4NOKA

Crystal structure of proenzyme asparaginyl endopeptidase (aep)/legumain at ph 7.5
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
404
structure length
404
Chain Sequence
KHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legumain
publication title Structural analysis of asparaginyl endopeptidase reveals the activation mechanism and a reversible intermediate maturation stage.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 150
structure length 404
sequence length 404
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4nokA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nokA01
4PRZA 2H5IA 2QLBA 4QU9A 4M9RA 3R7SA 3D6HA 4EJFA 1I51A 4AW9A 1RWXA 2CNNA 2QL7A 2QLJA 4NOMA 4FEAA 5I9BA 5LUBA 3SIRA 3NR2A 2QLFA 3DEJA 1NW9B 2H4WA 4JR2A 4EHNA 2CNLA 3H0EA 4ZVTA 3E4CA 2FUNB 2XYHA 3S8EA 1K86A 3H1PA 1QDUA 4NBLA 3R6GA 2Y0BA 4DCOA 2H65A 5IARA 4N5DA 1SHLA 4QTYA 3NS7A 4DCPA 2H54A 4ZVQA 4FXOA 3H11A 4JR1A 4EHAA 1ICEA 3QNWA 3R5JA 4N6NA 1RWOA 4NBNA 4NOKA 1NMEA 2HBQA 2HBZA 3R7BA 4QUBA 3KJFA 3KJQA 3V6LA 4QULA 2J31A 2HBYA 2J30A 2Y1LA 3DEHA 4LSZA 2XYGA 4QU8A 4AWBA 2XZTA 2QL9A 1RHMA 3DEIA 4NBKA 1JXQA 2WDPA 2J33A 2AR9A 4JQZA 3R5KA 4EHFA 2H4YA 3GJQA 1SC3A 5JFTA 4QU5A 1PAUA 3R6LA 3S70A 3V3KA 5IC6A 4JR0A 3K7EA 1F9EA 1BMQA 1RWNA 2H51A 1K88A 3BIJA 5IANA 3D6FA 4ZVPA 1GQFA 2DKOA 4D3ZA 4IEFB 5I9TA 4HQRA 5IC4A 3OD5A 4QUAA 1NMSA 4HQ0A 4DCJA 3PCXA 1KMCA 5IBPA 3V4LA 4N7MA 1NMQA 2XYPA 2H48A 4QUDA 4JJEA 4EHLA 5IAEA 4QUIA 1I4OA 2FQQA 3H13A 4N6GA 5LUAA 3KJNA 4PRYA 5H0IA 3EDRA 4N6OA 2C2MA 1RHRA 3ITNA 5IAJA 4D3YA 1QX3A 3V6MA 1RHUA 5IBCA 3GJSA 2P2CA 3SIPA 4ZVUA 5IAKA 3P45A 1RHJA 4QUJA 5IAGA 4AWAA 2K7ZA 2NN3C 1RHQA 4QUGA 1RWWA 4QTXA 4QUHA 4JJ8A 3UOAB 3V55A 1SC4A 3DEKA 4PS0A 1RWKA 4I1PA 1CVRA 3NKFA 2CJYA 5LU8A 2C1EA 4JB8A 2C2OA 3P4UA 2FP3A 1RWVA 3R7NA 2CNOA 1QTNA 1SHJA 3EDQA 1CP3A 4JJ7A 3IBCA 4IYRA 2XZDA 1SC1A 1GFWA 4I1RA 3H11B 1RE1A 3GJRA 2CDRA 3IBFA 4PS1A 4QUEA 1M72A 4HVAA 4ZVSA 1F1JA 1IBCA 1RWMA 4JQYA 1I4EB 3PD1A 4QU0A 4ZVOA 2CNKA 5LU9A 4N7JA 2H5JA 1PYOA 4NOLA 4EHDA 3GJTA 4EHHA 2HBRA 1RWPA 4ZVRA 3V4OA 2QL5A 4NOJA 4EHKA 2J32A 5IABA 5K20A 2C2ZA 4FDLA 4D3XA 3D6MA 3RJMA 1I3OA 3UO8B 2C2KA 3PD0A 5IBRA 1RHKA 5IASA 4FGUA 2CJXA
chains in the Genus database with same CATH superfamily
1ZD8A 2E85A 3LPLA 1HFEL 3GHYA 3K16A 4L0QA 4UUAA 3COJA 4RGYA 4UE6A 1KJZA 1TADA 5GONF 5T57A 4FEYA 2VHYA 2YZKA 4TYMA 3BJRA 3LUBA 3OM8A 1T5IA 2JKVA 2OORC 3IESA 1ISJA 3MD0A 3ZLBA 3W6PA 4HATA 1D7AA 5AW2A 4OJYA 1QS0A 1CBUA 1O77A 4LFCB 4HNGA 4NU8X 2Z57A 1L8XA 2X4DA 2VDJA 2ZUFA 1T0PA 4KE6A 1CDZA 1T1IA 2GD2A 5U4QA 3ZW9A 3ZHTA 4WVLA 5JXHA 3W2FA 2H0AA 3NORA 4JROA 1E59A 4UUOA 4DSOA 5KVQA 1E94E 2IU3A 4H9GA 1G8AA 3O4HA 3S27A 4QUBA 5EWJA 4E15A 1G41A 5E4TA 1JHUA 3QVTA 2JAOA 2YJTD 2HUPA 2DQKA 4QOIA 2J5KA 3GGCA 5JNVA 4US0R 2BGMA 4ND4A 1KTVA 5BVHA 3U80A 5K3OA 5ALSA 1Y1SA 5HIMA 3ZHYA 2HNAA 2WD8A 5IWAB 1T9ZA 1B15A 1YASA 3UJ8A 4DLNA 4BFWA 4KDRA 5SZHB 3PUZA 3L1UA 3PQDA 1A9XB 3DEAA 4KI0A 1GTSA 2GYYA 4M49A 4ECEA 6AT1A 1X80A 1A9YA 1OYVA 3MMPA 1GD1O 2FSHA 2XGOA 4D9JA 3DBLB 1WRBA 3FWYA 2ZBVA 2YBEA 3VOBA 4CT5A 3QKIA 4WXRA 5AXDA 2OZEA 3O0DA 1P5HA 3KETA 4DIBA 3EBLA 2O7VA 4RHXA 1P1JA 5IM5A 3N8DA 5T4FA 5I7HA 3TZLA 3COPA 2CWWA 1IHXA 1XVUA 3PWSA 1P8AA 4QJBA 1MAAA 2A67A 4MS3A 5DZSA 4DJDC 4EY3A 4LHYA 1PD1A 2J0UA 5EQJB 1YUMA 2JK1A 3DLAA 3KEGA 3NIWA 2B3TA 2CMHA 4OLHA 1XJ0A 1DAIA 1GIAA 2K7ZA 1EX9A 4P83A 3H1GA 5CFQA 4KJZA 1NBMA 4YCJA 1OZAA 3PR2B 2G72A 4OXIA 5CD9A 1DWQA 1ZEJA 4MEAA 4KQHA 4Q24A 4HGYA 1BCRA 4UUNA 1TFRA 4GVXA 2POQX 6LDHA 1HL7A 2YY6A 4X7RA 5ALDA 4C2UA 2FX2A 1KJYA 2H7CA 4MUEA 2H00A 2HSGA 2KSQA 5D3MA 4Z54A 4EJMA 1MG0A 2DC1A 3DT9A 4F9EA 5BR1A 2ZLBA 2D0IA 3LM8A 2OCKA 2XZDA 3S5JA 2PJDA 3SDSA 4KDDA 4NEHB 2NVBA 3DVSX 3KKZA 3RT7A 1ULBA 4Z0HO 5EIEA 4QO8A 3F5MA 3QVSA 1RQGA 3DZCA 3OPYA 4N5IX 3UIEA 1FB5A 2VTVA 3IUBA 2V7EA 2OSBA 4EGCB 5D3QA 5JY1A 1R0XA 3NVKI 4X20A 4EUNA 1CB7A 4UVEA 3RCBA 1PJZA 5CGZA 2QL5A 3RJ5A 3OIYA 5EUBA 1V6AA 5IABA 1I8TA 2C9BA 2B1QA 4MA4A 4RU1A 1P45A 2EATA 3IUPA 4NYJQ 3VV2A 4KYTA 1I7LA 3L7YA 4HWGA 5IASA 1EHYA 3Q8WA 1O97C 4XX1A 1C3OB 3HDJA 2ZYTX 3PEWA 4P3NA 1UKZA 3RFXA 1QM5A 4DA9A 1XFAA 3DZKA 4UDNA 1Z29A 3W8NA 4PHFA 1LX6A 4J16C 3OM9A 4G9GA 3AESA 3GRUA 1F9AA 2JFQA 4F2DA 2B5OA 4QPJC 3DXFA 2XBLA 4WK0B 4J90A 3LFUA 3QPDA 1MTZA 5EHGA 5CB8A 1JAIA 1Q1ZA 2DTDA 3AMVA 3EXFA 3GYGA 1V1RB 2FEOA 4NBUA 3LT1A 2LDBA 4QATA 3KUCA 5A9SB 1AHPA 4R8RA 1O0SA 2J46A 2RGBA 3B6ZA 3L4KA 5LQJA 3NT5A 4INZA 4TWIA 4X64B 4KWHA 3ZU5A 4OM8A 1VPLA 4RVCA 3HDTA 2XVXA 4ES6A 2BGNA 3IPRA 1PEKE 3L41A 3QUBA 2VSYA 3L7MA 1KMMA 2AJTA 1BWRA 1SD5A 1U9YA 1ZNQO 2HPHA 1Y1VA 4LOIA 2J7KA 1M6EX 5AVZA 1COWD 1RYNA 3JASA 3QX8A 2AZXA 1E0SA 4CQMB 1EH1A 4CM4B 1B2LA 1V6SA 1ZK2A 3L0SA 4Z7OB 4TZ6A 3DULA 1G8FA 1U8FO 1A77A 4TRNA 4W6QA 5FTNA 2W6NA 3N3BC 2R8EA 4LJ5A 1TM4E 4CV1A 1SOUA 5C2JB 4A91A 2J45A 4J76A 2OLJA 3L49A 1PUJA 1XDZA 2A6ED 1WCWA 3X1WA 3HO1A 4YJGB 2P30A 1XXLA 3LO8A 1FMLA 2QD5A 2KE5A 3FM9A 3LY5A 1BD4A 3CW2A 3R3XA 5MN6A 1IXYA 1HH4A 5THKA 3VO9A 4S1WA 2AZTA 3RAPR 2I22A 1CTQA 1W5EA 4YX9A 3H13A 5DNCA 4KBYA 5GVSA 2C0CA 3OESA 1Q2XA 3Q3VA 4D0NA 4B79A 3UCFA 5EJ9A 3DDOA 3OE7A 3GLHB 1S2OA 2FFQA 3F98A 4JC8A 2QDXA 4UEOA 3D1JA 4UFPA 4M0CA 1XUOA 1P5RA 5KDLA 3R7WB 3GLIB 2QUBA 5AI6A 4EKEA 2IIBA 5BN3B 3ASZA 2CGEA 3QWBA 1CJUC 1CPYA 1MABB 1TMGE 1U0JA 2IYTA 4LDQA 5AKJA 4WEOA 5J4VA 4BXOB 4W82A 1BHSA 2HJWA 4CKEB 1T8IA 2QQEA 3IAXA 3PQ3A 3VI3B 5CITA 3BGIA 3BHMA 3IOBA 2NSHA 2J3QA 2CN1A 1W46A 1F6BA 1UBUS 2BE7A 3QUSA 4N0QA 2NO0A 4RZ2A 2NYAA 3T7AA 1F0NA 1SOWA 5ICEA 2BGIA 2AS0A 2NU6A 1FSGA 1XKLA 3ESYA 3MM4A 1PS8A 3RRYA 2QUHA 4WXHA 1WNTA 1GA6A 1QIIA 2FZEA 3IAEA 3LKZA 5DBOA 4DCTA 1ZH2A 3S29A 4B09A 2DB3A 3B1VA 3WLOA 1KE2A 3UGTA 1PZMA 3STWA 3UMCA 1XRJA 1QZXA 4H4EA 5LLTA 4G01B 4UDYX 3FCYA 2OCAA 4J43A 4ZCSA 1N0IA 2NP7A 2ATIA 1LQTA 4REQA 4AMVA 4LJ9A 5I7RA 2AV6A 2WF8A 2ACKA 4F7WA 1RC1A 2XKAA 4J9VA 3L7AA 4U7JA 1YACA 2RG7A 1CUJA 4JX8A 1D2AA 3VR6D 1OXSC 3OIVA 4HAZA 1GTL1 3L7OA 4QU9A 5KTTA 2NUPB 3O8RA 1SKBA 4AG3A 1GN9A 1CK4A 5HUQA 4BQPA 1V45E 4JMPA 2E2WA 2QLFA 5LP6B 3IHLA 2TECE 3QG5A 2JRCA 3BK7A 4BKMA 1H42A 5J2TF 1OC2A 1ZJ4A 2VXOA 3HXKA 3RU9A 1XI2A 2A5LA 1QV6A 2BY4A 2KX7A 4UXJA 4ECAA 3UHAA 1FP4B 5JYDA 2JGKA 4MINA 1Z63A 1CRZA 3SHTA 4GS5A 4DA7A 3L6CA 3AEZA 3OLQA 4IJQA 3VU0A 4DDHA 1X9IA 1ARZA 3MGBA 2ICAA 4G0NA 5BQFA 1WW8A 1RXWA 1G3MA 1D6NA 2VDOB 1LS1A 3R3YA 2HFJA 2LW7A 2AK3A 1HKHA 5EOVA 4BLRA 3IXLA 4RY0A 4FYKA 2DT8A 4UXIA 1L7MA 4LKOA 5TSDA 1T9BA 5AWFC 3GLSA 3WGZA 3RNOA 2Q2OA 1X92A 2FOIA 3CN9A 3KQPA 1WU8A 4AYWA 2VDVE 2X4LA 4MVCA 4RF4A 2E55A 2V0NA 2A30A 1Y5IA 4D0GA 3SYRA 5DYNA 1K7YA 3CFYA 1HK7A 5CVCA 5SZJA 2JBHA 2QU7A 3EXIA 3GOQA 5KCMA 2DHCA 4MI6A 4FOTA 3DQZA 3DBVO 5C1BA 2H8GA 3MTQA 5FKJA 1OR8A 1J39A 1Z73A 1LWOA 4PIPA 2FR8C 1WABA 3I32A 2B6HA 1W59A 3NPAA 4I4IA 4XPIA 4CIVA 3UXEA 4EITA 1IY2A 4BDSA 5KWSA 1OOEA 4FLEA 2ZRQA 5CEEA 1NASA 1KMHB 1ZOOA 4JXJA 4O1HA 4OQZA 3CLRC 1TUBA 3L1KA 3OA0A 3O9VA 5HILA 4ETIA 3C1OA 2QSJA 2OGSA 2VIIA 4LPKA 2CLIB 2XZPA 1I94B 4J7CA 2P1DA 1PJQA 2P2CA 2CYBA 3L07A 3N2IA 3N2KB 1IOWA 1NTRA 3HSYA 2WRZA 3SZRA 5LYYA 4QAJA 3DF7A 4KWIA 4WY5A 3WIOA 1L7RA 1YUNA 1H1DA 1RFLA 3KJXA 3LHFA 5IFLA 4RVFA 3T9EA 3QVXA 4D45A 1V7ZA 4BVKA 2E89A 4FFDA 2VQEB 2P9BA 4WA8A 1N7HA 2ZSIA 3C4VA 4L51A 5C5IA 5L40A 3L8MA 3C0KA 4LYGA 1V8OA 4KQKA 4KXFB 3T9DA 1E2DA 4P86A 3PTAA 4P4TA 4HPWA 2OHOA 1CUYA 1NT4A 5DIFA 1RE1A 5KSYA 2CDRA 3BD6A 4WJKB 2ZPUA 2GHRA 5DT9A 2JIMA 4OG2A 5EE0A 3LLCA 4F4UA 2FF7A 1EVEA 1U28C 2FZ5A 3MB8A 3Q41A 4OB6A 4QBTA 1OI3A 4R2HA 5EY5B 5G3YA 5GGXA 1QNLA 2NIPA 8OHMA 5CJJA 1SCUA 3BRQA 1IULA 1XMXA 2IU6A 1JI3A 2P79A 2VUTA 5AM0A 5BSTA 3W06A 4CM3A 1VP3A 4M1QA 5IFKA 1GEEA 5B3KA 4LFAB 1RQ2A 3K31A 2X4IA 2XQFA 5LZ2A 1U63A 1XD2B 4W5OA 1TIKA 3E7DA 2YNMA 2ERCA 3WTBA 3EZ9A 4IZOA 1CIVA 2GK6A 2ZTVA 1VBNA 4RTQA 3NBXX 4TQ9A 4O3FA 3F5DA 1VLJA 5H70A 3JWJA 4NL4H 3T8YA 3EFOA 3OM0A 3UMVA 4BFVA 3JR7A 3E1GA 3ZYZA 4CQJA 4GYYA 3EPLA 4QNNA 3FAZA 4ZIRB 1WQ4A 3AEUA 1NTOA 1YQEA 4NYMQ 3WNBA 4GL2A 3JCZA 4IJUA 2HQ1A 5FBLB 2OD2A 1WTAA 4QTYA 3HJTA 5BRAA 3EYAA 5CCDA 4EO9A 3C48A 1P7YA 3TFOA 4G41A 1ZQ1A 1Y8CA 4CLXA 5JC1A 1NV9A 2UUAB 1E1KA 4AI6A 4ZU1X 4N8DA 3SJUA 1NAHA 4QYIB 3WLAA 3U7JA 1HFJA 4G0YA 3CZMA 1RAHA 1XZQA 4C08A 2AEEA 2AEMA 4FR5A 5GONA 1R0BA 1T1JA 3D8RA 4LSGA 4FHCA 4DJ5X 5K4AA 2F4QA 2YZNA 3S2FA 4N3NA 2BC9A 4AICA 2GPJA 1Q6ZA 2Z2YA 4P54A 2PRYA 4OMUA 4H3HB 4XOUA 3ETNA 3K1AB 1SUSA 1EE2A 1L5QA 4FHDA 4R9NA 2Z04A 4V0QA 1G20A 2CCKA 1SBZA 1N6IA 1BCSB 2IHZA 2N46A 2YWJA 3AF1A 3MXOA 2AKYA 1GFSA 3MB5A 2X19A 4PHTA 5IDYA 1WDLA 5LJLA 4R2MA 2PU5A 5G0WA 1PBTA 3BWDD 3OPVA 5I7OA 4NSNA 1H22A 5ALFA 4WLVA 1N9GB 4B83A 4EPTA 1WB9A 3B2NA 3CX4A 5CB6A 2E7ZA 1M67A 1S7GA 4ZT6A 3RIYA 1QANA 1USKA 2JAQA 4JOBA 3W5JA 1TKCA 2JD0A 3ADCA 2ZM5A 1AIPA 2E6UX 1FFBA 2DHQA 1B93A 1GDHA 1GCIA 2PZMA 3I9FA 2CL0X 1W35A 4PRYA 3T61A 4RAOA 3C5WP 1BSVA 4DW8A 2PX6A 1I7NA 3S99A 3T3OA 1TKRA 1VZ2A 1Z4JA 3OOHA 1J49A 2HGSA 5KOIA 4D25A 3D3QA 1Z2PX 1W2GA 1ZIDA 1D7OA 1K5DA 4HEJA 4BUCA 3SIPA 2XGGA 5ALMA 2AF4C 2X5NA 5G0SA 3CEAA 2ZRHA 1EHCA 2CKDA 3IDQA 2P68A 3DHEA 3PC6A 5CVJA 1WZ2A 2DJIA 2D5IA 3EIOA 1VL6A 2B25A 4NZOA 5I51A 4U4AA 3JQFC 1HQYE 2RGGA 3D4IA 5G2OA 1DPGA 5B7QA 1N2BA 3G2MA 1XAIA 1HE2A 4RL6A 4UNPA 5FWYB 4MRNA 1CZUA 1ZEMA 1G0OA 1GZUA 1Z13A 3PKJA 4IAOA 1HNXB 1LDBA 1SEPA 1P74A 2IELA 4F56A 2H1WA 3V46A 1UMBB 3H0GA 2P2YA 2FA9A 5EC8A 3O4JA 3E0QA 4GOXA 4JP5A 4ZQHA 4X93A 3WMRA 3KZOA 1SCBA 2FEKA 2ILVA 5FL7A 3IVGA 4LJ6A 4M0LA 4KSBA 3DUFA 4EKDA 2WABA 3KL2A 5NLLA 2NPFA 4QREA 4C7JA 2ZE6A 4ARZA 1L9KA 4LUCA 3CLUD 4RHFA 4XOIA 5KYNA 3ESAA 3S55A 2XT9A 3PD0A 2GAFA 1Y42X 1XCJA 1X7XA 3EG5A 4MQMA 4OMFG 2Y9PB 3OWOA 3A1FA 3R3VA 2VZEA 1G4HA 1K08A 1VM6A 4H2DA 4HDRB 1PV2A 4LX8A 1EDOA 2XOEA 2SKCA 3GI1A 1JEAA 1LEHA 3U56A 3QVLA 4EG7A 3DT6A 3U7FB 5K6AA 1NLFA 4ZK2A 1T3HA 1TM2A 4FTWA 3TD2A 2VUHB 1M6YA 3D2CA 3VZRA 3CX8A 1QV7A 2WYIA 3JVIA 4KU4A 5JD5A 3F49S 3UJCA 2X7XA 3TLBA 5JSBB 1O95A 5ALZA 4I08A 4XWWA 1J2JA 4ZK6A 1STOA 3DFUA 1AMUA 3ND5A 5TVKA 5B6JA 4V03A 5EHZA 3OCUA 1OZFA 2C3YA 3RRBA 1X15A 5KSZA 1WS6A 1JQKA 4R6WA 4XW2A 1ATZA 1VGRA 5IXSA 1UT5A 2GYUA 1YIDA 4A8JB 5KYXB 3KTOA 3MRXA 4MV8A 2WZQA 4CDGA 1NBEA 1AM4D 2BRUA 1TF5A 2J30A 3TRKA 3F4BA 3IOYA 4GI1A 1DG9A 3WDSA 4ALLA 1Z8HA 3OX1A 2EQAA 3MJRA 1PJRA 1PT7A 1TCVA 1Y8RB 3B2EA 4R1QA 3F7NA 3I1JA 2ILTA 4GZLA 3WRWA 3TOSA 5SY4A 1F14A 2P6NA 1NRIA 3AILA 3VU3A 4XWOA 2WD7B 2FSIA 3KBBA 4OYDB 2FUG6 2W6CX 5ERXA 2G17A 3NETA 1P1KA 1B76A 1XE3A 4I2NA 2QM8A 4FOSA 1KAMA 4P36A 1QU3A 1X9GA 1C50A 2XB4A 3EOBI 3H1EA 5DHRA 2QVGA 4PC3A 2PIAA 3GLGA 3A2NA 4MGZR 1T8WA 1SCDA 3NDJA 5EZYB 4WZAA 1QR6A 4Q1VA 1E1QA 3N8NA 4HAWA 5KNBH 3DGEC 1VA4A 1L4KA 1E62A 3EVGA 2P77A 2KLHA 4BB9A 3I42A 2QSUA 5KYKA 5TJ9A 5I7SA 4QD3A 4EPVA 2XOKD 5J2UB 1T2DA 1DG3A 1WSAA 1XSEA 1BJTA 1QB7A 1R5JA 2HRRA 3OX2A 4JT9A 4F9TA 5BSEA 4DLRA 5E7IA 1VG8A 1QP8A 3OZDA 2CHQA 3JTMA 3PXGA 3V6MA 5LLSA 3SIWA 3ZKWA 4FX5A 5IZCA 2WMYA 2H1FA 4A2PA 1WSWA 5HP4A 1T8UA 3OUTA 3E48A 5ETJA 5LPNA 4UCXA 4JI8B 2I87A 2VJDA 4PZDA 4X00A 4CRWB 3D31A 4KR2A 2MYPA 2V55B 3WWEA 1TA9A 3VSBA 2CNOA 2ZSDA 3BFJA 1OYOA 5DLQC 1LBTA 4I5EA 1Q1QA 2DU8A 5CHYA 4FOPA 1ECJA 4QDKA 4LMAA 1TTPB 3SF8A 4B3JA 4P93A 4IINA 1PVVA 3I72A 1RYDA 2JPDA 3KP1A 3B9PA 4PS1A 2ZB2A 3KTAB 3NXSA 4R1NA 3VR4H 1MORA 2ACVA 2WKRA 4IFEA 4ZVSA 3TNDA 4LV8B 4BO7A 1JJFA 4UEWA 1JIVA 3QOFA 2QN8A 1QLJA 1OH8A 4HBGA 3ELBA 4UJ3A 3DXXA 3KJEA 2WSLA 3NTUA 5GV7A 2OM6A 1UBMS 5JSKA 4J49A 1L7BA 2YFKA 3HV0A 2AHOA 2A1UB 1I33A 2QPAA 3KYBA 3DTVA 3G1TA 3A26A 3IFSA 5IJ0A 1ODIA 2XDQB 3WIUA 1CF2O 3DE5X 1NYRA 2JG3A 2HDHA 3C7DB 1HT2E 2CF5A 1YHNA 3M5PA 4B6SA 5MGNA 2AN3A 2G5CA 1YR6A 4UTZA 4IJMA 5FNVB 4FEAA 1Y9AA 3IPCA 4Q9AA 2HXGA 4XPZA 1SC9A 2XB8A 4CQLA 2VSQA 2OFPA 1FFSA 4F3NA 1B3BA 1J7KA 1N2JA 1FRQA 4JBLA 4UCWA 2NU9B 3P26A 3EXHB 3SX0A 1AC5A 4IWYA 3V00A 3N8KA 4RV9A 3B3JA 5KC8A 3IAS6 1QWSA 1GPYA 1WBDA 1F48A 1R1DA 1X42A 2VDUE 2WTAA 3NUGA 5EPOA 4N5MA 5TR9A 4OHBA 3TTSA 4ZVQA 4JKIA 4LXHA 5DE3A 1YXMA 4Z1MD 3LLMA 3PEYA 4CF5A 4WV3A 2VNHA 3GJYA 2HA4A 4KR0A 1IQPA 2FN3A 2XCQA 3K4HA 3BWCA 4GE0A 2FMIA 1QBGA 2C96A 5A9TA 1NSTA 2APJA 4I4TB 1AQUA 2EZ9A 1PTJA 4QFDA 5TMBA 1B7GO 1MJNA 4PAQA 2G0TA 3OEEA 2FN9A 5LZ8A 4RVDA 4QDUA 2YQ4A 2DLDA 4MRVA 1UBKS 4PTYA 2CLDX 1RYFA 3Q88A 4QJIA 2OPHA 2HR1A 1Q1BA 3WVNA 1SA0A 4OKIA 1E2HA 1HNNA 2GEKA 3EG9B 4L6AA 4ZJUA 1YA8A 5JWHA 3SBXA 2AFIA 2I65A 5LP1A 5J2TA 3WWZA 2ORED 1VHTA 2BFOA 1KEEA 5DSXA 3V3KA 3SVLA 1CUDA 1GPDG 2ALJA 2D3TA 2Q5CA 3KKLA 4BVJA 1SKMA 4IDCA 1T1EA 5EEHA 1RYHA 5JAZA 2IHUA 5JW6A 4RSRA 1F8GA 3F5FA 2OD7A 2YOFA 3ZE7A 4HQFA 1A8IA 2R3SA 1J2TA 4GX2A 1UAGA 5HKKD 1Y3AA 3MN1A 5U4XA 3OZBA 1YQXA 3I8SA 2IZZA 1RRGA 2WPNA 4LY9A 3VUEA 1EAYA 3CRZA 2AB0A 2PL1A 1X87A 2C8JA 3Q12A 4HC4A 1WETA 4F5DA 4B3SB 3TD6A 1J00A 1AKUA 3SJRA 2IK8A 1SZPA 3PUWA 2GO1A 3M8KA 1CUBA 2WJYA 1YIAA 1GRCA 4Q3LA 3L4BA 2VXCA 4YO7A 5BOSB 3SZ3A 4BAGA 2CBXA 5DFAA 3MA0A 3VDMA 1N0WA 5DNYB 5TLSA 2OCBA 3LV8A 1VIYA 3ZQUA 4FC7A 4V1CB 4JJKA 2UZ0A 2QX7A 4P3YA 4ZKEA 4QPCA 1AGRA 2ASVA 1WQHA 1A88A 4EO4A 1V7PC 2BMJA 1SVKA 3K0AA 5AI4A 4HXEB 3FRHA 5TPWB 3WYGA 2ONCA 1Z39A 2P5SA 4XWYA 4BKRA 3W2IA 2J3LA 2HLNA 3SMQA 4AZWA 4D8XA 2RGNC 1N5DA 4YPVA 4Y2VA 2XE7A 4PO1A 4HNSA 5D5PA 4ALNA 4IIHA 4N7BA 3ZWCA 4O4JF 5K3FA 4EA8A 4CETA 4WEQA 5CGQB 4NK4A 2RG1A 4PLCA 2FWJA 2ZK7A 4IXMA 1L5MA 3NHKA 1H5QA 3VPFA 2AI1A 3REOA 1NXOA 1C0IA 1UL1X 1T10A 2AR0A 3FRJA 2CB9A 2UYCA 1U8XX 4MW9A 2ZT7A 2D5BA 4QO7A 5J4KA 4RENA 4N8EA 4A0FA 1EG7A 3SHQA 3SLKA 4CKWB 2FRXA 5JNWA 1I14A 2H2DA 3D4NA 3FOWA 3HY6A 1Z08A 2VNKA 2YMPA 4GRDA 1Q14A 2XW6A 4MB0A 2GPWA 4C4TA 5TGDA 4QPNA 3T1VA 5DHTA 1SCJA 5CYFA 1J07A 4ASUA 4WJZA 3VH2A 1WUYA 2FOLA 1NN0A 2ECKA 2ZFUA 4J2TA 3ED1A 1XZNA 3LT4A 1SUAA 3QEMB 1N2HA 4FWIB 3T4PA 2G71A 5DGHA 4NCHA 1RP1A 3IJPA 3AIMA 3T4EA 1CFZA 3KJHA 2V45A 3SQNA 3LIIA 1DIOB 4YBZA 1MPTA 3I4LA 4BKQA 4Z3OA 3DZIA 4CKZA 1G8KA 3O47A 3GCZA 5JCOC 4OBBA 2H4ZA 3JAWA 3P2EA 4X0EA 2AR9A 3QPVA 1IDOA 3MJHA 3F74A 5DX0A 1SQGA 4AUMA 1ZL0A 4NU5A 1I7QB 3CEPB 1L7VC 4EARA 4J03A 2RIPA 4XGKA 4YO8A 2RCYA 5AVOA 3WTCA 4P4SB 5HGXA 1M75A 1QK4A 3I05A 3CIOA 3KWJA 4QBKA 4L8VA 2IE8A 4DQXA 2HYIC 1U1FA 4LTDA 5IJ9A 3FB4A 3C3JA 4ETNA 3IPYA 4EABA 4ZC1A 3T5DA 3N8GA 3DLHA 3C3PA 3PZBA 5CFRA 5GINE 1A8SA 2QVBA 1BX3A 1JHDA 2GVNA 1BVUA 3FG9A 4GR4A 5HUHA 3UMRA 4CIBA 2IYOA 4WN9B 4DUZB 3N2ZB 1JSCA 2CXQA 1RAGA 2X1LA 2H1CA 3Q4GA 2R5NA 3G85A 2FRDA 1EWRA 1N92A 1X1CA 2OXCA 4HHEA 5DOZA 2V7UA 1IIRA 1I0IA 1P2FA 4NMXB 1URPA 4F71A 1AGXA 3EGOA 3HNOA 7REQA 2OO7A 3KT3A 2IODA 5JRDS 3T0IA 4KNYA 3P96A 5DIZA 1B0AA 2C2GA 1CVRA 1W29A 1Z5OA 2VP0A 3BDVA 3BICA 1W4AA 3F5SA 3JALB 4XLLA 3ZXSA 1DJOA 2RI0A 2IQ5A 2FEAA 1ZIXA 1U1CA 2HJVA 3BIWA 3ZWQA 3TAUA 5KB3A 2PVCA 1Z6TA 4JZKA 2N42A 3MFQA 4ABYA 4JJ7A 4EJ0A 1KPIA 2FZWA 2I2AA 1QCYA 2FZ4A 3IR6A 3W5VA 1N75A 1G6HA 3G9TA 3W5SA 2PPLA 4TMFA 2FMTA 4C4RA 3BA6A 3H11B 4QNMA 1EFRA 2HH9A 1E66A 1PL0A 1ZYRD 1RMQA 3U4AA 4PG5A 5K8TA 1RI2A 1PR9A 4ZP1A 2O8EA 3TPCA 2IP4A 4AJJA 4CT0A 5AIBA 2NSLA 4NOLA 1L5SA 1S4MA 3H04A 4GX1A 3R7FA 5LQNA 3PK0A 5CD1A 4G9EA 1UC9A 4JUFA 4AQ7A 1JQDA 1RM0A 3CT4A 4YJ2B 3JV7A 3QBTA 1GPNA 1Y63A 1AKEA 2Q4RA 4ZAXA 4F12A 5IG2A 2PUCA 2ZTUA 1ZXBA 3KPJA 3NVDA 2PBRA 4FQ5A 5IT5A 1WMBA 3VU8A 1LXCA 2EGHA 3CJQA 4RTNA 5NULA 1TJPB 1GNSA 2YRWA 3FDZA 2WJZB 5I3ZA 3PQCA 3WFZA 3Q1LA 1NXQA 5GZ3A 2FX5A 1EFUA 4ZZ2A 3D5TA 4Y67A 2O3RA 1TCBA 3TI7A 4CL2A 3WZLA 1RS0A 3PEEA 1QPGA 3GDGA 3PE4A 3HUDA 2CLHB 2HQOA 4DBLC 2B4QA 1TMKA 1YB4A 1YDMA 2AW3A 3AF3A 4JP8A 4WFIA 3PZRA 1Q44A 5AKHA 2W6IA 2EWVA 4Y1RB 4BYGA 4A03A 5JDIC 4DG5A 4F45A 2ZIWB 5EP1A 2WVGA 5ER6A 1ZNXA 5A1TA 3FHLA 1DOHA 4O6VA 3LBFA 1GLNA 2ZIFA 2Q3HA 3DQQA 1G8YA 3FPHA 5AXBA 1IQ0A 1KK0A 3WJAA 3WWOA 1E2PA 1OASA 3FFXA 2HBYA 3R24A 3PEUA 4L5AA 4O29A 4AS3A 3GP5A 1THGA 4CMHA 4AULA 3STUA 1W73A 3OZWA 3FN4A 1D4FA 3C3KA 3P94A 4FMCB 2BGUA 4GRAA 3CWQA 1V95A 4I5IA 4NAVA 4UM5A 5C5CA 2I2CA 4IRMA 3ZXXA 3N2LA 1TU0A 1TM3E 1YS7A 1WXHA 1W4BA 1YKGA 3THWA 2WU8A 4RAQA 5ILOA 4KWTA 2Q0SA 3QBEA 3K96A 4G1BA 3TLGB 4X24A 5FWDA 4UOEA 4UPEA 1H8ED 2NSDA 2PBZA 2W6ZA 2X3UA 2YBDA 1VHWA 4GL4A 2R65A 3K7EA 1W85A 2GF9A 5IT0A 2EFEB 2HIGA 3SDBA 2AYZA 3DD5A 4QX6A 2QN3A 2W11A 2BCGY 4WXYB 3PJGA 5EFOA 3Q9LA 1NVEA 2IUFA 3A4MA 4MGIR 3CLHA 2R5FA 3P2JA 3HJRA 3F7MA 1EX6A 1Q74A 3ZH2A 1GKYA 4W5QA 1S2DA 2WTUA 1WOYA 3R20A 4QQNA 5I4KA 5KIAA 4Q4JB 2PUHA 3CMMA 4G0XA 3A6DA 4QT4A 5BPHA 4Q3DA 1JG3A 2B1IA 1XRRA 5L9AA 2GPSA 4MRRA 1SCKA 2D1RA 3UUWA 4XB2A 1E9BA 3MIZA 3ZUGA 2X5KO 1WL8A 1E9AA 4MEBA 4X44A 5JS1A 1FUYB 4WFJA 2OZKA 1RYZA 5AK0A 5KHOC 2NVUA 4BO1A 2BFCA 4LWQA 2CWDA 1A27A 1JLRA 1CR4A 2PKQP 1BX0A 3K9NA 1N34B 3QX7A 1H1LA 4UNIA 5CM2Z 1C8KA 1CY8A 2C78A 3H8VA 4MPPA 3UUEA 4E5PA 3LBIA 4ENWA 4I50A 5I7VA 3GBVA 1Q1AA 1N2SA 2D5CA 3LVQE 3FWPA 5M04A 3M82A 3BE6A 2O7RA 3AH8A 3EUEA 4GEGA 2R6HA 4AXBA 4QKQA 5HZHA 2X13A 1LPPA 2I66A 1NZDA 4QT0A 4R1MA 5P8WA 1X7HA 2Q9BA 2I54A 2VQSA 3WB1A 1DAMA 3O8NA 4N18A 4NS4A 4DNXA 1LY1A 5JNLA 3OQMA 1EFPB 3A3KA 1ODCA 3DL0A 2V7VA 4MS4A 3PUYA 5HVNA 3G9XA 4O4LB 4G0QA 1YC5A 2VPXA 4TMZA 4P98A 4UQOA 1FUEA 2Y92A 3M6UA 5EZSA 2I7DA 4TXLA 2R7KA 1WBJB 3TZHA 2VYVD 2OBLA 4L5BA 4WZBE 4DMCA 4IYJA 2VZ9A 4HH4A 3TJMA 5HRCA 5FXMA 2Y0BA 4FGUA 1QHEA 1HA3A 2C9OA 4I4LA 4MZDA 4QEDA 2J48A 1G64A 2BKUA 3QH4A 1ECGA 5EHNA 2YWBA 3E5HA 5ALYA 2VPYA 4Y18A 1KAOA 2QLJA 3E3OA 5K5EA 2I3GA 2D1SA 1SK9A 3BL8A 3C98A 3W3AA 3NHZA 3WNDA 3I30X 5CA0F 4FWBA 2G67A 3TKLA 3GRZA 4EYKA 3THXB 2AIRA 4QGBA 2VKQA 4KSYA 1KP2A 3BWMA 3GFBA 3HZHA 5EMJA 2D2EA 1R0WA 2YH2A 4E70A 3KQOA 5ALOA 2J3KA 4EUFA 1Q0PA 2QVCA 2ZZMA 1E6KA 1DARA 1QGED 4IJWA 3X44A 2IFTA 1Z2DA 1FJHA 2WYWA 4GPAA 3K09C 1WO8A 6YASA 1U90A 2HMYB 3O1HB 4BV3A 1ISSA 3Q3HA 1IAVA 5K9ZA 3BCRA 4PTZA 2A35A 3RK4A 1VE3A 2VPWA 3HKDB 4HH1A 1K4TA 5KYYB 3UICA 1D4OA 2VAPA 2WB1A 3Q3CA 1KDOA 5AHKA 5C32A 1LJUA 3GIDA 4AP6A 1DBVO 1XPJA 3GT0A 4G0MA 4JQZA 2H4YA 4RWEA 1UC4B 3EK2A 4ZO9A 4ZT5A 2PA3A 2XBUA 1PQ4A 1V16B 1K5HA 2YZMA 4ZAGA 1L5OA 1VLZA 4M0MA 5AI8A 3UFXB 4ZVKA 5JJIA 1R6BX 3O84A 3UTDA 1JWAB 3O3OB 1T36B 2PUWA 3EIQA 4U9UA 5FP0A 1ZSNA 5FR1A 2EXXA 2JJ8A 4IXDA 1ZD4A 1M1YB 4ZO7A 3BXHA 4RQBA 1PK8A 1HLPA 2ZTLA 3M4JA 2G1UA 3G1UA 2WWVD 4Q5IA 2JA7A 3CE6A 5DSZA 3WHIA 4U0JA 2DETA 4G4SO 1Z16A 2XYPA 4YV1A 5IVDA 3PNOA 4KAFA 3RRFA 1SCNE 1Q16A 3I5XA 2AX3A 2INGX 1MIOB 1H85A 4ZDIA 5BN5A 4I19A 2WWRA 2PYZA 3E03A 4KUHA 1CY7A 4LRSB 4QOFA 5BSMA 1HPLA 1IPFA 3I3OA 1D2RA 2VF8A 3RJTA 4Z9XA 4GR5A 4BNVA 2XDYA 1MRNA 5E9WA 1ZD9A 4X94A 4A8PA 4J9UE 1TF2A 2GJ4A 2JGFA 5LN1A 4RVSA 2WU4A 3B9BA 3K9CA 3H3JA 4JL8A 1OTXA 3LOQA 3LY8A 3F4LA 1U0BB 1ZWLA 2Y1KA 1BXKA 2UYOA 5HJ5A 1YI1A 2FP3A 1IN1A 2B94A 3WFJA 1C3EA 3MAAC 3ZVNA 2NO6A 2ZBFA 3LP6A 3R0JA 2R4GA 1BFUA 1U7HA 2H11A 2QDKA 2RHOA 1NJ2A 4KQXA 4LK3A 4W4TA 4X1KA 4N54A 4WACA 1D9XA 3GFVA 1F7VA 2HDWA 2WTXA 5B7NA 3ACCA 1YQQA 3ETCA 5DHPA 3RV3A 1P62B 1A5SB 4J91A 4M1YA 4RF5A 5JQWA 2HCTA 1Z4NA 2D8AA 1W9MA 1P8JA 5CTJA 5JOQA 1M0EA 4X66B 3BULA 1EVQA 2H4JA 2O3JA 2RH4A 1CW2B 2C5AA 4RZQA 2IDJA 4HWTA 3RSCA 1GQRA 1X1DA 5FPYA 5L3SB 1Z3CA 2EW2A 3GQBB 5I7WA 4LV5B 2QR3A 1DLIA 5ALJA 2FR0A 2GXQA 3IERA 2WE8A 1R4ZA 4C4OA 2JZNA 3TRIA 3IULA 1Z4PX 3CRMA 1RQPA 1SKAA 1YHYA 2D06A 2WOJA 2AL7A 1EX1A 2R00C 3IAM6 2K5UA 4UFOA 1F2DA 2QGFA 2HT6A 1XX6A 1SZCA 3RTBA 3PEVA 3HYRA 4BS9A 4JBWA 1ZR2A 5BWCA 2GK4A 1XHFA 3N1UA 4ZA2A 5G4LA 1CLUA 2QPOA 4QYMA 4IS2A 2G9ZA 3A1WA 3QXGA 1Z82A 2XD9A 3VMFA 2C98A 4FGJA 4O4JA 2ONJA 3IO5A 3UMJA 4E5DA 1W7AA 1I2BA 3KCNA 4MB6A 4CQMD 2QQ0A 5FTKA 3NAQA 3WK4A 2BT4A 5IYZF 1PS0A 1Q0QA 3I2FA 3IEUA 3OKPA 3DCNA 3TX6A 3FYHA 3NDPA 4DA4A 3F8SA 4CKYA 5IXYA 2AZDA 4AF7A 4HN2A 1LSJA 3CPJB 3INYA 3BG5A 1M0TA 5DMXA 5H16A 1LI5A 1GUZA 2FDCA 4EPYA 4FT2A 3TOXA 1F06A 3RPEA 1OLXB 4XJXA 3L79A 3I1IA 3IXMA 3FVTA 5F1YA 4HNRA 2ACEA 1JPJA 1UJ6A 4XLTA 3COSA 4LMPA 4IGEA 4IV0A 4CKBB 5DOVA 4EB3A 2G9VA 1AUPA 3H8WA 5JTTA 4LYHA 1IM2A 5COBA 3MJ4A 1DX6A 1WOMA 3ANSA 3HS3A 3EGCA 4PLYA 2P7HA 5IJAA 5L3QA 1QOZA 3FHTA 4HVLA 2FPIB 3EVTA 1ZC3A 4RLFA 1D1PA 4TVOA 2GZHA 3UVEA 2FWMX 3SXUA 1SUIA 4DREA 3GG2A 1XPUA 1XZLA 4RHCA 1BVYF 1DBQA 4F2PA 1O96A 1XQYA 3V1MA 4FYIA 2CJWB 1N7JA 4RV4A 4DY4A 1BFDA 1GNLA 1DBWA 2P78A 1QVRA 1NP6A 2YHIB 3U3OA 2AMLA 3ZGVA 2V9PA 1HT0A 1CDDA 1HZZA 2H7VA 2ZBQA 2ZWOA 1T5SA 1KDPA 3FY4A 4KX3A 3RUIA 2R1TB 3FOAA 3DO5A 1W4LA 2BP7B 4GSYA 3ZHOA 3OCCA 2F9LA 3BAZA 2PQMA 3CUVA 4KRYA 3HN7A 1AH2A 4IKPA 3RSQA 1C4KA 1H05A 2OHIA 4PYLA 3BXFA 5EKSA 2RAUA 3EAQA 1YT5A 4RD6A 5AVXA 1QTQA 4BV2A 2W2QA 3AKYA 4DY6A 5HKAA 5E6SA 3DEKA 5BSHA 4JGBA 4DV6B 2XRYA 4BX3A 3HL4A 4C43A 1V47A 1LJLA 3DW3X 4DMUB 5KNCD 3ZU2A 1VPEA 3CC8A 3S2UA 1U2RA 2HJRA 4X8HA 3ZWDA 1IHYA 3ELUA 1ACJA 4PYIA 1Y81A 3GLRA 2YNMC 1ETHA 4KDFA 1CR6A 2CHUA 1BWSA 4HWOA 4G5QA 3ZXIA 1MW8X 3DAPA 1DJLA 4WVFA 3DMNA 2JLVA 1SFOA 3P0RA 1KIMA 1TTHA 4KN6A 5GZ1A 2PX2A 4RK1A 3ZDAA 3OVMA 2WG1A 1AV6A 2C2YA 2ZANA 1NLMA 3FNHA 3K73O 4R98A 2BKEA 3W7BA 5CAEA 3M7IA 5CUQA 4S1NA 3WQRA 3ZGZA 4MLDA 3HA7A 1FQWA 4EA9A 1JQBA 4O3MA 3I39X 2DM6A 1FF9A 1NBHA 1WCIB 1XP5A 5AM2A 3U9LA 2NUAB 3F90A 3WQQA 1XHLA 1XOIA 1QBKC 2YMMA 4DUGA 4EVIA 1IU9A 2HN9A 4H35A 5AJUA 4QGHA 3AGPA 3HDGA 4E2FA 1Y33E 1HE8B 4S05A 1RLOA 3PGLA 3W8RA 1R5ZA 3E70C 3EARA 3L7KA 4OBXA 2DY0A 2ZAOA 3RUCA 4DLBA 1J0CA 3L8ZA 4FT4A 1KVSA 5IN5A 3CVXA 4YXWD 3QKSA 1NYLA 3ZVRA 4RM3A 2J07A 3EXAA 1RPJA 2WUGA 3AXSA 4WRRA 2JI8A 2BF4A 5TMPA 2O2EA 4DB4A 3CZ9A 2GEJA 1ZMRA 2OV2A 1EFHA 3A6LA 4LQLA 1OWNA 5A4JA 3HY3A 4R31A 1IBKB 1N0HA 1QFXA 2XB6A 2N0SA 4IH4A 4CGYA 1A9PA 1G59A 1BA3A 1RLJA 4E5NA 4DJAA 4BWYA 1KSHA 2ZUSA 4B8WA 2I3DA 1B8OA 2QS9A 5HS6A 4BNGA 3D59A 1SMKA 3NBZC 3BA1A 5TF4A 2B0CA 2W2OA 5I9SA 5F52A 2Y9MB 2CT8A 4IQ0A 3TE6A 4K1LA 1XWFA 4HGRA 4HDMB 3RVMA 2C9CA 1AKMA 1UXGA 2VJOA 2K2WA 3FMGA 4MDYA 4M46A 1M10A 1GO2A 3CGGA 4J1QA 2ZYIA 3TLYA 1QIHA 3F46A 3GBPA 3LUKA 4XA8A 2ZIGA 2C4NA 3IS3A 1YZHA 5JASA 3PD7A 1SURA 1H0RA 4ER6A 1JA0A 2R66A 4GWKA 2NZJA 2IS4A 2QVZX 3E2MA 1KFEB 3TKAA 5C4IA 3DB1A 3P4YA 4BLQA 3A7DA 3O2NA 5DM70 3GMTA 2JFWA 2WIDA 2HTEA 1DQYA 2KBFA 2FFJA 1RACA 3M83A 1RXEA 3FJOA 3VUFA 3WGYA 1T2EA 4E08A 3T7DA 4Q7LA 1Z45A 3HRIA 1BG6A 1DNPA 3QXXA 3ZHVA 1AGNA 1UBOS 3CXUA 4JB2A 1JYSA 1WWKA 2XX3A 3ZD9A 4CE6A 2HPZA 1K92A 4GBMA 1GL3A 1UBFA 1ZN9A 1K3UB 3WLEA 1EDZA 2EVWX 1YQDA 4F1KA 1YBVA 5BMOA 2E18A 4B4VA 1RRJA 4JBYA 3Q2KA 4HWKA 2JW5A 4F9GA 2ORYA 2QYHA 2W2KA 3THOA 3HFSA 2VNAA 5JVDB 3GP8A 4DM4A 3TZQA 1Q0SA 1SHJA 5E6UA 1PWYE 2DF8A 3ZWYA 4B0OA 1SKUA 2R25B 4FNAA 3GEIA 4D8UA 1R6UA 5CYGA 2QJRA 2P9QA 1P77A 1O95D 4A4DA 1JIXA 2HMWA 1GRNA 3A1DA 3MZ0A 1AX9A 1JDUA 1G17A 1IBCA 2WF5A 3DTYA 1IBRA 1WD5A 3EVNA 4NULA 4BJHB 1NA5A 2HADA 4V0SA 4N7JA 1E1NA 5H59A 4DRYA 2VT6A 3QE4A 5MLC9 1SC6A 3AERA 1ZVJA 2IA5A 4RCZA 2BEWB 3HKEB 2AG0A 4Z9FA 3AR6A 3M34A 4Z49A 3CEMA 3LSTA 2G09A 4EDFA 4FDLA 2OFOA 4RYLA 4RFVA 2X1MA 1IXSB 1MOZA 3EIWA 1DWPA 4MLZA 1CUXA 1JBKA 1EWTA 3VBCA 5IKEA 4YMTA 1E6CA 3NDRA 2WD9A 4M83A 1MJGA 1X1SA 3ZOZA 1YS4A 4WQMA 3R7SA 2PLFA 3QFCA 4L7VA 4NHOA 3PKIA 3DPIA 3ZJ5A 4YPOA 2GZSA 3IYLW 3FTQA 1B41A 2IF2A 3KR9A 4IUCS 2QVYX 1X8KA 5DGDA 5LUBA 4CMIA 4YRAA 1G42A 1USUA 4XYGA 3HO6A 5E1BA 2BR4A 3QYFA 3AXTA 3GD5A 5J23A 1VRCA 3UKOA 1JFTA 1S8FA 1N5OX 5EQDA 4D26A 5DBIA 1B6SA 4GAEA 1PW7A 3MJCA 3PPXA 3Q5DA 1E3IA 1DEKA 4QBFA 4Q3BA 3VDXA 4OKNA 1QVWA 2XGMA 1XAJA 3RWBA 3N0TA 1TO2E 1Y8QB 4K9MA 2JLZA 4AY6A 1EUCB 1L1RA 4UTRA 1KAQA 4UOQA 1VP9A 3EISA 3QLVC 4AC9A 3L8EA 1NPDA 4FBGA 5ALPA 1PJAA 3IEXA 4WWHA 3JVUA 3BE4A 3GFQA 3NHYA 5EJIA 2PE5A 1BMFD 2GN8A 3CVUA 5CA0A 1M34B 2QRKA 3T52A 2NU8B 4RHUA 5DM60 1U9ZA 1VJRA 4NIMA 4PC1A 2VJBA 3F78A 4YUVA 3S70A 1GPLA 3AETB 4D92A 3ESCA 3OHPA 4L02A 1KZ4A 3WWPA 1NXVA 3RABA 3CWCA 3AYXB 1O8CA 1BQEA 1GG2A 2JI4A 3JWPA 3UK6A 4DXDA 1BXGA 4PN3A 3H5LA 5TQ0A 1W581 2HV8A 3AHJA 4KVZA 3FUVA 1DX4A 2PMEA 1A8UA 4QGAA 4XB1A 3VI4B 1P6XA 3WLNA 4K6MA 1K0FA 4MS1B 4FU0A 2QIOA 4UM9D 2PD4A 2XEXA 4KZKA 3HKZA 1EA7A 4IGAA 4R7GA 3OQ6A 4AB1A 4C76A 2QM7A 3QJ5A 2NZUG 4MVJH 5JNTA 1ZGGA 1U94A 2P2LA 4CDMA 3DVAB 1IOZA 1PFYA 4YC7A 1ZX1A 3MWYW 5TF0A 1C2TA 2GGSA 5DWQA 3BIFA 2ZG6A 3DS8A 1DUSA 3FDXA 4RTRA 4CFSA 4F04A 1G60A 1LVUA 3V1YA 4R84A 3OU2A 2NPOA 3G0BA 2Z3VA 2NN3C 1QIDA 3NFRA 2Q3BA 2REBA 1UEXC 1UWKA 2B1JA 3GJ8A 2ZRDA 4JT8A 2IVFA 2DLCX 2X8JA 3WC4A 1U0NA 3FYTA 2FSUA 4TS3A 3CUUA 2Q6TA 1O89A 3R44A 4RELA 4D9MA 4JB8A 3FDJA 3A9SA 4FSDA 3C15C 1YKFA 2Z2ZA 4LN1A 2O4CA 4TWBA 1LCIA 3MJTA 1UFKA 3NG1A 5FIUA 2KLBA 1XPRA 3ZOKA 1M9NA 1CUSA 3VZPA 4YCMA 2HXSA 1NBIA 3NUZA 4RH3A 3I83A 2B2NA 2IU4A 3NHRA 3WBFA 3CSSA 3ICWA 4G5FA 3HZRA 5DXJA 3FUUA 3HWX1 4WCFB 4ZAZA 3CVYA 5BMVA 5T64A 3KZKA 2DPGA 2V6BA 3FZQA 1N0VC 1IMJA 1O94A 3CVJA 1LFDB 5KYUB 4ZD6A 4GFQA 2IBTA 4YRZA 3K8ZA 1XALA 2QXYA 2W58A 1IJEA 2J6CA 3NB0A 4D3XA 1L5YA 1UBNA 3R9XA 3F9IA 1DCFA 1WA5A 5HDBB 1GGFA 4BOYA 2PNFA 3L84A 1I2CA 3LUJA 1RM5A 2GRJA 3BMOA 3PYXA 4Q4AA 2D74A 2R48A 2LXNA 2R6DA 3BE5A 3T7JA 1R18A 3ZGXA 4D4HA 4DBZA 5A5VA 1HLFA 4DARA 4M53A 4BTVA 1A9XA 4PG4A 5L6LB 1EUQA 3RWOA 4KPUB 3R40A 3DOJA 2C0QA 4XM1A 2ZQ5A 4CJXA 2ANCA 1J0DA 4ZYVA 1A04A 1BTOA 4FDTA 2XCLA 5EJFA 3V9PA 2XZOA 1E2EA 2HA6A 4EJ2A 2QLTA 1PR1A 1KGSA 1NBWB 2CCGA 4B9EA 3PE6A 3M0EA 2R86A 2WIJA 1IPHA 3KJGA 2XHZA 3HGQA 3WRYA 3ILVA 1SUDA 1XO1A 1Z0AA 2BGRA 3IV7A 4WKBA 5EJ6A 1EJ9A 2RB4A 2EKZA 3DAYA 4EI9A 3TAXA 3OCWA 3OFKA 4MCJA 2ZTMA 1Z9BA 7GPBA 2IH2A 4KO1S 3FUXA 3MERA 1NYQA 2PAFA 2J33A 3HXLA 4PLTA 5ESRA 1B74A 4BP3A 1IZYA 1LQUA 1JFSA 2LPMA 2TMKA 1W36B 4O4HF 1GGJA 3ZCVA 3RTCA 2G1AA 1IOVA 2BI4A 1F5SA 2CW0D 1K6MA 2FJUA 3D7MA 3GGDA 3R0VA 2EJUA 3HJHA 2I2FA 2ZRGA 3M89A 1MH9A 3MT7A 5MFZA 3ME5A 1EEXB 3EHDA 3Q40A 4I5FA 5IYZA 4QJ3A 1WUJS 4ZRDA 4IY1A 3BMXA 5AJYA 2D7CA 5BYBA 1B3RA 2AT1A 4NFYA 4ERXA 2YVUA 2CSUA 4LWPA 4MWEA 3SJAA 1HNWB 2EKPA 2WFMA 1BU8A 4M98A 2I2XB 3GTOA 3ETDA 2Q3EA 4JP1A 4QSHA 4AQYB 4V38A 1D5CA 2OOKA 3T94A 4AMYA 1E98A 2BWJA 2PZBA 3KQTA 4TT8A 2VA9A 4I7EA 4BX9A 3AR4A 4EY6A 3E5MA 4TV8F 5EE3A 4MRMA 5BXYA 4IP9A 1U5BB 2DMRA 1AHIA 1JSXA 4UMVA 4NX2A 5IBCA 3DU5A 1RT9A 4KPEC 1SZJG 1GGMA 4MK4A 4ISCA 3I6MA 4R68A 1MVOA 5KTNA 2Z8YA 1C3OA 1QGUA 1DD5A 2LTAA 1YJCA 5A4MS 1U9IA 2BTOA 1FJ2A 2R4TA 4O2LA 1GSOA 4LBVA 4YGXB 2PUDA 1CQJA 4IHJF 4Z8XA 3O83A 2AWOA 2GCPA 3QRWA 5ER9A 1YDEA 1CX9B 1I6VD 1YVDA 4KLAA 4Y98A 1XRPA 3CH6A 5CMLA 4X3OA 4DQVA 2A8YA 1ZW6A 1Y1WA 1P1BA 3B7PA 1V1RA 1V3TA 2XIJA 3T3EA 3ZHXA 4ASUD 3LHIA 1UXHA 4L9SA 3ACDA 1EK2A 5C5EA 4ENRA 2WFZA 1F1JA 2H0RA 2NO4A 2VJMA 3CPHA 4KQJA 3KHKA 4XFDA 5DTIA 5CDSA 3DE6X 1K27A 1KYQA 2P2DA 5SYNA 5EZYF 3ZZ1A 3PITA 1ZYUA 3RAEC 1QE3A 3D0RA 1Z18A 4EVRA 2W2MA 2PZEA 4QGSA 1CJTC 1CUZA 4NCNA 2WIFA 1KZYC 2YN4A 5EP4A 2F6RA 3LFTA 5AKLA 4BUJA 3B8EA 1SOVA 4M1EA 3GFFA 4P7BA 4MGYR 4QTUB 4QOJA 3HVIA 2IKQA 1POWA 1O54A 2VJLA 3J81A 4QOEA 4C6TB 2O20A 1ESMA 4H1TA 1C1YA 4GPIB 4DLPA 2CW5A 1PK7A 4HP8A 4UU0A 3NT4A 3GTMA 1DQZA 2EBWA 2W6OA 1ULHA 3O92A 2ZI5A 3DEJA 1FU7A 1M5UA 1XKTA 2GZ1A 1FY2A 3ETHA 4JVLA 4R9RA 2DHDA 4UMFA 3OY7A 4JV5B 1DCMA 2D0OB 1TMOA 3F5QA 2P6MA 4NCBA 1V11A 3C3BA 3JRWA 2V54A 2OC9A 2Q6KA 4FZJA 3UAZA 2PRZA 4LF7B 4H77A 4Q3OA 4U2GA 5HUJA 2ZQYA 4ESVA 3KEFA 2IH4A 3C3WA 3IL2A 2DUJA 3WLTA 2Q5QA 5GY7A 3V6LA 4BATA 1P72A 4YFYA 3GNSA 2PQ6A 3GLHA 1OXTA 1YQ9A 4NR0A 4C2BA 1X7YA 4JCOA 1GTRA 3G9QA 1OAOA 1RADA 1MZVA 4DCCA 4TXJA 2UXDB 3RC2A 2RH5A 5HJEA 3ZEAA 2CZQA 3H2SA 1XTTA 1WDTA 1W4ZA 2IOQA 3AFOA 4YGYA 3RHTA 3WV4A 4DM3A 2XVYA 3NNNA 3WS7A 5IXJA 3BILA 1TK9A 3IA7A 4H1WA 3EWAA 2XODA 5A6VA 1PIWA 5HF8A 5K0SA 2P2NA 4UVHA 4EF4A 1E2GA 4P3KA 4DBVO 3EVZA 3L1JA 3FMFA 1FCJA 1W75A 2FRDC 3LL7A 2ERYA 2PGLA 2PGXA 3IE1A 4JASB 4C4XA 3T3HA 4BMNA 4O33A 5BVGB 2HQSA 2X9QA 1M3SA 4DEVA 1GV1A 2J9YB 3HLTA 2ISQA 3GFRA 2E6KA 5K0EA 4C04A 1JQ5A 4URYR 3RYIB 4K2HA 1EE1A 5JSHA 2XCRB 2UZAA 1B0PA 2PRJA 4OGFA 4BO6A 4JI6B 5D51S 1HFWA 2VAXA 1GU1A 1W47A 5F3WB 4CEIA 2YASA 5FT9A 5FDFA 2KHZA 3HU5A 1KVRA 3E9QA 2UZ4A 1MAHA 3FBGA 3BT7A 4XYEA 2CFTA 3IV9A 1LGYA 1ISIA 3K8QA 2QX4A 2ZRBA 1TC1A 1LU9A 3NHAA 3OZSA 4NONA 5E0KB 5HQTA 5D3KA 4I4TF 2A3RA 4B2LA 4C4ZA 5KDDA 3W9UA 2NUPA 4LYDA 3SJCA 4LZNA 5B1HA 4NICA 2C7RA 1WR8A 2VCYA 3N5KA 4N0PA 3G0DA 1NNI1 2XRMA 3GAZA 4WOKA 3DEFA 4RXMA 3TQCA 1VYVA 3U81A 2C7OA 3RBAA 3FA2A 2PO5A 4N5HX 4HQKA 1V1MA 2J9FB 1UT6A 1VKJA 2P7IA 3BWXA 1TCUA 5TV2A 5LQAA 2YDXA 2Q7DA 1YE3A 4B4KA 2GM9A 2Y1EA 3DP7A 1ORRA 3DBRB 1E1RA 1A71A 3RHFA 4DLKA 5HX7A 3JQGB 2PFSA 3R8FA 1M5TA 3IJEB 1MNQA 1YZFA 3OUUA 4MUNA 3BXPA 1NOJA 3TBFA 4NRDA 3WI7A 1O9BA 5FBKA 2EIXA 5C46F 4EHKA 3KFLA 1RDFA 2QY9A 4UTVA 4OP2A 4WGFA 4HPJB 4C3OB 1JEYA 4PYNA 3GPLA 2GA9A 5J5CA 3S0JA 3C14C 2XZLA 3FI0A 3SEQA 1Q57A 3AUKA 1ZI6A 4L28A 1YU6A 2YCLA 3ZTWA 3KQSA 3OCZA 4U9IS 4GOND 1T9KA 2V1XA 2ZWVA 1AGPA 3K5MA 1P5FA 1K6IA 3GO4A 2OM2A 3Q10A 1ZH6A 2VWGA 3FTCA 2ZE8A 4BFXA 1T0HB 1ANKA 3F3SA 1Z8DA 1XWWA 3CRRA 4KAXA 1SU6A 1L4EA 4Q34A 3RROA 4B44A 1U7XA 4R9VA 1V3QE 2A7QA 3EGDA 1JS1X 1E5QA 4HN4B 4FS3A 3DZBA 3ADBA 3E4CA 2VI5A 1TVMA 1UOEA 3EMDA 2ZRKA 2EG9A 3UA3A 2W8ZA 2VQDA 2O8NA 5HEKA 1P3JA 4YJFA 5AP9A 4BNWA 1PK9A 2VP5A 4J29A 3EXEA 3KJIA 4INJA 4C5BA 1VHJA 2GBGA 4UVGA 2EX1A 4J4HA 1C1XB 1K5PA 1UJBA 1KMHA 2PLAA 3G02A 3TLXA 3PGXA 2CE7A 4A6EA 2BMDA 4MB2A 2YWEA 5HOEA 1RZUA 1JE0A 3OZUA 1YL6A 2REOA 2QRMA 1U8ZA 2D1TA 4OHRA 4OP3A 1VSTA 3GRRA 1ONSA 3PFNA 5DX1A 1EK8A 4L22A 2XUDA 3FKIA 3K6SA 2BDTA 4OA8A 4MYSA 2H2FA 1BRTA 4FUTA 1A7KA 2COUA 1IHOA 4M7WA 4EFLA 2WSIA 3REQB 4KV9A 4M4SA 2R8RA 1LPQA 3ZVLA 1XPOA 3L77A 4NI5A 3MTBA 3G3EA 1EFAA 4YI5A 1E9EA 1YAHA 4ARIA 2FNAA 5CIYA 3MMNA 5I9TA 4UCFA 3TQRA 2GK7A 2PT5A 3GZNB 3PLAE 2NW6A 3U40A 3UWOA 4LNUA 4H7DA 2VOJA 4PGHA 2P75A 3BJIC 3PCXA 4EB8A 5ESDA 1KMCA 1OKKA 4B4OA 5F76A 4UQLA 3PQ7A 5KNBA 1I4WA 3K57A 2QI9C 2J6BA 1OLUA 1VRVA 5DJ5A 5FFNA 1L5HA 1KYWA 3CLUC 1P1FA 3AF2A 1G5HA 3C1AA 3B52X 4HXGA 1XQXA 1O03A 4BB5A 5FWAA 3I2IA 3PFWO 3UMBA 4E1BA 4EB6A 1XLVA 2R47A 1YDWA 3MGCA 4F6CA 3L04A 3I53A 4RY2A 1XYVA 1CDEA 1KBZA 2GLXA 4WBNF 3W5DA 1VL5A 4ON9A 5HZGA 3UCEA 1VL0A 3OCXA 3IQIX 4XQCA 4CF4A 4L9WA 3A6ZA 4B5KA 3I62A 2BJHA 1REQA 3EA5A 3DBOB 1U1IA 2E1PA 3UGJA 5REQB 4KXMA 1BW9A 1I50A 1PFUA 4RIIA 1CUEA 3KOXA 4OU4A 5HIKA 2OILA 3H1FA 2HA7A 3RFVA 1SIOA 1SGWA 1U0LA 4LQDA 4P0TA 1IN5A 2QJTA 3CHYA 4P31A 1ECPA 4Y0AA 4NXNB 2FG7C 2O5EA 1MZPA 1YCDA 7ADHA 5J3JA 2FCRA 1CHNA 4RK7A 5ALHA 2O1WA 4GLBA 1ISHA 4Q6BA 2I8AA 4K05A 5KSPA 1E0DA 1UK9A 3PXUA 1WW3A 4MDEA 1YJ8A 4Q82A 2PXCA 4KO4S 4UM7A 1VTKA 2C77A 3D81A 4O1MA 5D7BA 5K4GA 1HMYA 1PR0A 1RRVA 3A0UA 2FVYA 3HWWA 4QBGB 5AW0A 4WUVA 4RKRA 3G88A 4PW0A 2FK7A 5TGZA 2C2ZA 2WZCA 1K98A 2HC9A 4BU0A 1ADYA 1Y5NA 1A36A 2Y1CA 3NIGB 1WPQA 1L3IA 1PHPA 1ZXLA 3DCIA 3V8EA 4BZZA 1UBEA 3ILSA 1TWFA 1NM5A 2ZWMA 1W4RA 2O7SA 1MU0A 3K1AA 1NP3A 3TJRA 1YGPA 1ZCJA 5KHLB 4CUZA 1BCSA 2FPWA 1UDAA 2A14A 3VOSA 2QN7A 1DXHA 3KKEA 4B8ZA 3MW8A 2QAJA 3QVGA 1ABFA 2GN6A 2ZJZA 3WG9A 4RTLA 2CXTA 1P7ZA 2DERA 3RRMA 4R8MA 3OU6A 2JDIA 1RE0A 4ZQBA 4EG4A 2HYDA 3QBVA 1Q3TA 1UOQA 2R7AA 1AKWA 1CEXA 3IVXA 3N70A 4WT7A 2GR9A 4PLGA 1P73A 4IVPA 4NXMB 4QDZA 3GRYA 4HAYA 3WYAA 4MA5A 1ZG3A 4XGRA 4XSVA 4C0KA 1VBFA 2HWWA 4YAKA 3DO8A 4FMDB 1Y1KE 3OY2A 5FA8A 1QIKA 3EMKA 3LYHA 1H1TA 4KYIB 1QR2A 4MV1A 3VHRA 3E22A 1QQ7A 3ZCUA 2ZR0A 4RK6A 3QWAA 4JLOA 1CEQA 3NIFB 1ZH4A 4MX8A 4HLNA 4DCNA 1KEUA 8MHTA 2C5FA 2R97A 2Y0PA 5JDCC 4UC0A 1PWZA 2YJGA 3DDUA 5F5XA 1N6OA 1E63A 4H7PA 1SXPA 1NWCA 3N8HA 1KDTA 5CEFA 1AE1A 2BONA 3U5ZB 2I4IA 4C7MA 2ZSAA 4MCAA 1T5HX 2FGJA 2ZGVA 3B12A 4O02B 4ARVA 5IC6A 1MX9A 5KWIA 5LB4A 1JQJC 4B84A 4DGQA 2HRCA 2ZJ5A 3AC0A 3BK2A 3QUAA 1UJ2A 2VC2B 3A7EA 3P9RA 3HNRA 1NAIA 1EFVB 1TL8A 2JGEA 1APBA 1VPVA 1XMSA 2JARA 4FFWA 4IXWA 4RFLA 2B21A 1RAAA 4QJ5A 4UBKA 2M2IA 5EYPB 1IG3A 3M1IA 1SH7A 1D2CA 2FQWA 1E5LA 4KKXB 4KLRA 5H0IA 4HWRA 1Z4OA 1T0IA 1QIGA 5EMNA 3RF6A 1OBVA 3W78A 1QO7A 4Z2AA 2DZDA 4MWDA 3ZIAA 4O4HA 3EH1A 4D8YA 4IKOA 3FMVA 1GQQA 3U1VA 1X1QA 3UBMA 1ZSVA 3DZHA 1P0CA 1EE9A 1U65A 2P4QA 5BW6B 3GLFE 1USGA 4W99A 3WHKA 3OBBA 2LIPA 4HNQA 4M88A 4KMSA 4YT2A 1NRWA 3PRHA 4NV0A 4AO6A 4FMCF 3M4YA 2PCJA 1N6HA 1FDTA 3FYUB 3I45A 2EKDA 3D2LA 3QE0A 4PSAA 5T8KA 4H3SA 4HDCA 1OV6A 3ZN2A 2WSSA 4A2QA 2GCOB 4UXHA 5EPEA 5I7EA 1XV5A 3ORQA 4ITRC 2XRZA 4EHBA 5FPHA 4XXHA 3OO0A 1QQ6A 3TR6A 5K3EA 2JI7A 2YV2A 5FEUA 4QIWA 4XEUA 3Q3IA 3CCBA 4EVQA 3IAFA 2QN9A 4YLYA 3BERA 1Z4QA 1FNSA 4TV8A 5ED0A 5I8ZA 5JZOA 3B6JA 4MKRA 3R0QA 2PZFA 4DL9A 3ANLA 3DFZA 1ESEA 1QUEA 1GITA 3Q7SA 4MNTA 2PFKA 4JU9A 2JGAA 3LT0A 5A3QA 1VG1A 2RGXA 5H8WA 4WW0A 1RAFA 1L4GA 4YP0A 1L5NA 4CR8A 1KEWA 2DPXA 1B6RA 3LX4A 1TEVA 1YJBA 4AIRA 4A7PA 3CEJA 3EQ6A 3N76A 5F5LA 3TAHA 2ONYA 2W0SA 3O9ZA 2Z5GA 4J3FA 4NENB 4LMOA 4IHJA 2Q9AA 3QUQA 3O2JA 1Y8RA 2CNWD 1N5KA 3UUFA 2WICA 3O3MB 4B85A 2GAJA 2F43B 3M6VA 1X7GA 3ETLA 1BE8A 1K7CA 3MBOA 4U2FA 4BJ1A 2XNDA 1JFFA 1R6AA 1NF8A 3R0IA 1HGXA 2ZKLA 4GOMD 4BNDA 1NU8A 1W52X 1R9NA 2PLRA 3M81A 3ESDA 5H80A 3HA3A 4RORA 3RADC 1AKQA 5C52B 3FF1A 4H6PA 4PXAA 4CWAA 2XE4A 5JBQA 2OXEA 4Q02A 3QIAA 5HA5A 1IIBA 4UHDA 5EZYA 1GPMA 1Y3BE 1ISMA 1DAGA 4MDHA 4QNRA 4IRUB 1CRLA 2EARA 4E22A 4UBOA 5L4NA 4BB0A 4A0RA 4Q7JB 5DN9A 1DHRA 1NIJA 2G9RA 1KIFA 2BJVA 3OCYA 5D1NA 3WAKA 4TT3A 3MEQA 1G291 3UQYS 2FUEA 4H4DA 4MQBA 5CVDA 3BF7A 4UHCA 1ORVA 4QULA 1N2CE 4ODIA 4O4LF 2F3PA 1PTKA 3DE3X 3OZGA 4OQLA 3VQTA 4DT1B 1PR3A 4LGCA 2FUKA 3M6WA 4K1XA 2NGRA 2JEZA 2QTVA 2OTCA 4IDGA 2VTEA 5B7PA 1NXWA 2AA3A 3UW3A 4WLUA 3OPXA 5D7NA 4MOWA 3ZNPA 3UH0A 4DZRA 4EI7A 2O52A 1VSUA 1OWOA 2AOTB 3N87A 2VHQA 3PJEA 4GOLD 4D79A 3I1FA 4MUGA 3NJ4A 5C9ZA 1K8YB 3LX8A 3WKCA 5BORA 4L5CA 1FVFA 5I9NA 1GUYA 3VU9B 5DU2A 2W8BA 3CU5A 2J5QA 5T41A 4LW8A 2WM9B 4W9NA 5E3JA 1IOLA 2IIPA 2WHPB 3SNKA 1ZK4A 4LKRA 1NDUA 2GD0A 2NADA 2HHCA 2Z8XA 1F17A 4EMSA 4KTVE 5ECYA 4XFKA 3LQ2A 3HADA 4G1EB 4PO9A 1WEHA 4RCVA 2PH5A 4Z4GA 3ZLUA 4D9IA 1UEJA 3I23A 2DTEA 4A0QA 5B57C 6REQB 1CF4A 1SXJE 3I28A 5JZSA 4IUBS 3PRJA 2B2XA 2Z1DA 3A25A 4RA6B 1EB9A 1FMTA 3WBKA 3EVCA 3HXPA 4UVIA 3ZIDA 5B1EA 1KI4A 1MEJA 4DPLA 4C9BA 2QD2A 3LT5A 3HCNA 3KWLA 2VTKA 4XQGA 4KB5A 3ZTTA 2AFHB 3QXHA 1EVIA 2HLDA 2FZCA 2RJNA 5I5EA 3UHPA 2NVWA 3L0YA 4WESA 4DLLA 1EBUA 3H16A 4A9AA 3TDKA 5JCJD 2JLAA 4IQ4A 4B33A 4WZBA 3PNSA 4YAIA 2F8SA 2ZAMA 3EXHA 3KZCA 4NARA 1Z0JA 3LW7A 3L92A 3EAGA 2NUTB 3KLPX 3W0LB 4RULA 2CVPA 2ZJFA 3L7LA 4BFZA 3QUTA 4CM7A 1NVDA 3G0OA 1ADJA 3G6KA 1PGOA 4V1CI 3PPYA 4YY3B 4MR9A 3NYQA 1WHSA 4K7JA 4W8OA 1UBJS 2ORWA 5F35A 3DMFA 4GE3A 3JQ6A 3UPDA 5JYBA 2CNKA 2BL4A 3ADOA 4HCJA 4IVQA 5E8RA 1Z0ZA 3L46A 1WSDA 2YXDA 2PUAA 2Z98A 1ACMA 1IL0A 4PHGA 3HKBA 3NIBA 3IA2A 2WZDA 4RLSA 3BMCB 1I5RA 3DJYA 3SDZA 4C0QC 4D80A 3EDYA 3WE7A 3NXKA 2C5EA 3ZV7A 1LPOA 2JLUA 3OJ0A 1U0TA 5JS7A 4HKTA 5BWMA 5J5VA 3C87A 5DDIP 5DTJA 2L18A 1ABEA 1JR4A 4AJEA 2XQGA 3IP1A 1XELA 3D7SA 1XZKA 4LQCA 3DU6A 2QNBA 4PNEA 5JJ5A 2QAIA 2Q8PA 4IWXA 4K9QA 1AO3A 2ATXA 4I5GA 1ZUNB 3AFHA 3L9WA 1MC4A 4ZOLB 1DXQA 1YL7A 3GUUA 4H31A 2DP4E 4NZPA 1G5TA 4J7XA 4HAXA 3CN7A 1TQ4A 4JBHA 3RS0A 3OZXA 4YUXA 1Q1EA 2ZZKA 3ZHUA 3H5OA 4RTPA 2IQIA 3LBAA 1Q8IA 1NI4B 4B2PA 5DP1A 1KSFX 2FHPA 4X3PA 1N3YA 5EIOA 1CY2A 2AQIA 3VSEA 3B2QA 3LP8A 4NZZA 1FRNA 1GYQA 1YB2A 2ENUA 4Z5XA 3U9TA 3UENA 2QJOA 3DE7X 1SJ9A 2IV2X 4ZJYA 2XNJA 2P4SA 3K9WA 5K6RA 1Y80A 2A5GA 4NBKA 1Q15A 2I8LA 2PWYA 1T3TA 3OQIB 4HZUB 1OH6A 3WSVA 4L4XA 4OQ4A 3RU3A 3WO0A 3KYLA 2QZ4A 4DSNA 4CU2A 1QVZA 3L6UA 4L78A 1PZGA 3N86A 5KSWB 2PMWB 2J5BA 3WGUA 4PPGA 3MBIA 2JJMA 3RS7A 5CDUA 1R0LA 2QAGA 1MF7A 4ZQEA 3M3HA 2BM8A 3RS8A 3GU3A 1NH3A 5HR5A 3EIHA 1DFIA 2JL1A 4K81B 4WOCA 3GV0A 4BQQA 5ICGA 5I8PA 1QH8B 1E6LA 1ZZEA 4ND7A 2O48X 3V2GA 5EIAA 1YSCA 3PIIA 2BZ1A 1ELOA 5FOXA 1W0JD 2RHCA 2O3TA 4LF6B 1XWIA 3FNGA 5HM6A 3PE3A 1NNUA 4JH0A 4LA4A 2V6MA 5IAEA 2GFHA 1XCGB 2XD4A 3SYMA 4AUEA 1O0CA 1NHGA 2DUNA 1I7PA 1D6MA 2WNIA 2BUAA 2XUKA 1MD9A 3PHIA 4MTCA 4UBNA 2I29A 4RDXA 4LDJA 1DADA 1Z47A 3QMVA 3EZ2A 4MVWA 2I2BA 3CRW1 4OL0A 4K9LA 1RLMA 3AF5A 1E9RA 4K0KB 3OUZA 4JQOA 1L5GB 4WKPA 1Y6JA 4MQ5A 3JWHA 2JFPA 4JT4A 1LH0A 1NI5A 1Y7HA 5JAIA 4IJ5A 4E2YA 1KL7A 1UBTS 1SVLA 4YLEA 4EUKA 1C9MA 1G9XA 1LNZA 4UTXA 2O8FA 2Y1XA 3H05A 3T38A 4C88A 4DNQA 5GADl 2VT2A 3CX3A 3I01M 2Z4TA 3T1NA 1O0BA 2CXSA 3W5CA 1E1YA 1VI5A 3EEOA 1ZFNA 3DOOA 5CFNA 5KOHB 4QASA 4X9XA 1EINA 1V9CA 3VC2A 1NZFA 3TZEA 1XCOA 2ZB3A 4PFQA 2XUIA 5C1OA 5HKLA 1K2WA 2WB4A 4GOKA 1RJ9B 4ZVRA 3DH0A 1QYVA 3KHUA 5K8JB 1QVAA 2J32A 1V1JA 4WBNA 1J9GA 1L7DA 2R6JA 3BMNA 2Z4RA 1JQAA 3KD2A 1FPMA 1MGPA 3B48A 4MW2A 5ALRA 1NW7A 1Z56C 4FHGA 2B98A 1TB4A 1LI4A 3MCTA 2FU5C 4U3JB 4KFSA 5HRAA 2VSXA 3PHGA 4W7SA 1TC2A 1VDZA 1EK1A 2XRFA 5CT8A 1I51A 2A0FA 3L6OO 4XRRA 1E4YA 4HLCA 3I73A 3Q98A 2FSSA 3VYUB 1Z62A 1I3NA 1M2EA 4Y9SA 5ADHA 3HDVA 1DO8A 5SYMA 4DUYB 1VE1A 3VPXA 1HT1E 1XQ9A 3GK3A 4RJTA 4UTPA 4TM7A 4ZHSA 5D8DA 3Q0EA 3TMAA 1C8VB 1OPRA 4HGZA 1KYXA 2BFFB 3BTVA 1KY5A 1QCDA 2V4MA 1KVQA 1MB3A 1TX4B 4W1PA 4WKCA 5AJZA 3RVSA 3M3DA 4CMCA 5HKBA 5I45A 2R85A 1TQDA 1YS1X 4WN9A 2IXEA 1ENZA 2AJCA 3R7AA 1Y4SA 3K2BA 1N2GA 1U5CA 3FIJA 2GEVA 4LVUA 2ZSKA 3KJQA 3VX3A 5KPDA 3QP9A 3EHEA 3LHDA 4DBLE 2NLOA 2HO4A 2VO1A 2XQKA 2H3EA 1XGKA 1MJHA 2DBRA 4FIDA 1YZQA 2ZRMA 4IG4A 4MVJF 2G5PA 4PC7A 3THYB 2X2PA 3I09A 3N5CA 4IDPA 1EKXA 4XIGS 4YCCA 3DZGA 1Q1GA 3JYNA 1OHHD 4LXTA 3KQHA 4EATA 4IQFA 1DSSG 4Z1OA 3UC5A 4ZDJA 4TGLA 5C34B 2BR5A 1G4UR 4L76A 3MGKA 2ZIXA 4J0KA 3UKJA 3HXOA 1Q92A 5JT1A 1NQXA 2IV3A 1B00A 3INRA 3HP4A 4EI8A 3D6FA 4MIOA 3HB0A 3ZI0A 1F0PA 2QL6A 4DKJA 4D6PA 3T7IA 4WZZA 4DCSA 2LIVA 1T25A 3ZHSA 5KU7A 4OVKA 3OT5A 2R7NA 1Y37A 3O8QA 2HA3A 4LSMA 4BB6A 1E2FA 1GYRA 4R81A 1ETUA 1LF0A 2SECE 3QKRA 4MAAA 2QX6A 4YMVA 3P32A 1SWVA 1AUQA 4NFHA 3DAHA 5C53B 2XSZD 1MDBA 4JKOA 4B80A 1H0KA 1NVKA 4GOJA 1KFCB 1M0WA 1N2EA 1TL7C 4M38A 4AO8A 2DEUA 4Z2YA 1FC0A 3L4JA 1BMDA 3E2PA 5JSYA 4ZPXA 3CF4A 3GROA 4TWAA 2WJHA 3DDCA 4W7IA 5A1JA 8AT1A 3GRPA 1X94A 3TEMA 2I71A 2GN0A 2LCFA 1LQ2A 3MINB 5C1PA 5HPYB 1S6YA 3UPUA 2QW0X 2EQBA 1J6UA 1VL8A 1X7ZB 2JIPA 2FMXA 3EUAA 3AV3A 4R7ZA 3D3WB 4BVBA 3I9MA 4A15A 4JEUA 3TH5A 4C07A 3ZWWA 3GBSA 1KHHA 1Y1TA 4D6XA 2ZJOA 1Z6AA 2QZZA 3T1TA 1BHO1 1J8QA 2BHTA 3STHA 5B58C 1PKEA 5KX5A 2GXAA 1PZXA 3IIKA 2O5CA 1MX3A 5BNZA 2CLFB 1FRVA 2WTEA 2XGJA 1T26A 1OW3B 3H9CA 4NZNA 4EO7A 1TLFA 1SBNE 3B1JA 2MSDB 1JLMA 3HG7A 5FOUA 3HNPA 4PYMA 2C2BA 2DFLA 3OC0A 4E94A 4F4HA 4X92A 1K68A 1I2MA 5G3ZA 3TW0A 4PLHA 3U7QA 3IIEA 2MHCA 1Z0IA 5KS2A 1Y4ZA 5CEJA 4OHFA 4R16A 1VB5A 2GWRA 3I04M 3N2GB 5FOTA 3T3DA 5IUNC 1TJ5A 5CLLA 1KFJB 5GWXA 2G0AA 3ZDFA 1ZUIA 4B6FA 2FP4A 5K0FA 5ES3A 3HYSA 4I81A 4PN7A 1R2QA 1FS4A 3G5UA 1SIBE 1J70A 1DQNA 4KN9S 4MV7A 4HYYA 4UW9A 1KP3A 3EIUA 3ZU4A 1E2NA 4C4AA 5DV9A 3E61A 1O8BA 2YX1A 3T9BA 3ZGYA 4P7JA 5EE1A 3B13B 2XAAA 3K5HA 3OE4A 2I4LA 3PL5A 3H0EA 3OZIA 1Q22A 3ESBA 4Y2RA 2GBIA 1FLVA 1E3QA 4OAQA 4HDKA 1KIAA 1TWHA 4A36A 4G84A 4DHWA 1SR8A 1XTJA 1Z25A 3I04A 1G63A 5DLDA 1H0HA 1LLQA 1DBSA 1Y7IA 1Z22A 2VK8A 2IXFA 2VQ6A 3ABSB 1RLTA 3C8HA 3Q6NA 4BL5A 2PXHA 2CFRA 3NFYA 3WGGA 1CT9A 3UOWA 1NV8A 2QTAA 2CLLB 2QN1A 2ZRLA 3V2HA 1C9YA 2Q3LA 2BFPA 2Q0QA 3GRAA 3L8FA 4XCXA 3AWIA 3JYQA 3RK0A 4L9AA 1TWAA 3VPDA 2PN1A 5DGTA 1BE6A 1SAYA 3ELWA 1BDBA 1P1RA 2JFZA 3R5XA 4FYJA 2B4RO 1NDHA 3JU3A 4G07A 3V1NA 4B2YA 5JNRA 1Z4MA 3C4JA 4MPJA 2BMWA 4M60A 3UHJA 5LWQA 2ZU0C 1DLJA 3H9GA 3HB4X 1U0OC 1UBSB 3QPBA 4RMJA 5FO1A 3ZBPA 2X6TA 3DOUA 3A2LA 3DKIA 2GETA 1P81A 2R1VA 3AI3A 1W76A 3KVRA 1HM5A 2WJIA 2HLPA 5KWVA 3DONA 3PNVA 1Y8AA 4WA7A 4O2RA 1S2MA 3QMWA 2QRVB 4Y9DA 4ZI7B 5CXQA 1DFGA 3EC1A 2XMBA 4RADA 3I6QA 2Z56A 3T95A 1J06A 1XDDA 4HDNB 3GDFA 4BHTA 5EJEA 3KSAC 4FCCA 3E82A 4LJYA 6NULA 2JAWA 1EFPA 2IYNA 1C9JA 2JJ2D 2XITA 3IX7A 5T4EA 3IILA 4O4LA 5K2MA 2MINB 1CRQA 1PWEA 3HEMA 3QUCA 2GSDA 1RI4A 4A16A 2NVOA 4G81A 2FHSA 4TMXA 4WLOA 6Q21A 4BASA 2R62A 2HMVA 3WJ1A 1SVWA 3PF9A 1M76A 4GM0A 3B82A 3IE2A 4KGVA 5KVVA 4OGKA 4C22A 3UV6A 1WMEA 5BW4A 3NANA 3OOWA 1XLTA 2EJBA 3OSZA 5B6PA 4L4SA 4HDOB 1T2UA 1RQNA 2GNAA 2UVPB 3SMVA 1JJVA 4OK3A 4ONEA 2OCGA 4JLDA 2VJQA 1UINA 3WGMA 3R8CA 4P7GA 2CV2A 2F1KA 4YUYA 4EELA 1Q0HA 3ZS8A 3ZY4A 1FQKA 2GEBA 4MJ3A 1TQHA 2AI2A 3QQPA 5CXSA 2B1RA 1NWHA 2O8CA 4RKEA 3WIDA 4MWGA 2KQUA 4IO0A 4QGGA 4BQSA 2UDPA 4G5HA 3QTLA 5C7LO 4FE4A 3FRIA 4O25A 4D5EA 3O4IA 1JTVA 5GM2A 4Q6WA 3TCKA 3DSRA 4L72A 4DVJA 1CZNA 1R00A 3TBKA 2PUEA 2YC2C 1NVVR 1FOEB 4QRDA 1KS2A 2C57A 4BMSA 1I5EA 5DN6A 4D3FA 2VDPB 2PMFA 5ICFA 1OIVA 5CCEA 2PYIA 4COKA 2GCEA 1Q7CA 4BLWA 5AW8A 3VKGA 2QRHA 4UPDA 4UHJA 5H3HA 3MWEA 2XXAA 4WI1A 4DAOA 4LRYA 1F0YA 4HB2A 4G09A 4O2AF 2ZIEA 3AY3A 5DXAA 3G23A 3EVBA 4DADA 3GPIA 1HDZA 3GJZA 4NLLA 4PHCA 4RO0A 4BO9A 3E2IA 4XGIA 1FYDA 3O90A 3P19A 3WR5A 2RC6A 4EZIA 1T36A 3DJFA 3JAMA 2E4UA 1EFDN 5L3ZA 1ZMBA 4RDHA 3L8HA 3JARB 1R4MB 5AUNB 1XZPA 2L69A 4EP1A 4HRXA 1KVUA 1SBQA 3LUHA 2XPCA 4MV3A 5A3SA 5LKRA 1T4CA 3IBGA 5DYIA 4CLOA 3NYIA 2DFKB 1W36D 1YHZA 1DRJA 2FW1A 4REOA 3WWDA 2P1ZA 1JN0A 3GFPA 3MOGA 4YT8A 2O7NA 3I8XA 4LTNA 3RYHB 1U0GA 1M0SA 1NW5A 1KI7A 1Y6QA 4MUMA 4OY3A 1OX6A 5TX7A 2CVHA 4JEMA 2PWAA 2XYGA 4MQEB 1Y9DA 2WJVA