4KC6A

Crystal structure of c-terminal deletion mutant of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 61
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kc6A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kc6A02
1ISEA 1IS1A 1EK8A 3FHZA 4DDQA 2PHCB 1EH1A 1BGWA 2P5MA 3BUEA 3L4JA 3FOFA 3OEPA 4KAWX 4KC6A 3LPXA 5JVOA 1Y698 2KWAA 4JLRC 3OREA 3V4GA 1GE9A 4G0UA 1AB4A 3LAJA 3QX3A 1DD5A 3FOEA 5MLC9 4G0VA 2ZFZA 1F9NA 1B4BA 1BJTA 3CAGA 2XCRB 2Y3PA 1ZVUA 4KB4A 1XXAA 1WQFA 1WQHA 3LHPS 4KDDA 4L8IA 3OPFA 3NUHA 1WIHA 2XCOA 5JSNB 3ERED 4GFQA 4KB2A 3LF9A 5JSBB 2XCQA 4J3NA 4OYDB 3MMLB 5CJ9A 4FM9A 3L4KA 1XXCA 2RGRA 4G0WA 1XXBA 1WQGA 3VA7A 3LAPA 1B4AA
chains in the Genus database with same CATH superfamily
5C4JK 2R92A 3T02A 3HOYC 3S15C 5EGEA 4QIWD 3K59A 4Q5VA 1R9TC 1A31A 3HOWK 2PMZA 4LK1A 5IORA 3PO2C 3S2DK 4L8IA 4BBSK 1K4TA 4GT9A 4FM9A 1MIUA 3K7AC 1WQGA 4LJZA 5EGHA 2R7ZK 4KM9A 3BP8C 4YFNA 3L4JA 3BUEA 5IYBK 4O2DA 2NVYC 4P5BA 2A69D 3AQOA 2E2HC 4BY1C 4XCHA 2B63A 1Y1WC 3S1MC 2ZFZA 3CAGA 3N0BA 2JA7C 1WOOA 4AH6A 1WORA 2JA8K 2B63K 4C3IC 3I4NK 5C3EK 3N0CA 4GZYA 2FQTA 1TWHK 3FHZA 2WAQD 3BP3A 4Q4ZA 3S16K 4EJ3A 4AYBA 1R49A 3GTKA 5JFEA 4A3GK 4KC6A 1R9TK 4A3BK 5C4XC 5JVOA 3GTGA 4BBRK 2R93A 3WVOA 4G0UA 5TJ3A 4A3CC 4Y52K 1Y1WA 2B63C 3GEEA 3K5NA 1L0WA 3HOXK 4A3KK 3HOZC 1O25A 3HOVC 2V6TA 3K5MA 1Y1VC 3A8JA 2A6HA 1PJ7A 2E2JK 3RZOC 4G0VA 1J98A 3L4KA 1XXCA 1YCLA 4C2MC 4A3JK 1TWFA 2NVQC 4KM8A 5M3FK 2E2IA 4C2MA 4XSZA 3I4NC 1TWAA 1SC7A 2ZUEA 4KMHA 3TFIA 2JA7K 3GIRA 1ZQ1C 3DXJA 2VUMC 1TWGC 2Y0SL 1TWCK 3H3VD 3HOYK 3HKZL 1YNND 1IW7A 4OIPA 3FKIC 1VJEA 3AD9C 5C44C 5C9HA 1XZPA 4C3JC 1VLOA 4A3MC 3S1RC 1IL2A 1I6VA 4NOIA 3K5LA 3S2HK 1T8IA 3G4CA 5TMFA 1TGOA 3A8IA 4BBRC 3HXAA 4BKWA 2R7ZC 4A3IK 1I3QK 2JA6A 1Y698 1TL8A 2NVYA 4BY7C 3TFHA 2PMZL 2YU9C 2JA7A 4XLNA 3SJRA 1A36A 5FLMK 3S15K 3TFJA 3HOUC 2YU9A 4OIQA 2E2JC 4PABA 1WSRA 1TWHA 1I50K 1PJ5A 4KATA 4KB2A 2O5JA 3A8KA 2B9SB 2RH6A 4G0WA 4X6AK 1ZYRA 3GTJA 4YFKA 2P8TA 1EJ9A 1IW7D 2VUMK 2PHCB 4BLAA 3GTGC 3S14K 1YNJD 4FYDA 4ZH4A 3S1MK 1EQRA 1IBAA 5IP9K 4OINA 3OREA 2JA6C 1WOPA 3G4AA 3H0GC 1WCMK 1O2FB 2GSNA 2NVYK 1F9NA 4P5AA 3GTMC 5IYCK 1Y1VA 5CHPA 3Q3QA 1O24A 3GEIA 5M5YK 3K7AK 4OIOA 1TWHC 4PAAA 3SZZA 1SMYA 5M3MK 1O29A 2E2IC 4O26A 2BE5A 1IS1A 4BY1K 2P5MA 3S1QC 3GTLA 3M4AA 2CFAB 4BXXC 1TWAC 2FQOA 2VUMA 3MAQA 4KN7A 1LPQA 4QIWA 4QCLA 3GTQA 2NVXC 1J6VA 4IP8A 1XPPA 4A3DK 2GSUA 4Q5GA 4KMDA 3FKIK 5JSNB 1I50A 5IYCC 2RGRA 5TMCA 4GTCA 2JA6K 3S2HC 1BGWA 4LMOA 5IP9C 2E2HA 3HKZD 1VGXA 1EI6A 2V6SA 2GSOA 2JA5A 1GE9A 1I6VD 2BE5D 5M5XK 5CQGA 1SFOA 4A93C 1ZBSA 2JA5C 3IAYA 2E2HK 1Y1WK 4M1XA 3CQZK 4A3LK 2ZUFA 4LLGA 4J3NA 3AH5A 4MQ9A 4GTFA 3MMLB 4YG2A 4ILDA 1BS2A 3PO3K 1RR8C 4NOMA 1WOSA 4AHCA 4BY7K 1HQMD 4FGUA 3S0XA 3M4OK 1JOEA 1O27A 3S17K 2KWAA 3GTKC 1X31C 2NVTK 1PJ6A 3V4GA 3HOUK 1F7UA 3I4MC 5MLC9 2JH3A 3DU5A 3GTPK 1XZQA 4C3IK 2D6FC 2JA5K 3T01A 2PMZD 4LK0A 4A3EC 1HI9A 3RZDC 1SFOK 3H3VL 2Y0SD 4GFQA 3HOXC 4GTEA 1K83K 4KMUA 3JSTA 1RU0A 2R93K 1XZPB 4A3FK 3S1NK 4G7OA 2E2IK 2O5IA 1O26A 5HL8A 5FJ8K 1RRJA 1Q8IA 5IYDC 3S17C 3M4OC 4IP9A 3FKIA 1DD5A 5E68A 3TTGA 1TWGA 1UV7A 4C3HC 1ZXOA 3H0GK 2A68D 3RZOK 1V5VA 4NOKA 3HOWC 1O2BA 1USOA 4A3KC 3HOZK 4C45A 4YFXA 1G51A 1TWAK 3GTOA 3S14C 3M3YC 4WJ4A 2WAQL 1TWCC 4QIWL 3GTLC 4KASA 2R92C 2R7ZA 3PO2K 3S1QK 3QX3A 2R4GA 3SZYA 2Y3PA 1WCMA 4KB4A 2YU9K 4BBSC 1R9TA 3AQPA 1F7VA 2WB1A 2A6EA 5M5WK 1WQHA 4Y7NC 4G7ZA 2NVXK 4WILA 2W7VA 3N3YA 5JSBB 1VH2A 1IQ0A 1YX2A 4BXXK 5D4DA 3GTOC 1HQMA 4GTDA 5C3EC 1EH1A 2A68A 1DCHA 3LPXA 4X6AC 3M3YK 4MEYA 1A35A 4D3ZA 3DU6A 3GTGK 1C0AA 4RMFA 3FOEA 3GTKK 1B4BA 3H0GA 1BJTA 4A3CK 1ZVUA 1K4SA 4A93K 1INNA 3GSIA 3WODA 4QJVB 2GAGC 3ERED 4KMAA 1I3QA 3S16C 3AD8C 2O5JD 3VA7A 4JK1A 1BDFA 3LAPA 4Y7NK 4A3LC 4DDQA 4H3TA 2WAQA 4F3EA 3CQZA 1I6HK 2A69A 4AYBL 2A6HD 3GTPA 3ADAC 2R93C 3K57A 3GTPC 3EQLA 4FZBA 3HOVK 1XZQB 4C3JK 1K83A 3RZDK 2NVTC 5IOTA 1DCOA 2XCRB 3P9AA 1F93A 4KN4A 4GTLA 3KYLA 1WSVA 4KDDA 3I4MK 2CFAA 4C3HK 1TWFC 5C4JC 3S2DC 1XXBA 2V6UA 1YNJA 1YNNA 1V9MA 4D3YA 1TWGK 4KARA 4KAWX 4A3FC 3S1NC 2GAHC 2JA8C 2WB1L 1AB4A 4A3IC 4P9SA 2R92K 3AD7C 2CW0A 4A3EK 1SFOC 2NVXA 1XXAA 3GTQC 1USMA 3GEHA 1WQFA 4MEXA 3LHPS 1WIHA 4GTBA 5FLMC 4NOLA 1I6HC 2PA8D 4OYDB 3GTJC 5CJ9A 1I50C 4OIRA 1IE0A 4A3BC 1ZYRD 3OPFA 4FXDA 1ISEA 2A6ED 1J6XA 2NVQK 2PPBA 4BLBA 3GTMK 3PO3C 1TWCA 3K58A 4GTAA 2PA8L 5C4XK 4WJ3M 2F4QA 5L46A 3LAJA 5IP7K 1VRQC 4LOWA 3GDZA 1TWFK 4AYBD 1O2AA 3GTLK 4C2MK 4A3JC 1J6WA 4LQYA 1WCMC 4XSXA 4XLPA 1SEUA 2XCOA 1R5ZA 1SMYD 3LF9A 1JQWA 3GTQK 1O28A 1JVIA 4LR2A 5IOQA 4A3MK 3S1RK 1B4AA 1KQ4A 3CQZC 4A3GC 4G7HA 1EK8A 2CW0D 4QJVA 5IP7C 2Y0SA 3OEPA 4Y52C 3FOFA 1DCPA 4AN8A 3IPJA 3GTOK 3HKZA 4JLRC 3T00A 5IYBC 3GTMA 5C44K 2EBBA 4Q5SA 5IYDK 1NH3A 1Y1VK 1K83C 3K5OA 1EFWA 3GTJK 5IOSA 4A3DC 3NUHA 2WB1D 2XCQA 1I3QC
chains in the Genus database with same CATH topology
1RR8C 4NOMA 1TGOA 4AHCA 4DDQA 4H3TA 2WAQA 1HQMD 4F3EA 3CQZA 4FGUA 4BKWA 3S0XA 2A6HD 3GTPA 2R92A 1O27A 3K57A 2JA6A 1Y698 1TL8A 2KWAA 4FZBA 2NVYA 3V4GA 2JA7A 5EGEA 3SJRA 3K59A 4Q5VA 5MLC9 1K83A 1A36A 1A31A 2JH3A 3DU5A 5IOTA 2YU9A 2XCRB 2PMZA 5IORA 3P9AA 1TWHA 4GTLA 3KYLA 4KDDA 4L8IA 2CFAA 1K4TA 4KATA 4GFQA 4KB2A 4GTEA 4GT9A 4FM9A 4G0WA 2B9SB 1MIUA 2RH6A 1XXBA 1WQGA 3GTJA 5EGHA 1EJ9A 4KM9A 1IW7D 2PHCB 4BLAA 1V9MA 4D3YA 1YNJD 3BUEA 1O26A 4KARA 3L4JA 4KAWX 4FYDA 4P5BA 2A69D 3AQOA 1RRJA 2B63A 1Q8IA 3OREA 1AB4A 3G4AA 4IP9A 3FKIA 1DD5A 2GSNA 2ZFZA 1F9NA 1TWGA 4P5AA 3CAGA 3N0BA 4C3HC 2NVXA 1Y1VA 2A68D 1XXAA 1ZXOA 5CHPA 3Q3QA 1O24A 1WQFA 3LHPS 4NOKA 1WIHA 4GTBA 4C3IC 4NOLA 1O2BA 3N0CA 1O29A 4OYDB 5CJ9A 4O26A 1ZYRD 3GTOA 3OPFA 4FXDA 1ISEA 1IS1A 3FHZA 2A6ED 2P5MA 4EJ3A 3M4AA 4AYBA 1R49A 3GTLA 3GTKA 2CFAB 4KC6A 5JFEA 4BLBA 2VUMA 3GTGA 5JVOA 1TWCA 4KASA 3MAQA 3K58A 2R93A 2R7ZA 4GTAA 3WVOA 4G0UA 2F4QA 5TJ3A 3LAJA 1LPQA 3QX3A 2R4GA 1Y1WA 4QIWA 4QCLA 3GTQA 3K5NA 4IP8A 2GSUA 2Y3PA 1O2AA 1WCMA 4KB4A 1R9TA 3AQPA 4Q5GA 1O25A 4KMDA 2WB1A 3K5MA 1WQHA 4LQYA 1SEUA 2XCOA 5JSNB 1R5ZA 1I50A 1SMYD 3LF9A 5JSBB 3N3YA 1O28A 2RGRA 4G0VA 4LR2A 5IOQA 3L4KA 1XXCA 4C2MC 1TWFA 1B4AA 1KQ4A 4KM8A 4GTCA 1EK8A 2CW0D 4C2MA 2E2IA 1TWAA 4GTDA 1SC7A 1EH1A 4LMOA 1BGWA 2E2HA 4KMHA 2Y0SA 3OEPA 3FOFA 3LPXA 4AN8A 3HKZA 1A35A 4JLRC 4D3ZA 2GSOA 2JA5A 3DU6A 1GE9A 1I6VD 3GTMA 2BE5D 5CQGA 1SFOA 3FOEA 1ZBSA 1YNND 1B4BA 3H0GA 1NH3A 3IAYA 1BJTA 1ZVUA 1K4SA 3K5OA 5C9HA 4M1XA 4C3JC 5IOSA 3ERED 3NUHA 4KMAA 1I3QA 4J3NA 3AH5A 2XCQA 2O5JD 3MMLB 3K5LA 4GTFA 1T8IA 3G4CA 3VA7A 3LAPA 4ILDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISE A;  1IS1 A;  1EK8 A;  3FHZ A;  4DDQ A;  2PHC B;  1EH1 A;  1BGW A;  2P5M A;  3BUE A;  3L4J A;  3FOF A;  3OEP A;  4KAW X;  4KC6 A;  3LPX A;  5JVO A;  1Y69 8;  2KWA A;  4JLR C;  3ORE A;  3V4G A;  1GE9 A;  4G0U A;  1AB4 A;  3LAJ A;  3QX3 A;  1DD5 A;  3FOE A;  5MLC 9;  4G0V A;  2ZFZ A;  1F9N A;  1B4B A;  1BJT A;  3CAG A;  2XCR B;  2Y3P A;  1ZVU A;  4KB4 A;  1XXA A;  1WQF A;  1WQH A;  3LHP S;  4KDD A;  4L8I A;  3OPF A;  3NUH A;  1WIH A;  2XCO A;  5JSN B;  3ERE D;  4GFQ A;  4KB2 A;  3LF9 A;  5JSB B;  2XCQ A;  4J3N A;  4OYD B;  3MML B;  5CJ9 A;  4FM9 A;  3L4K A;  1XXC A;  2RGR A;  4G0W A;  1XXB A;  1WQG A;  3VA7 A;  3LAP A;  1B4A A; 
#chains in the Genus database with same CATH topology
 5C4J K;  2R92 A;  3T02 A;  3HOY C;  3S15 C;  5EGE A;  4QIW D;  3K59 A;  4Q5V A;  1R9T C;  1A31 A;  3HOW K;  2PMZ A;  4LK1 A;  5IOR A;  3PO2 C;  3S2D K;  4L8I A;  4BBS K;  1K4T A;  4GT9 A;  4FM9 A;  1MIU A;  3K7A C;  1WQG A;  4LJZ A;  5EGH A;  2R7Z K;  4KM9 A;  3BP8 C;  4YFN A;  3L4J A;  3BUE A;  5IYB K;  4O2D A;  2NVY C;  4P5B A;  2A69 D;  3AQO A;  2E2H C;  4BY1 C;  4XCH A;  2B63 A;  1Y1W C;  3S1M C;  2ZFZ A;  3CAG A;  3N0B A;  2JA7 C;  1WOO A;  4AH6 A;  1WOR A;  2JA8 K;  2B63 K;  4C3I C;  3I4N K;  5C3E K;  3N0C A;  4GZY A;  2FQT A;  1TWH K;  3FHZ A;  2WAQ D;  3BP3 A;  4Q4Z A;  3S16 K;  4EJ3 A;  4AYB A;  1R49 A;  3GTK A;  5JFE A;  4A3G K;  4KC6 A;  1R9T K;  4A3B K;  5C4X C;  5JVO A;  3GTG A;  4BBR K;  2R93 A;  3WVO A;  4G0U A;  5TJ3 A;  4A3C C;  4Y52 K;  1Y1W A;  2B63 C;  3GEE A;  3K5N A;  1L0W A;  3HOX K;  4A3K K;  3HOZ C;  1O25 A;  3HOV C;  2V6T A;  3K5M A;  1Y1V C;  3A8J A;  2A6H A;  1PJ7 A;  2E2J K;  3RZO C;  4G0V A;  1J98 A;  3L4K A;  1XXC A;  1YCL A;  4C2M C;  4A3J K;  1TWF A;  2NVQ C;  4KM8 A;  5M3F K;  2E2I A;  4C2M A;  4XSZ A;  3I4N C;  1TWA A;  1SC7 A;  2ZUE A;  4KMH A;  3TFI A;  2JA7 K;  3GIR A;  1ZQ1 C;  3DXJ A;  2VUM C;  1TWG C;  2Y0S L;  1TWC K;  3H3V D;  3HOY K;  3HKZ L;  1YNN D;  1IW7 A;  4OIP A;  3FKI C;  1VJE A;  3AD9 C;  5C44 C;  5C9H A;  1XZP A;  4C3J C;  1VLO A;  4A3M C;  3S1R C;  1IL2 A;  1I6V A;  4NOI A;  3K5L A;  3S2H K;  1T8I A;  3G4C A;  5TMF A;  1TGO A;  3A8I A;  4BBR C;  3HXA A;  4BKW A;  2R7Z C;  4A3I K;  1I3Q K;  2JA6 A;  1Y69 8;  1TL8 A;  2NVY A;  4BY7 C;  3TFH A;  2PMZ L;  2YU9 C;  2JA7 A;  4XLN A;  3SJR A;  1A36 A;  5FLM K;  3S15 K;  3TFJ A;  3HOU C;  2YU9 A;  4OIQ A;  2E2J C;  4PAB A;  1WSR A;  1TWH A;  1I50 K;  1PJ5 A;  4KAT A;  4KB2 A;  2O5J A;  3A8K A;  2B9S B;  2RH6 A;  4G0W A;  4X6A K;  1ZYR A;  3GTJ A;  4YFK A;  2P8T A;  1EJ9 A;  1IW7 D;  2VUM K;  2PHC B;  4BLA A;  3GTG C;  3S14 K;  1YNJ D;  4FYD A;  4ZH4 A;  3S1M K;  1EQR A;  1IBA A;  5IP9 K;  4OIN A;  3ORE A;  2JA6 C;  1WOP A;  3G4A A;  3H0G C;  1WCM K;  1O2F B;  2GSN A;  2NVY K;  1F9N A;  4P5A A;  3GTM C;  5IYC K;  1Y1V A;  5CHP A;  3Q3Q A;  1O24 A;  3GEI A;  5M5Y K;  3K7A K;  4OIO A;  1TWH C;  4PAA A;  3SZZ A;  1SMY A;  5M3M K;  1O29 A;  2E2I C;  4O26 A;  2BE5 A;  1IS1 A;  4BY1 K;  2P5M A;  3S1Q C;  3GTL A;  3M4A A;  2CFA B;  4BXX C;  1TWA C;  2FQO A;  2VUM A;  3MAQ A;  4KN7 A;  1LPQ A;  4QIW A;  4QCL A;  3GTQ A;  2NVX C;  1J6V A;  4IP8 A;  1XPP A;  4A3D K;  2GSU A;  4Q5G A;  4KMD A;  3FKI K;  5JSN B;  1I50 A;  5IYC C;  2RGR A;  5TMC A;  4GTC A;  2JA6 K;  3S2H C;  1BGW A;  4LMO A;  5IP9 C;  2E2H A;  3HKZ D;  1VGX A;  1EI6 A;  2V6S A;  2GSO A;  2JA5 A;  1GE9 A;  1I6V D;  2BE5 D;  5M5X K;  5CQG A;  1SFO A;  4A93 C;  1ZBS A;  2JA5 C;  3IAY A;  2E2H K;  1Y1W K;  4M1X A;  3CQZ K;  4A3L K;  2ZUF A;  4LLG A;  4J3N A;  3AH5 A;  4MQ9 A;  4GTF A;  3MML B;  4YG2 A;  4ILD A;  1BS2 A;  3PO3 K;  1RR8 C;  4NOM A;  1WOS A;  4AHC A;  4BY7 K;  1HQM D;  4FGU A;  3S0X A;  3M4O K;  1JOE A;  1O27 A;  3S17 K;  2KWA A;  3GTK C;  1X31 C;  2NVT K;  1PJ6 A;  3V4G A;  3HOU K;  1F7U A;  3I4M C;  5MLC 9;  2JH3 A;  3DU5 A;  3GTP K;  1XZQ A;  4C3I K;  2D6F C;  2JA5 K;  3T01 A;  2PMZ D;  4LK0 A;  4A3E C;  1HI9 A;  3RZD C;  1SFO K;  3H3V L;  2Y0S D;  4GFQ A;  3HOX C;  4GTE A;  1K83 K;  4KMU A;  3JST A;  1RU0 A;  2R93 K;  1XZP B;  4A3F K;  3S1N K;  4G7O A;  2E2I K;  2O5I A;  1O26 A;  5HL8 A;  5FJ8 K;  1RRJ A;  1Q8I A;  5IYD C;  3S17 C;  3M4O C;  4IP9 A;  3FKI A;  1DD5 A;  5E68 A;  3TTG A;  1TWG A;  1UV7 A;  4C3H C;  1ZXO A;  3H0G K;  2A68 D;  3RZO K;  1V5V A;  4NOK A;  3HOW C;  1O2B A;  1USO A;  4A3K C;  3HOZ K;  4C45 A;  4YFX A;  1G51 A;  1TWA K;  3GTO A;  3S14 C;  3M3Y C;  4WJ4 A;  2WAQ L;  1TWC C;  4QIW L;  3GTL C;  4KAS A;  2R92 C;  2R7Z A;  3PO2 K;  3S1Q K;  3QX3 A;  2R4G A;  3SZY A;  2Y3P A;  1WCM A;  4KB4 A;  2YU9 K;  4BBS C;  1R9T A;  3AQP A;  1F7V A;  2WB1 A;  2A6E A;  5M5W K;  1WQH A;  4Y7N C;  4G7Z A;  2NVX K;  4WIL A;  2W7V A;  3N3Y A;  5JSB B;  1VH2 A;  1IQ0 A;  1YX2 A;  4BXX K;  5D4D A;  3GTO C;  1HQM A;  4GTD A;  5C3E C;  1EH1 A;  2A68 A;  1DCH A;  3LPX A;  4X6A C;  3M3Y K;  4MEY A;  1A35 A;  4D3Z A;  3DU6 A;  3GTG K;  1C0A A;  4RMF A;  3FOE A;  3GTK K;  1B4B A;  3H0G A;  1BJT A;  4A3C K;  1ZVU A;  1K4S A;  4A93 K;  1INN A;  3GSI A;  3WOD A;  4QJV B;  2GAG C;  3ERE D;  4KMA A;  1I3Q A;  3S16 C;  3AD8 C;  2O5J D;  3VA7 A;  4JK1 A;  1BDF A;  3LAP A;  4Y7N K;  4A3L C;  4DDQ A;  4H3T A;  2WAQ A;  4F3E A;  3CQZ A;  1I6H K;  2A69 A;  4AYB L;  2A6H D;  3GTP A;  3ADA C;  2R93 C;  3K57 A;  3GTP C;  3EQL A;  4FZB A;  3HOV K;  1XZQ B;  4C3J K;  1K83 A;  3RZD K;  2NVT C;  5IOT A;  1DCO A;  2XCR B;  3P9A A;  1F93 A;  4KN4 A;  4GTL A;  3KYL A;  1WSV A;  4KDD A;  3I4M K;  2CFA A;  4C3H K;  1TWF C;  5C4J C;  3S2D C;  1XXB A;  2V6U A;  1YNJ A;  1YNN A;  1V9M A;  4D3Y A;  1TWG K;  4KAR A;  4KAW X;  4A3F C;  3S1N C;  2GAH C;  2JA8 C;  2WB1 L;  1AB4 A;  4A3I C;  4P9S A;  2R92 K;  3AD7 C;  2CW0 A;  4A3E K;  1SFO C;  2NVX A;  1XXA A;  3GTQ C;  1USM A;  3GEH A;  1WQF A;  4MEX A;  3LHP S;  1WIH A;  4GTB A;  5FLM C;  4NOL A;  1I6H C;  2PA8 D;  4OYD B;  3GTJ C;  5CJ9 A;  1I50 C;  4OIR A;  1IE0 A;  4A3B C;  1ZYR D;  3OPF A;  4FXD A;  1ISE A;  2A6E D;  1J6X A;  2NVQ K;  2PPB A;  4BLB A;  3GTM K;  3PO3 C;  1TWC A;  3K58 A;  4GTA A;  2PA8 L;  5C4X K;  4WJ3 M;  2F4Q A;  5L46 A;  3LAJ A;  5IP7 K;  1VRQ C;  4LOW A;  3GDZ A;  1TWF K;  4AYB D;  1O2A A;  3GTL K;  4C2M K;  4A3J C;  1J6W A;  4LQY A;  1WCM C;  4XSX A;  4XLP A;  1SEU A;  2XCO A;  1R5Z A;  1SMY D;  3LF9 A;  1JQW A;  3GTQ K;  1O28 A;  1JVI A;  4LR2 A;  5IOQ A;  4A3M K;  3S1R K;  1B4A A;  1KQ4 A;  3CQZ C;  4A3G C;  4G7H A;  1EK8 A;  2CW0 D;  4QJV A;  5IP7 C;  2Y0S A;  3OEP A;  4Y52 C;  3FOF A;  1DCP A;  4AN8 A;  3IPJ A;  3GTO K;  3HKZ A;  4JLR C;  3T00 A;  5IYB C;  3GTM A;  5C44 K;  2EBB A;  4Q5S A;  5IYD K;  1NH3 A;  1Y1V K;  1K83 C;  3K5O A;  1EFW A;  3GTJ K;  5IOS A;  4A3D C;  3NUH A;  2WB1 D;  2XCQ A;  1I3Q C; 
#chains in the Genus database with same CATH homology
 1RR8 C;  4NOM A;  1TGO A;  4AHC A;  4DDQ A;  4H3T A;  2WAQ A;  1HQM D;  4F3E A;  3CQZ A;  4FGU A;  4BKW A;  3S0X A;  2A6H D;  3GTP A;  2R92 A;  1O27 A;  3K57 A;  2JA6 A;  1Y69 8;  1TL8 A;  2KWA A;  4FZB A;  2NVY A;  3V4G A;  2JA7 A;  5EGE A;  3SJR A;  3K59 A;  4Q5V A;  5MLC 9;  1K83 A;  1A36 A;  1A31 A;  2JH3 A;  3DU5 A;  5IOT A;  2YU9 A;  2XCR B;  2PMZ A;  5IOR A;  3P9A A;  1TWH A;  4GTL A;  3KYL A;  4KDD A;  4L8I A;  2CFA A;  1K4T A;  4KAT A;  4GFQ A;  4KB2 A;  4GTE A;  4GT9 A;  4FM9 A;  4G0W A;  2B9S B;  1MIU A;  2RH6 A;  1XXB A;  1WQG A;  3GTJ A;  5EGH A;  1EJ9 A;  4KM9 A;  1IW7 D;  2PHC B;  4BLA A;  1V9M A;  4D3Y A;  1YNJ D;  3BUE A;  1O26 A;  4KAR A;  3L4J A;  4KAW X;  4FYD A;  4P5B A;  2A69 D;  3AQO A;  1RRJ A;  2B63 A;  1Q8I A;  3ORE A;  1AB4 A;  3G4A A;  4IP9 A;  3FKI A;  1DD5 A;  2GSN A;  2ZFZ A;  1F9N A;  1TWG A;  4P5A A;  3CAG A;  3N0B A;  4C3H C;  2NVX A;  1Y1V A;  2A68 D;  1XXA A;  1ZXO A;  5CHP A;  3Q3Q A;  1O24 A;  1WQF A;  3LHP S;  4NOK A;  1WIH A;  4GTB A;  4C3I C;  4NOL A;  1O2B A;  3N0C A;  1O29 A;  4OYD B;  5CJ9 A;  4O26 A;  1ZYR D;  3GTO A;  3OPF A;  4FXD A;  1ISE A;  1IS1 A;  3FHZ A;  2A6E D;  2P5M A;  4EJ3 A;  3M4A A;  4AYB A;  1R49 A;  3GTL A;  3GTK A;  2CFA B;  4KC6 A;  5JFE A;  4BLB A;  2VUM A;  3GTG A;  5JVO A;  1TWC A;  4KAS A;  3MAQ A;  3K58 A;  2R93 A;  2R7Z A;  4GTA A;  3WVO A;  4G0U A;  2F4Q A;  5TJ3 A;  3LAJ A;  1LPQ A;  3QX3 A;  2R4G A;  1Y1W A;  4QIW A;  4QCL A;  3GTQ A;  3K5N A;  4IP8 A;  2GSU A;  2Y3P A;  1O2A A;  1WCM A;  4KB4 A;  1R9T A;  3AQP A;  4Q5G A;  1O25 A;  4KMD A;  2WB1 A;  3K5M A;  1WQH A;  4LQY A;  1SEU A;  2XCO A;  5JSN B;  1R5Z A;  1I50 A;  1SMY D;  3LF9 A;  5JSB B;  3N3Y A;  1O28 A;  2RGR A;  4G0V A;  4LR2 A;  5IOQ A;  3L4K A;  1XXC A;  4C2M C;  1TWF A;  1B4A A;  1KQ4 A;  4KM8 A;  4GTC A;  1EK8 A;  2CW0 D;  4C2M A;  2E2I A;  1TWA A;  4GTD A;  1SC7 A;  1EH1 A;  4LMO A;  1BGW A;  2E2H A;  4KMH A;  2Y0S A;  3OEP A;  3FOF A;  3LPX A;  4AN8 A;  3HKZ A;  1A35 A;  4JLR C;  4D3Z A;  2GSO A;  2JA5 A;  3DU6 A;  1GE9 A;  1I6V D;  3GTM A;  2BE5 D;  5CQG A;  1SFO A;  3FOE A;  1ZBS A;  1YNN D;  1B4B A;  3H0G A;  1NH3 A;  3IAY A;  1BJT A;  1ZVU A;  1K4S A;  3K5O A;  5C9H A;  4M1X A;  4C3J C;  5IOS A;  3ERE D;  3NUH A;  4KMA A;  1I3Q A;  4J3N A;  3AH5 A;  2XCQ A;  2O5J D;  3MML B;  3K5L A;  4GTF A;  1T8I A;  3G4C A;  3VA7 A;  3LAP A;  4ILD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...