L7XA 1JDUA 3CMMA 1JJAA 4RZSA 2P2GA 1UWLA 4EITA 2YU9A 3GA5A 2FRVA 1YWGO 3FYCA 1XPOA 2WTAA 4QPJC 5EE0A 4HDRA 4KRYA 3ROMA 4FE4A 3DLHA 3G8DA 1A5BB 2N0SA 2W90A 2FUG6 3OLCX 5F7XA 1EM6A 1NJ8A 4I5GA 2V0CA 4C76A 2POQX 1YACA 3HXTA 3L1IA 2W0MA 1DIGA 3QU5A 5JSYA 4AW9A 1B6RA 2QZZA 1P44A 2W2QA 3A3NA 3DQQA 4MRRA 1NJ1A 5IFKA 4TUYA 1E2GA 1GFZA 1KZGB 1NJSA 4LS3A 2C1XA 1LY1A 1JG2A 3C3CA 3M6MD 1OPRA 4IYRA 4QDOA 5GP1A 3CZQA 4RMHA 4CLHA 3BSYA 4AG5A 5LUBA 3ANMA 1EK5A 4J6FA 2P6PA 2PGJA 3JVDA 3RWOA 4EJFA 3ZJ5A 4BMXA 4MVJF 5IC6A 3AXTA 1DJNA 4J03A 1J56A 1E2IA 1M76A 3OQMA 4YUVA 1JTFA 3FHTA 4Y2TA 4E5VA 1Z4IA 3FPFA 1AXEA 3TSAA 2FW1A 2HF9A 4L22A 1XP5A 3KOZA 2A68D 2IOHA 2DUJA 2YW9A 4WNIA 3VHQA 4FGJA 4IINA 3T1TA 1ISHA 1NPYA 3GGOA 1DUVG 3MJ4A 1WCV1 4BTEA 3BL6A 3UW3A 4FD2A 2RH4A 2JCYA 2QN8A 3DDHA 4LVUA 4JJIA 1RHRA 3DMGA 3GFRA 1ZD1A 2CBGA 3R9WA 5J4KA 1XPRA 4N0MA 2CSXA 4DE5A 1RRJA 2R2GA 4EUFA 3CZCA 2CBZA 4BB6A 1RM3A 4XFKA 1R8YA 2ZBDA 4UBKA 4IH1A 1YUNA 3AZOA 3LUDA 1PHPA 1U7ZA 1UOEA 4NJOA 3WNDA 1Q8IA 1ULBA 1BW9B 2D1SA 3ZK7A 3AINA 3T7IA 2GF0A 3L6RA 1C50A 3P2EA 4ZOEA 2J3LA 3AV3A 4WK4B 4B2LA 1REQA 2E1PA 2VJKA 3DWGA 1PYDA 3MZ0A 4UFPA 5CCBA 1WQFA 1I2DA 1ZD4A 3ZE9A 2R92A 1D1SA 1E5XA 1QHNA 2EX4A 3E48A 3H2KA 4F1KA 3AUUA 4HWPA 3HABA 5LQCA 2EF1A 3OOYA 2FQQA 3S8MA 2LUOA 4CR8A 1VHQA 1K8ZB 4US0R 4PG7A 4FFBB 3VPBA 4C2BA 3KQSA 3K7EA 4ZDJA 2YQ5A 4EFMA 4I2NA 3HKCB 3I8OA 3W9YA 2A3NA 2X8AA 1JEQA 2OOKA 4PSDA 4URVR 3LCJA 1ODLA 3Q98A 4AIRA 3NV9A 4X6YA 2EQBA 1R6VA 4F2DA 4ETNA 4BXOA 1QFYA 3CLVA 2XYVA 2NTYC 4PGAA 2R8YA 4DLNA 1R0BA 4Q7LA 2BE5D 1Z33A 1IU9A 2MWMA 2ZU6A 4EB6A 3FNIA 4JS0A 4PO9A 4HDMB 3LC0A 3H6GA 3KV1A 5ESDA 1H9BA 1IBLB 2I8CA 3JALA 2QTGA 3TDMA 1KJQA 4E2XA 3DR5A 4DAOA 1EVYA 1EVIA 3OZGA 5BQOA 2PHZA 4IDNA 4IGEA 4D1YA 3HPQA 2GTIA 1HT2E 3PT5A 4FS8A 4CDMA 2O7SA 1O6FA 1E69A 2ZI5A 1ZH8A 4KGDA 3SVZA 1QXSA 3ZWNA 1E7WA 1P1RA 1WNTA 5AK6A 3ZZ1A 2CMKA 2FG5A 1XTQA 4JUAA 4PS0A 3GR6A 3RH0A 3DEKA 3R8CA 5ITZA 5K3DA 2I80A 3BVPA 4MR8A 3TRHA 421PA 1S9HA 5L3QA 3H2GA 3S6JA 1R4NA 4MDFA 4J8PA 4YMIA 4B4UA 5EZYF 3VVMA 2PMDA 4XDZA 5HIIA 3EZNA 4BO3A 4AFNA 1TVEA 5AVWA 1YCDA 4IG4A 1O08A 2R86A 4BLQA 2H57A 4UM9B 4NOJA 1KQGA 5CA0F 3Q9NA 3FTFA 1FY2A 3MWLA 5JISA 2I2WA 2QTLA 4DFDA 1RRCA 5E6SA 3TZ6A 2LIVA 3ZQUA 4J94A 4BNZA 3UJBA 3SVLA 1P9OA 4PSUA 3OCZA 2BFEB 5BV0A 4NS1A 3NBUA 3FYUB 1P2FA 1UXJA 2CDCA 2DH6A 2FPOA 4EM6A 4EO4A 2I3AA 5JU6A 2GK3A 2AG6A 1W4AA 4CE6A 5UKDA 1AKNA 3H4VA 5EUCA 3VBCA 1I32A 2J0VA 4D4IA 2F1RA 3O4RA 2FUEA 3I53A 1I6WA 2P8JA 3D8HA 1C0LA 2Y6VA 4HQLA 4LYEA 4YRTA 4NYMR 4D9KA 3VKHA 2ZZMA 1AUVA 1T3ZA 2W6CX 3KWJA 1QH9A 2BSAA 2MINB 3DE0X 3LX6A 3UYLA 4OH1A 4K3VA 4ZQBA 1JHYA 1QRDA 3GUUA 5JFGA 5JSFA 2O8FA 5E9QA 3SHFA 4RO0A 3CZMA 3WG9A 1VPLA 2R47A 1IBSA 2R3SA 4RABA 3S2EA 4TQAA 2RAVA 3WAKA 2BMEA 3FYSA 3LBAA 3QMPA 1MRSA 1DG9A 3BDVA 3OCUA 4M88A 3AI1A 3RRJA 3VH4A 5K4HA 5IRCD 1Q0QA 3AOGA 1Z9BA 1CVRA 3EC1A 4M1EA 2IV3A 4DMUB 3IEPA 4E4YA 3BIFA 1RQ2A 1X1QA 4LDAA 1AUPA 2DHCA 2GM3A 1T1IA 1XL1A 1QF7A 1HZZC 4LXHA 3C1TA 3EDCA 1SUSA 2QL6A 2MYPA 3ZYCA 2R7ZA 2A1TS 5A4IS 3KJIA 3ESAA 3Q7SA 1RTKA 2FZGA 4XGRA 5BWOA 2WD8A 3LO8A 3TUJC 3FNGA 4MGEA 2MSKA 5GY7A 1F2DA 3GFPA 1H93A 3QPDA 3UAXA 1GAJA 1RXIA 5IVIA 1YZTA 5IKXA 2E49A 3AOEC 4G0NA 3I73A 2OAQ1 1NFFA 3IEUA 3IMKA 4JI1B 3JQ8B 4QQKA 3T5DA 4HZUA 1Y9DA 4I9GA 3C0KA 2GASA 3L4BA 4QDKA 3FNHA 4EY8A 5L9AA 4J9UE 3AB7A 4FS3A 1U94A 2OLKA 2MSDB 2VDPB 4R8LA 2NZJA 2PLAA 4DAEA 3NIDB 1D3AA 4HUTA 4E31A 2CV1A 1GTMA 4YK7A 2HX1A 3N2KA 1ZJYA 3KZCA 3VHXA 4EDHA 4QPZA 4R7GA 1ZSNA 3EHEA 5IAKA 3QEBZ 1KAOA 4PE5B 1RHMA 1ZRMA 2D7DA 1WUKS 4HAWA 1KO8A 1VHLA 1YZGA 1OXXK 1V47A 1XC7A 4OHRA 5M3BA 4RLHA 4YO8A 3HGMA 4ZCMA 2J0UA 4ZALA 1IHOA 3H04A 3HDJA 4BFXA 3ICEA 3NBKA 1XNRB 4PGHA 4F3NA 1ST3A 2JIQA 3WP0A 1TMKA 4BZPA 2HFJA 3C8DA 2KWIA 5B3LA 3K57A 1N77A 3FOAA 4E88A 1L5ZA 3NIGB 2CLMB 3NX4A 2R6R1 1DBRA 1RMQA 1JR2A 4G07A 4Q9AA 1GT6A 1NVFA 3OJEA 4J0FA 5CM9C 4A0HA 1TYEB 4P3YA 1V9CA 4R6WA 5HQTA 4AZVA 2VPIA 2ATIA 1SOMA 3U2QA 5IDVA 3RFXA 3AFOA 5FNVB 1KI6B 4RK6A 4L1KA 1THZA 2I3BA 3NGXA 3BB1A 3RIHA 1ZQ9A 2O57A 4HNRA 1NHWA 1KR2A 3OZAA 5LYJA 4YRBA 2ECKA 2WKSA 3ABOB 3ZZNA 1GDHA 3KWFA 2WD7A 2G4CA 2HMUA 3BORA 3FYTA 3N8KA 2RGNA 4I08A 3ESRA 3P9RA 4XOIA 4BNFA 3NRBA 2X6RA 5JYCA 2BI7A 2QRMA 5B64A 4XOUA 1ULTA 3DUFB 3EE6A 1TUBA 2VATA 1KO4A 2AC4A 2V65A 3RODA 3H75A 5KUTA 4JSYA 2GM9A 4K8OA 4K81B 3SDZA 3FW1A 4A23A 1O6GA 1N2ZA 5DTMA 3EISA 4HB2A 5MFZA 4ZDIA 3A6ZA 4C6HA 2PX3A 3OTOB 1QPZA 3ZV5A 4N7MA 3JWGA 2D1TA 3AFGA 3UUFA 3HKEA 2ANBA 1QE0A 3KPWA 1ELOA 4TS1A 1NXWA 1Y3IA 4F96A 1YZFA 5J4HA 1T1GA 2N1BA 3V97A 4FNOA 5ADWA 1AUOA 2JFBA 3LHIA 1PG2A 1FBTA 1XE3A 5HWSA 1WMDA 1YDWA 3WNVA 3D6AA 3DEJA 3KSUA 1B0PA 5K8JB 3TSYA 5CPFA 2IBSA 3VUFA 3W2HA 1I50A 4KI7A 4AB1A 3Q2OA 4LDZA 3C41J 1C0PA 2OO5A 3TLAA 1JSRA 5EMNA 3ER8A 3PU6A 5EHGA 2OZVA 2TMYA 2B5VA 4IXWA 4TKMA 3RC1A 3LFTA 5AQ1A 2NLOA 2Y0BA 3CT4A 1GEGA 3ZZTA 4WTOA 4RA6A 2C5SA 4DBLC 3L7MA 4L73A 3L8EA 4BGIA 1I7DA 5EMKA 1GQFA 3HJUA 3HCAA 2NU6B 2JZOA 3ANYB 3RVRA 1C7JA 4CKBB 1S3GA 4OMDA 4LRYA 3RABA 3N58A 4GR5A 3RHFA 3SSNA 3PHIA 1KEKA 4B47A 4F97A 2XCLA 4GECA 5CJPA 2I67A 4MROA 3GMTA 1JJIA 1CTQA 3IQGX 2EOAA 2PGDA 2YRXA 4KACA 4Y0AA 4I6JA 2YYYA 2XYPA 4U6NA 2FZWA 3K0CC 2IVFA 3F7OA 4L4RA 3KYIB 4NC9A 4GVLA 2UZ0A 2ZVQX 3C5CA 5U9CA 2WKWA 3CVOA 4PZZA 2GJAA 3EJWA 1LDEA 4Q82A 5JBNA 2FQYA 4P84A 4NXNB 1ZZGA 3E8MA 3Q3GE 3QIVA 4OXIA 1NUPA 5I7AA 4EHIA 1NIJA 1ZNWA 2EQ5A 3OZ7A 4RWEA 5AKJA 3VQTA 4HLNA 1G9SA 3WZMA 1FFWA 2BEWA 4R2WA 4B3RB 3TOXA 2RGGA 3JWEA 5K3BA 1FP6A 1G41A 1TYCA 5IVPA 1N0HA 1C7EA 2B6HA 1MIOA 5IF9A 1K97A 1KJ9A 2XECA 3IHTA 1P7ZA 3LHSA 3ORSA 4IEFB 3D0OA 3C5HA 1VE1A 4HX2A 4OB7A 3L0YA 2XWPA 3U4HA 3WAGA 2CJWB 2CVHA 4EBBA 1KRWA 2VF4X 1RP7A 2WIGA 1CUBA 3IJEB 5AVYA 3RT1A 4G0WA 3NTXA 1RYMA 6REQA 4R5MA 1KMNA 2RGWA 2BFDA 1M10A 2IYWA 3QY9A 4FKZA 5KJFA 2AG8A 3BWBA 1U99A 4PPFA 3RI3A 2AZMA 1AB5A 3I9FA 1ZL0A 3GNQA 3I34X 3K0EA 3IQXA 3NEAA 4H1TA 1A7JA 1X94A 3KD2A 5M7EA 2FMUA 1O97C 1TQHA 2IDKA 2AFIE 4L5JA 1R64A 4MYDA 2G83A 3HCEA 4F91B 3HDTA 1W36D 3HZZA 4BMVA 2GRJA 4ATNA 1UOOA 2K7ZA 1EP3B 3DHYA 3D6UA 3WIDA 2PD3A 2NO4A 4IFBA 2X3FA 4CMIA 3HUFA 1TA9A 1OOEA 4GPAA 2JCSA 5F73A 4LHWA 4RY8A 5FOXA 5THQA 1SXJD 1EJ2A 2FPKA 2RB4A 3ZXUB 2RHBA 2FSUA 2O23A 3ACDA 3PUIA 4TTQA 2GCPA 3DT9A 4KX3A 3RPEA 1BQ4A 1UP6A 2O2IA 3KRTA 4DADA 1M6VA 2JBAA 2WV9A 2J3IA 4B4WA 1MC5A 5H82A 1FYDA 3STWA 3QVSA 4QASA 1J0AA 2NSHA 3VPCA 1TYBE 1T36B 4GKJB 1XALA 5I8ZA 5PGMA 4BLUA 3W5AA 2R79A 2VH5R 4ARZB 1G2PA 4DLXA 2AXEA 1NLZA 2DR0A 1KKMA 1KNXA 3B1VA 4TMFA 5DLQC 4A6EA 3FFWA 3U3XA 1UQUA 3FCYA 2BFNA 2LVBA 1XZFA 3NR2A 2NQTA 2R6CA 2FX2A 1F7UA 3VKFA 1K06A 2E3JA 2IE0A 2R8OA 3NONA 2JGRA 1LJLA 4M8IA 4ZT4A 2P5SA 5AM1A 5ICEA 2VXCA 1OLUB 4ZC1A 1P7YA 4JC5A 3TVTA 4C0QC 2Q6IA 4KXNA 4N5LA 2HLDA 4JVSB 1P5ZB 2NO0A 5HZMA 4MGHA 1XT6A 3IBGA 3TH5A 1QR6A 4TTRA 4WZBA 1GNTA 3DFZA 3QW2A 4LMRA 4NEHB 1QB8A 2CDNA 2JFFA 2NYUA 4KQGA 4PZCA 1H85A 2GEVA 2EJUA 3PJEA 2QIOA 3RHSA 2WHPA 1OH5A 3ENVA 2Z4RA 5CX1A 4H3TA 2IHBA 4JASB 4OGLA 4ECAA 1XDZA 4JC0A 2BN4A 1R0YA 3HVJA 4EHLA 3CLRC 1GU1A 5DN6D 3ZW7A 4G0UA 1MA0A 1XMXA 1UDRA 1LRKA 4YP0A 4QNNA 4PAMA 1FDRA 1Q19A 1JFRA 2QPOA 3PJFA 1NYQA 4YMUA 1MNQA 3IRUA 4A0FA 4LJYA 3PRHA 2A9OA 5LZ9A 4KIGA 1J5EB 2VR1A 4MWBA 4YRFA 1K6XA 2QRZA 1ANKA 3GAMA 3H5VA 2WU8A 4Q9NA 1QM5A 4PZYA 3RS4A 1W25A 2BM9A 2B5OA 3NPMA 4PLPA 1NW8A 3GT3A 2VJPA 3G0IA 3B36A 1RRVA 2OHFA 4ND1A 4G1CA 3SOZA 2C29D 3IH5A 1QLWA 1U5CA 5K8LA 3TAUA 2AUNA 1COZA 4R1PA 2JJQA 4BAUA 4EG7A 2NP7A 3K05A 1Q15A 2B1JA 2VXYA 3E3LA 4CM8B 5JD5A 1BMFA 2XUPA 1F5SA 1C1YA 1UBGA 1FEZA 4A0RA 2VNHA 2WLSA 3WOVA 2Z6VA 4QGBA 1JLLA 2IU0A 3RS0A 3MB8A 4IDEA 2HXYA 2PQ0A 1ZWKA 4Q3LA 1AS3A 1HDCA 1JYEA 4GPIB 3K4HA 5LA6B 1CJCA 2D13A 1A8PA 2QRJA 3E3OA 3M4XA 1YBMA 3ZDFA 4DARA 3VTKA 3OICA 2C98A 4HDSB 1BFUA 2C57A 2XQKA 5CGQB 5T7BA 3MSXA 4UEQA 3M6LA 4S3MA 5FPKA 2CVOA 2QGNA 4HL6A 4L74A 3E18A 2JGNA 5IMBA 4CMKA 2GXQA 4DRXA 2OWEA 3V32A 5A3JA 3WQHA 1JPNA 3GAFA 4XI9A 1YBHA 3AILA 4XLTA 5CX4A 2PL3A 1TKRA 1Z4MA 3G6KA 1WKCA 1JU4A 3O90A 4MGZR 3RWMB 1PZGA 3VZPA 2BJVA 4W9NA 4P53A 1D2GA 1EP2B 2X5NA 2Y93A 3A27A 1E58A 3CA8A 3ENQA 3FCUB 3HCPA 2YV3A 4PV7A 4QNRA 1AV6A 2HQBA 3ML1A 3KOMA 3DULA 4JHLA 4WQMA 4ITRC 2O6HA 4EAAA 1DUSA 3ELWA 3GARA 3PGKA 3KLOA 4J43A 4G4JA 2C2ZA 3L7CA 1YZUA 4L2IA 4LJAA 1DAMA 2D2FA 2YYSA 5EOVA 5E2BA 2ZDHA 5A4MS 1YHNA 2ZB2A 3CEPB 1GGKA 1YTLA 4JBXA 2BV3A 1ORVA 5E8JA 5FPPA 4BNJA 1JLSA 3SBXA 1M2FA 1MP0A 2JC3A 2SKEA 1SR8A 3LLCA 4G0MA 1IQPA 4KO1S 3E4CA 4E30A 1SPBS 5HUHA 1QGED 2CN1A 4M46A 2PANA 2IU3A 3TLCA 3O75A 4I55F 3FHCB 4BY9E 1Z2DA 2QUAA 2XDQB 4OXRA 2Z9DA 2D7JA 1GG9A 2C94A 1RKVA 4OJQA 1VSVA 5G4KA 2BFCA 2E18A 4Q5VA 3ON5A 3ASZA 3GZNB 4BWYA 1EBBA 1KZ9A 4G09A 2VP9A 1YCHA 5AP9A 2QLNA 2GJ4A 1GYQA 2BGRA 2AOXA 4GNKA 2D5LA 4M36A 2J07A 3LT0A 2RGAA 3AVTA 4IY1A 3LDUA 3HKZA 2O8VA 4Q93A 4NY1A 1CJVC 2HLDD 4UBMA 5IAAA 5EMJA 3E05A 1NBWB 2Z08A 2GFIA 4KPUB 4FYXA 4EPTA 4QGSA 1VCMA 1MMFB 4X97A 1NW9B 1PYGA 5LP6F 2PV0A 3WZ2A 4GYKA 1XEWX 2XXJA 3M0EA 3N70A 4OP3A 4Q4HB 1CNFA 3N0RA 3PI7A 2OHXA 1MABB 3K0AA 1KO1A 3PL5A 2IPOA 2DHDA 3ZTWA 3TR6A 2GSDA 2O2EA 2IEGA 2V54A 1E60A 3A3KA 3RRXA 5DNCA 3OZTA 3SFTA 3HYNA 2H4FA 1GPBA 3WGTA 4GU5A 2Y1CA 1NBEA 2IX9A 3E7PA 2PD4A 4KJXA 4WXYB 2NV0A 1RCFA 1SCKA 4G2NA 2CT8A 5T57A 1K2WA 4GP6A 4OBEA 1GCOA 2H06A 5F2OA 3A6GA 2PZLA 1WMFA 1K08A 2VC2B 4MX8A 3WWOA 3THXB 2PSDA 4QGGA 1RXEA 5I7WA 2ZR0A 3SIPA 4HNVA 2OXIA 3K53A 1FFXB 3RV4A 4KODA 1ZW6A 2PSJA 1X7YA 3EC7A 1CQZA 4LZLA 4D9NA 1HQMD 5BW4A 4RTOA 3L4JA 3EBLA 2JLZA 2NNLD 1GL3A 1HDYA 5IG2A 5IXYA 4YDQA 2ILTA 1SCQA 4MVWA 4PZPA 1JXQA 1NF3A 3NYWA 2ECFA 4L4SA 4NHEA 1BMFD 3AUAA 2O0LA 7MHTA 2NX2A 2BH9A 4Y9TA 1KDVA 3IIKA 3ROPA 3V34A 3HHEA 4Z49A 3A1TA 4QECA 5CDYA 1M34E 1N8KA 5FLXA 2PTGA 3T5PA 4EA6A 5BUZA 4EJSA 1ATZA 4K9NA 4EA7A 5CAEA 1SKYB 1G8FA 3Q3CA 1KQOA 3I01A 5JQGB 3M1LA 4OYLA 1Q7TA 4Q00A 4G0VA 4NPAA 2WFLA 1E4OA 4RMGA 1OV4A 5CYFA 3PNLA 3JTEA 4JLPA 4MQFB 2BMFA 3MCTA 5DCYA 3ZGZA 1GOTA 3VPFA 4OL9A 5I01A 3Q1KA 3WGJA 4OYRA 2BSXA 1HEYA 1IDOA 3KSDO 3LUGA 2GM5A 4KR6A 1BDIA 1W52X 2FSIA 1SC6A 3NWPA 4PFQA 2Z4SA 1A5SB 3DH0A 2ZIXA 4PLYA 2HCBA 3IAYA 5KVSA 1SU8A 2V4UA 3RRFA 4B33A 3SNHA 5I8WA 1PJLA 3RS3A 1LJUA 1SC9A 3NUGA 3A0UA 4Y2SA 1OGYA 1ZO8A 4NENB 1KY5A 4Z4GA 4FYYA 3VGPA 3NLLA 5EVCA 4C4XA 1GUZA 1AKMA 1PD0A 2NSLA 4WHMA 3K0SA 2WWFA 1R4MA 2AJ8A 1E64A 1T8SA 2OZLA 3T4PA 2R65A 1YB7A 3JS5A 2FEOA 3AEKA 5GV8A 3HVIA 4MK4A 1O7JA 4EHFA 3MAJA 1XIVA 4RW0A 3Q85A 1C2YA 4KIJA 4GPTA 4U7FA 3C3AA 2AFHB 2FJ0A 4JT2A 4YT4A 5LZ2A 1IXZA 5HBGA 4RV5A 1DRJA 1UEJA 3HKDB 3G5UA 5ALGA 1G2OA 1F12A 2XQIA 2IQIA 1X1BA 2H85A 3H1GA 3OE5A 3OETA 1ZIDA 4N1AA 1OWOA 1M0SA 2Q8PA 2BONA 5CLLA 2W70A 1R9TA 2PKXA 2E0IA 1QYXA 3H5OA 1VYVA 1Z68A 3PFWO 1P9NA 1RLIA 1LTHR 3KEMA 4JVLA 4MLDA 4NCJA 4OP2A 4P92A 4Y0VA 5CHYA 2C88A 2YYAA 3X44A 5I4KA 3JVUA 3HRHA 3G2PA 4P81A 4CKCA 2AKAB 2C2KA 4KXFB 5C5IA 1FQOA 4YNBA 2D4HA 2FB9A 3SR0A 4CMCA 1WMSA 5KOHA 2JLUA 1TO1E 5ALTA 3QNWA 2FOLA 3EUAA 2V7EA 1X8LA 3LZCA 4EFNA 3TFOA 3BJRA 3C6BA 2I99A 4F8JA 3ZCXA 3RUDA 1O57A 1JKJB 2IXEA 1Z8FA 2GDJA 2OSVA 5A5EA 1T1EA 1U5AA 1FSZA 4X7PA 2PY6A 1WHSB 4YPFA 3GLIA 1V26A 2A9PA 1D5WA 4EHDA 5JSZB 2DOKA 1UT6A 3GJ4A 2ET6A 2VK4A 3K15A 3I3SR 3LOQA 3V2IA 4XWWA 1JDPA 2ZIZA 5JSUA 2CE2X 3BRWA 2GBLA 3IEXA 4AY6A 1UXKA 5KINB 4D5GA 1JWAB 4BU1A 1Q0ZA 3I0NA 3QM1A 3OD1A 4JT8A 3UB3A 2V7PA 1HEUA 4LXIA 4DCGA 5A3VA 1TJPB 3VO8A 4BASA 3TQOA 1MJGA 4RNCA 3WFZA 4OGKA 4LOAA 4LKOA 3UENA 2QQFA 1GHTA 2G9NA 1CDEA 3MWGA 2UVPA 4LNHA 4RVUA 2QUIA 2RHGB 4UNIA 3ZE8A 2FG7C 2ERXA 4K26A 5DHRA 2FF7A 2XMZA 1QLJA 1HM5A 3VSBA 3FRIA 2WF9A 4PX5A 3RS2A 4OHWA 1ZQ1A 1SKMA 1J8YF 4EGFA 3IL2A 4PXAA 3KPYA 3TQSA 3DBRA 4MDHA 4CQMA 2DHEA 4H4EA 3AR2A 3IPXA 1U7XA 4HWGA 5TMDA 4J49A 4ACBA 1OGJA 1JVNA 3EUFA 4MPTA 5KYNA 4DR1B 2I2CA 4MUAA 1IG3A 3FLMA 3H8WA 1PWEA 1DOAA 2IUYA 1KGSA 2R62A 1K7SN 3NRCA 3PPWA 5FD8A 5IZCC 5HMLA 3EPHA 5I4BA 1YL5A 3D8UA 2AOUB 1A9QA 2GPSA 2W98A 4EIWA 3L6UA 3GHYA 3KR9A 3WFJA 4IQ0A 2JGAA 4Q34A 4U9UA 4A1OA 5ES4B 3ZDQA 5HUQA 1WIWA 4N0DA 4QU0A 4EZIA 4FFRA 1XR3A 2X14A 3E22B 3O73A 4B6SA 1M6EX 4K6MA 4CHTA 4IGIA 2Z6UA 2X42A 3OQNA 3SNKA 3P9KA 1E1CA 4RPGA 2AI1A 1QQ7A 2KE5A 4WA7A 1BIFA 1WULS 2GK4A 4ZICA 3MD0A 3H1BA 3LSTA 3TGWA 3AF2A 1P19A 4AO8A 1EFPB 2DTEA 3AFNA 3PGJA 3GNLA 4Z0PA 1G59A 2JFWA 1JEEA 4XB1A 2Y2VA 2HF2A 5JZMA 2O8DA 2BHRA 1SZPA 1Z25A 4HXEB 3UBTA 4OI1A 3CMCO 4FW8A 1XG5A 5DP1A 3IDAA 4YP7A 3NNNA 2F3PA 3SEFA 4TSFA 1T13A 2DUMA 1OZHA 1R0RE 1RMYA 4EENA 1BGWA 3RIGA 4QZVA 2MYNA 5LR6A 1XVVA 3LE8A 2IHJA 2CXRA 1GU0A 3CRNA 1ZU5A 4B4KA 4EY5A 5BP7A 4PVDA 3EOAI 1UBMS 3EXHC 3FWPA 4NYMQ 5AKLA 1CRZA 3HJRA 1RYDA 5AW9A 1X9GA 5I9MA 5TVGA 4I1PA 1US8A 1PT9A 4JD5A 3OJWA 3F4BA 2MU1A 1DKUA 3PHBE 2I87A 4MQEA 4GOJA 4BDSA 2YOFA 4NG4A 4XPIB 2NACA 4ZD6A 1L5SA 3IBYA 5GV7A 2V5UA 3TLEA 1WAMA 4KE7A 2GCOB 3DSRA 5ILQA 4DJAA 3I28A 4GX2A 4JWTA 3HN2A 4RIIA 1T1SA 1KH2A 2XGSA 4UUBA 3WGNA 1E9SA 1MO4A 1ONNA 3UUGA 2WJYA 1C1XA 1I7QB 1VLLA 1YSCA 3RVJA 3CYFA 3RUHA 2VDJA 4XIIA 5EJ7A 4RD3A 2AE1A 3FR7A 1QHFA 2CMFA 3QUBA 4EG1A 4ITUA 5FUWA 4C29A 3KETA 2A5FA 3RS7A 1N57A 4BX0A 4U5QA 5BW6B 5KHOC 2JJ1A 2C8KA 4L16A 1USGA 5H9VA 1ZBDA 3D3NA 1M72A 3PL1A 1DBPA 1NMZA 3ADCA 4IJ6A 2Q2NA 4Z3OA 3GLGA 1PV4A 4UCXA 5AKHA 2WMOB 2J3EA 4HB0A 3GMSA 5A4JA 3EVEA 3CVJA 4QARA 1X8JA 3KO8A