4KC6A

Crystal structure of c-terminal deletion mutant of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 61
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kc6A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kc6A02
4J3NA 1F9NA 5JSBB 1WQHA 4KB4A 4KC6A 3V4GA 3FOEA 3ERED 3LHPS 1GE9A 3OEPA 3OPFA 3FOFA 1EK8A 1B4AA 2XCOA 1DD5A 3LAPA 4KB2A 1IS1A 4KDDA 1BJTA 1ZVUA 5JVOA 3L4JA 4G0UA 4G0WA 1EH1A 4L8IA 2XCQA 3LF9A 2ZFZA 3OREA 2P5MA 2Y3PA 4JLRC 1AB4A 5CJ9A 4OYDB 4GFQA 3BUEA 1XXCA 2XCRB 3FHZA 3CAGA 4G0VA 3LPXA 1Y698 3NUHA 1B4BA 1ISEA 2PHCB 5MLC9 2RGRA 1XXAA 1WIHA 1BGWA 4DDQA 1WQGA 5JSNB 3VA7A 4KAWX 1XXBA 3LAJA 1WQFA 3QX3A 3L4KA 2KWAA 4FM9A 3MMLB
chains in the Genus database with same CATH superfamily
1F93A 3S2DK 3H0GC 5C3EK 3N3YA 4NOMA 4A3IK 2NVXC 4BBRC 1I6VA 1YCLA 3H3VL 1Y1WA 3AQPA 2R93C 4G0WA 1T8IA 1WSVA 2VUMC 4KMAA 4A3EK 2R92K 2B63K 1EFWA 3GTGA 3RZOC 1SC7A 3GTQA 4BXXC 1BGWA 1SMYD 3GEHA 1YNNA 2YU9K 3K5LA 3HKZL 1C0AA 3GTLA 3HOWC 4GT9A 1HQMD 1F9NA 1O25A 2R93K 3K58A 2CW0D 2R7ZK 1TWFC 4AYBA 1JVIA 5C9HA 2GSOA 2B63A 1VJEA 3HOZK 4KM8A 4L8IA 3GEIA 2ZFZA 2A69A 1WOSA 4C2MC 2NVYC 4JLRC 4YFNA 4GFQA 2YU9A 1Y698 3HOWK 4LQYA 3IAYA 4GTDA 1WQGA 5JSNB 2E2HC 1DCPA 2A6EA 3LAJA 1TWFK 3GTPC 2R7ZA 3S1NK 3MMLB 4QIWA 4XCHA 2Y0SD 3LHPS 2PA8L 3OEPA 4C2MK 3S17K 1VGXA 3K5OA 5IP9C 4FGUA 4GTAA 1YNJD 5JVOA 3WODA 4C3IC 5CHPA 1EH1A 1XPPA 5M5YK 2A6HD 3OREA 2E2HK 2JA8C 2NVTC 4A3KK 4LK0A 4MEYA 4A3FC 1TWFA 3AH5A 4KMDA 5D4DA 1HI9A 3K59A 4KAWX 5IOTA 3S15K 4C2MA 5IP9K 1IQ0A 1K83C 3T00A 4PAAA 4NOLA 5IP7K 5C44C 3HOVK 4XSXA 5TMFA 2WAQA 2WB1A 1SEUA 2JA8K 2NVTK 3T02A 4YFKA 2XCOA 3FKIK 4KDDA 4A3FK 4GTBA 2ZUEA 2ZUFA 2P8TA 1WSRA 5IOQA 1RR8C 3CAGA 1ISEA 1ZYRD 5C44K 3H3VD 4KM9A 1WIHA 1A36A 2E2JK 3S1MK 1TGOA 1WCMC 4IP9A 2GSUA 4A93C 4OIOA 4X6AC 3FKIA 2RH6A 5TJ3A 5HL8A 1ZXOA 4XLPA 3GTJA 4FZBA 3FOFA 4KASA 3HKZD 1A35A 1SFOC 3GTMK 4BBSK 1AB4A 1WCMK 4Q4ZA 3I4MC 4C3JK 1XZPA 4P5AA 3PO3C 4A93K 3NUHA 2GSNA 3HOYC 5MLC9 3GTKC 3GDZA 5IOSA 5CQGA 4C45A 1SMYA 1R9TA 3DXJA 2EBBA 2A68A 1SFOK 1I3QC 4BY7C 1WQHA 3GTMA 2O5IA 3AD8C 1J6WA 1DCOA 1K4TA 1V5VA 3AD7C 2O5JD 4O26A 5C4XK 2PA8D 3HOXC 4QIWL 4F3EA 2E2IA 4JK1A 1TWAC 1I50K 1SFOA 4D3ZA 4WJ3M 3H0GK 3GSIA 3PO2C 2NVQC 1XZPB 2NVXK 4BBRK 1K4SA 5FJ8K 3AQOA 4P9SA 3FOEA 2B9SB 3N0BA 4G7ZA 2VUMK 2Y0SA 3HOUC 1IS1A 3S2HC 2R92A 1USOA 3RZOK 1I50A 2XCQA 2NVQK 4QJVA 3H0GA 3S1QC 4BXXK 4A3LC 1TWHC 2XCRB 4PABA 2NVXA 1A31A 2JA7C 1IW7D 4GTEA 3KYLA 4A3BC 4A3JC 2R93A 4Q5VA 1J6XA 1O2FB 2VUMA 3HOUK 1O27A 3K5MA 1UV7A 1JQWA 1IBAA 1I6VD 4YFXA 1O28A 3I4NC 1O29A 2NVYK 2F4QA 4IP8A 3TFHA 2JA7K 4G0UA 2JA5C 4OINA 4OIRA 3S16C 5CJ9A 4A3BK 4A3JK 4AHCA 3P9AA 2PMZA 1WOOA 2D6FC 3GTPK 1YNND 4QJVB 5IYCC 1MIUA 4YG2A 1G51A 1RRJA 1O2AA 3M3YC 1TWGC 2NVYA 5M5WK 4H3TA 2JA5K 4AYBD 4C3IK 5FLMC 3S16K 4A3DC 3SZYA 1DD5A 2E2HA 3MAQA 3HKZA 1VLOA 3GTPA 1YX2A 1TWCC 1X31C 5IYCK 3S0XA 3JSTA 1IE0A 1EI6A 5C4JC 3GTOC 4O2DA 1K83K 2A6ED 3A8KA 2RGRA 1Y1VC 2JA5A 1XZQA 4QIWD 4Y7NC 2BE5D 3GIRA 4GZYA 4FYDA 4A3CC 5M5XK 1O24A 3DU6A 5M3FK 3L4JA 2JA6C 1PJ5A 4MEXA 2GAGC 1K83A 1Y1VK 4C3HC 1INNA 2P5MA 3K5NA 2O5JA 3LPXA 4Y7NK 4KARA 4X6AK 4Y52C 4GTFA 4M1XA 3BP8C 4AYBL 4DDQA 1Y1WC 4GTLA 2WAQD 3HXAA 5IYDC 4J3NA 3K57A 4A3GC 4KC6A 3V4GA 1XZQB 1WOPA 1HQMA 4KMUA 3GTGC 3T01A 3GTQC 4BY1C 4FXDA 3S2DC 3I4MK 1WCMA 5C3EC 3PO3K 2CW0A 3HOYK 3GTKK 3GTLC 2Y3PA 2FQTA 4NOKA 1V9MA 5L46A 1B4BA 5IYDK 5EGHA 1I3QK 4Q5GA 1XXAA 4LJZA 4BY7K 4A3EC 1PJ7A 5EGEA 4NOIA 2B63C 3L4KA 1O26A 5JSBB 4LOWA 2PMZL 1BS2A 2YU9C 3GTLK 3GTKA 4KMHA 4AH6A 3HOXK 3LAPA 1TWAK 1YNJA 1I3QA 4QCLA 2R7ZC 3PO2K 4ZH4A 3HOZC 2FQOA 2A6HA 3AD9C 2WAQL 1RU0A 2WB1L 4LLGA 4ILDA 2A68D 3G4AA 1XXBA 2CFAA 4XSZA 1TL8A 4A3MC 1Q8IA 4FM9A 3S14C 3TTGA 5M3MK 3S2HK 3IPJA 1KQ4A 1TWAA 1F7UA 3S1NC 3S1QK 4A3LK 4KB2A 4AN8A 1TWHK 1ZVUA 4MQ9A 3S1RC 1EQRA 4Q5SA 3S17C 4G0VA 4A3MK 4GTCA 3S14K 4LK1A 3GEEA 4A3KC 3M4OC 1ZYRA 3VA7A 3I4NK 2GAHC 4OIPA 1VH2A 1PJ6A 1TWHA 1USMA 3S1RK 2BE5A 1WORA 2CFAB 3S15C 2JA7A 4BLAA 4D3YA 1EK8A 5IP7C 1B4AA 1EJ9A 1BJTA 3HOVC 1ZQ1C 4WILA 2A69D 3N0CA 4KN7A 1J98A 3BP3A 3M4OK 3A8JA 3TFJA 3FKIC 2W7VA 4P5BA 3BUEA 1XXCA 2V6UA 4LR2A 3GTJC 1TWGK 2PHCB 3M3YK 4WJ4A 4RMFA 1DCHA 5IORA 3G4CA 3Q3QA 5FLMK 1WQFA 4A3DK 4BLBA 2KWAA 1L0WA 2E2JC 3S1MC 3M4AA 1TWCK 1GE9A 3OPFA 3TFIA 4KATA 1IL2A 1R5ZA 3GTJK 3EQLA 3CQZC 5C4JK 3GTOK 2V6TA 1TWGA 1R49A 2PMZD 1R9TC 2PPBA 2V6SA 4LMOA 3SZZA 3GTMC 4BKWA 3K7AC 2Y0SL 4BBSC 5IYBC 4C3JC 1F7VA 1TWCA 1ZBSA 3QX3A 4A3CK 3RZDC 4EJ3A 1I6HC 3DU5A 4XLNA 3CQZK 2WB1D 4KB4A 5JFEA 3GTOA 2E2IC 4OIQA 3ERED 2JA6K 3SJRA 5E68A 1R9TK 4C3HK 4KN4A 1Y1VA 3A8IA 4G7OA 1VRQC 5TMCA 1JOEA 1BDFA 3K7AK 2JH3A 3LF9A 5IYBK 4A3IC 3ADAC 4Y52K 3FHZA 4G7HA 4OYDB 3RZDK 1Y1WK 1I6HK 5C4XC 3CQZA 1NH3A 2E2IK 1J6VA 1LPQA 4A3GK 2JA6A 1O2BA 2R92C 1IW7A 2R4GA 3GTGK 1I50C 3GTQK 3WVOA 4BY1K
chains in the Genus database with same CATH topology
3FKIA 4H3TA 2RH6A 5TJ3A 1KQ4A 3N3YA 1ZXOA 3GTJA 1TWAA 4NOMA 4FZBA 3FOFA 4KASA 4FM9A 1DD5A 2E2HA 1A35A 4KB2A 4AN8A 1ZVUA 3MAQA 3HKZA 3GTPA 1Y1WA 3AQPA 4G0WA 1T8IA 4KMAA 1AB4A 4G0VA 3S0XA 4P5AA 3NUHA 2GSNA 3GTGA 4GTCA 5MLC9 1SC7A 3GTQA 2A6ED 2RGRA 1BGWA 5IOSA 2JA5A 1SMYD 5CQGA 3VA7A 3K5LA 1R9TA 3GTLA 2BE5D 4GT9A 1HQMD 1F9NA 1O25A 1TWHA 1WQHA 3GTMA 2CFAB 4FYDA 2JA7A 4BLAA 4D3YA 3K58A 2CW0D 1EK8A 1B4AA 4AYBA 1EJ9A 1K4TA 5C9HA 1O24A 2GSOA 2B63A 3DU6A 1BJTA 2A69D 4KM8A 3N0CA 3L4JA 2O5JD 4L8IA 1K83A 2ZFZA 4C3HC 4O26A 4C2MC 2P5MA 4JLRC 3K5NA 4GFQA 4F3EA 1XXCA 2E2IA 2YU9A 3BUEA 4LR2A 3LPXA 1Y698 4P5BA 4KARA 4LQYA 2PHCB 1SFOA 4D3ZA 3IAYA 4GTFA 5IORA 4GTDA 4M1XA 1WQGA 5JSNB 3G4CA 4DDQA 3Q3QA 3LAJA 1WQFA 4GTLA 2R7ZA 2KWAA 4BLBA 3MMLB 4J3NA 1K4SA 4QIWA 3K57A 4KC6A 3AQOA 3V4GA 3M4AA 3FOEA 2B9SB 3LHPS 1GE9A 3N0BA 3OEPA 3OPFA 2Y0SA 3K5OA 4KATA 4FGUA 4FXDA 4GTAA 1R5ZA 1YNJD 1IS1A 1WCMA 2R92A 5JVOA 4C3IC 1TWGA 5CHPA 1EH1A 1I50A 1R49A 2A6HD 2XCQA 3OREA 4LMOA 3H0GA 2Y3PA 2XCRB 4NOKA 1V9MA 1TWFA 1B4BA 3AH5A 4KMDA 2NVXA 1A31A 4BKWA 5EGHA 1IW7D 4Q5GA 1XXAA 1Q8IA 4GTEA 3K59A 5EGEA 4KAWX 4C3JC 5IOTA 2R93A 1TWCA 1ZBSA 4C2MA 4Q5VA 3QX3A 3L4KA 2VUMA 4EJ3A 4NOLA 3K5MA 3DU5A 1O27A 1O26A 5JSBB 1I6VD 4KB4A 5JFEA 3GTOA 1O28A 2WAQA 3ERED 3SJRA 3GTKA 4KMHA 2WB1A 1O29A 1SEUA 1Y1VA 2F4QA 2XCOA 4IP8A 3LAPA 4KDDA 4GTBA 4G0UA 2JH3A 3LF9A 1I3QA 4QCLA 5CJ9A 3FHZA 4OYDB 4AHCA 5IOQA 1RR8C 3P9AA 3CAGA 2PMZA 1ISEA 1YNND 1ZYRD 4ILDA 3CQZA 1NH3A 1A36A 2A68D 1MIUA 1LPQA 1WIHA 4KM9A 1TGOA 2JA6A 1XXBA 4IP9A 1O2BA 2CFAA 3G4AA 2R4GA 1TL8A 1RRJA 1O2AA 2GSUA 3KYLA 2NVYA 3WVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J3N A;  1F9N A;  5JSB B;  1WQH A;  4KB4 A;  4KC6 A;  3V4G A;  3FOE A;  3ERE D;  3LHP S;  1GE9 A;  3OEP A;  3OPF A;  3FOF A;  1EK8 A;  1B4A A;  2XCO A;  1DD5 A;  3LAP A;  4KB2 A;  1IS1 A;  4KDD A;  1BJT A;  1ZVU A;  5JVO A;  3L4J A;  4G0U A;  4G0W A;  1EH1 A;  4L8I A;  2XCQ A;  3LF9 A;  2ZFZ A;  3ORE A;  2P5M A;  2Y3P A;  4JLR C;  1AB4 A;  5CJ9 A;  4OYD B;  4GFQ A;  3BUE A;  1XXC A;  2XCR B;  3FHZ A;  3CAG A;  4G0V A;  3LPX A;  1Y69 8;  3NUH A;  1B4B A;  1ISE A;  2PHC B;  5MLC 9;  2RGR A;  1XXA A;  1WIH A;  1BGW A;  4DDQ A;  1WQG A;  5JSN B;  3VA7 A;  4KAW X;  1XXB A;  3LAJ A;  1WQF A;  3QX3 A;  3L4K A;  2KWA A;  4FM9 A;  3MML B; 
#chains in the Genus database with same CATH topology
 1F93 A;  3S2D K;  3H0G C;  5C3E K;  3N3Y A;  4NOM A;  4A3I K;  2NVX C;  4BBR C;  1I6V A;  1YCL A;  3H3V L;  1Y1W A;  3AQP A;  2R93 C;  4G0W A;  1T8I A;  1WSV A;  2VUM C;  4KMA A;  4A3E K;  2R92 K;  2B63 K;  1EFW A;  3GTG A;  3RZO C;  1SC7 A;  3GTQ A;  4BXX C;  1BGW A;  1SMY D;  3GEH A;  1YNN A;  2YU9 K;  3K5L A;  3HKZ L;  1C0A A;  3GTL A;  3HOW C;  4GT9 A;  1HQM D;  1F9N A;  1O25 A;  2R93 K;  3K58 A;  2CW0 D;  2R7Z K;  1TWF C;  4AYB A;  1JVI A;  5C9H A;  2GSO A;  2B63 A;  1VJE A;  3HOZ K;  4KM8 A;  4L8I A;  3GEI A;  2ZFZ A;  2A69 A;  1WOS A;  4C2M C;  2NVY C;  4JLR C;  4YFN A;  4GFQ A;  2YU9 A;  1Y69 8;  3HOW K;  4LQY A;  3IAY A;  4GTD A;  1WQG A;  5JSN B;  2E2H C;  1DCP A;  2A6E A;  3LAJ A;  1TWF K;  3GTP C;  2R7Z A;  3S1N K;  3MML B;  4QIW A;  4XCH A;  2Y0S D;  3LHP S;  2PA8 L;  3OEP A;  4C2M K;  3S17 K;  1VGX A;  3K5O A;  5IP9 C;  4FGU A;  4GTA A;  1YNJ D;  5JVO A;  3WOD A;  4C3I C;  5CHP A;  1EH1 A;  1XPP A;  5M5Y K;  2A6H D;  3ORE A;  2E2H K;  2JA8 C;  2NVT C;  4A3K K;  4LK0 A;  4MEY A;  4A3F C;  1TWF A;  3AH5 A;  4KMD A;  5D4D A;  1HI9 A;  3K59 A;  4KAW X;  5IOT A;  3S15 K;  4C2M A;  5IP9 K;  1IQ0 A;  1K83 C;  3T00 A;  4PAA A;  4NOL A;  5IP7 K;  5C44 C;  3HOV K;  4XSX A;  5TMF A;  2WAQ A;  2WB1 A;  1SEU A;  2JA8 K;  2NVT K;  3T02 A;  4YFK A;  2XCO A;  3FKI K;  4KDD A;  4A3F K;  4GTB A;  2ZUE A;  2ZUF A;  2P8T A;  1WSR A;  5IOQ A;  1RR8 C;  3CAG A;  1ISE A;  1ZYR D;  5C44 K;  3H3V D;  4KM9 A;  1WIH A;  1A36 A;  2E2J K;  3S1M K;  1TGO A;  1WCM C;  4IP9 A;  2GSU A;  4A93 C;  4OIO A;  4X6A C;  3FKI A;  2RH6 A;  5TJ3 A;  5HL8 A;  1ZXO A;  4XLP A;  3GTJ A;  4FZB A;  3FOF A;  4KAS A;  3HKZ D;  1A35 A;  1SFO C;  3GTM K;  4BBS K;  1AB4 A;  1WCM K;  4Q4Z A;  3I4M C;  4C3J K;  1XZP A;  4P5A A;  3PO3 C;  4A93 K;  3NUH A;  2GSN A;  3HOY C;  5MLC 9;  3GTK C;  3GDZ A;  5IOS A;  5CQG A;  4C45 A;  1SMY A;  1R9T A;  3DXJ A;  2EBB A;  2A68 A;  1SFO K;  1I3Q C;  4BY7 C;  1WQH A;  3GTM A;  2O5I A;  3AD8 C;  1J6W A;  1DCO A;  1K4T A;  1V5V A;  3AD7 C;  2O5J D;  4O26 A;  5C4X K;  2PA8 D;  3HOX C;  4QIW L;  4F3E A;  2E2I A;  4JK1 A;  1TWA C;  1I50 K;  1SFO A;  4D3Z A;  4WJ3 M;  3H0G K;  3GSI A;  3PO2 C;  2NVQ C;  1XZP B;  2NVX K;  4BBR K;  1K4S A;  5FJ8 K;  3AQO A;  4P9S A;  3FOE A;  2B9S B;  3N0B A;  4G7Z A;  2VUM K;  2Y0S A;  3HOU C;  1IS1 A;  3S2H C;  2R92 A;  1USO A;  3RZO K;  1I50 A;  2XCQ A;  2NVQ K;  4QJV A;  3H0G A;  3S1Q C;  4BXX K;  4A3L C;  1TWH C;  2XCR B;  4PAB A;  2NVX A;  1A31 A;  2JA7 C;  1IW7 D;  4GTE A;  3KYL A;  4A3B C;  4A3J C;  2R93 A;  4Q5V A;  1J6X A;  1O2F B;  2VUM A;  3HOU K;  1O27 A;  3K5M A;  1UV7 A;  1JQW A;  1IBA A;  1I6V D;  4YFX A;  1O28 A;  3I4N C;  1O29 A;  2NVY K;  2F4Q A;  4IP8 A;  3TFH A;  2JA7 K;  4G0U A;  2JA5 C;  4OIN A;  4OIR A;  3S16 C;  5CJ9 A;  4A3B K;  4A3J K;  4AHC A;  3P9A A;  2PMZ A;  1WOO A;  2D6F C;  3GTP K;  1YNN D;  4QJV B;  5IYC C;  1MIU A;  4YG2 A;  1G51 A;  1RRJ A;  1O2A A;  3M3Y C;  1TWG C;  2NVY A;  5M5W K;  4H3T A;  2JA5 K;  4AYB D;  4C3I K;  5FLM C;  3S16 K;  4A3D C;  3SZY A;  1DD5 A;  2E2H A;  3MAQ A;  3HKZ A;  1VLO A;  3GTP A;  1YX2 A;  1TWC C;  1X31 C;  5IYC K;  3S0X A;  3JST A;  1IE0 A;  1EI6 A;  5C4J C;  3GTO C;  4O2D A;  1K83 K;  2A6E D;  3A8K A;  2RGR A;  1Y1V C;  2JA5 A;  1XZQ A;  4QIW D;  4Y7N C;  2BE5 D;  3GIR A;  4GZY A;  4FYD A;  4A3C C;  5M5X K;  1O24 A;  3DU6 A;  5M3F K;  3L4J A;  2JA6 C;  1PJ5 A;  4MEX A;  2GAG C;  1K83 A;  1Y1V K;  4C3H C;  1INN A;  2P5M A;  3K5N A;  2O5J A;  3LPX A;  4Y7N K;  4KAR A;  4X6A K;  4Y52 C;  4GTF A;  4M1X A;  3BP8 C;  4AYB L;  4DDQ A;  1Y1W C;  4GTL A;  2WAQ D;  3HXA A;  5IYD C;  4J3N A;  3K57 A;  4A3G C;  4KC6 A;  3V4G A;  1XZQ B;  1WOP A;  1HQM A;  4KMU A;  3GTG C;  3T01 A;  3GTQ C;  4BY1 C;  4FXD A;  3S2D C;  3I4M K;  1WCM A;  5C3E C;  3PO3 K;  2CW0 A;  3HOY K;  3GTK K;  3GTL C;  2Y3P A;  2FQT A;  4NOK A;  1V9M A;  5L46 A;  1B4B A;  5IYD K;  5EGH A;  1I3Q K;  4Q5G A;  1XXA A;  4LJZ A;  4BY7 K;  4A3E C;  1PJ7 A;  5EGE A;  4NOI A;  2B63 C;  3L4K A;  1O26 A;  5JSB B;  4LOW A;  2PMZ L;  1BS2 A;  2YU9 C;  3GTL K;  3GTK A;  4KMH A;  4AH6 A;  3HOX K;  3LAP A;  1TWA K;  1YNJ A;  1I3Q A;  4QCL A;  2R7Z C;  3PO2 K;  4ZH4 A;  3HOZ C;  2FQO A;  2A6H A;  3AD9 C;  2WAQ L;  1RU0 A;  2WB1 L;  4LLG A;  4ILD A;  2A68 D;  3G4A A;  1XXB A;  2CFA A;  4XSZ A;  1TL8 A;  4A3M C;  1Q8I A;  4FM9 A;  3S14 C;  3TTG A;  5M3M K;  3S2H K;  3IPJ A;  1KQ4 A;  1TWA A;  1F7U A;  3S1N C;  3S1Q K;  4A3L K;  4KB2 A;  4AN8 A;  1TWH K;  1ZVU A;  4MQ9 A;  3S1R C;  1EQR A;  4Q5S A;  3S17 C;  4G0V A;  4A3M K;  4GTC A;  3S14 K;  4LK1 A;  3GEE A;  4A3K C;  3M4O C;  1ZYR A;  3VA7 A;  3I4N K;  2GAH C;  4OIP A;  1VH2 A;  1PJ6 A;  1TWH A;  1USM A;  3S1R K;  2BE5 A;  1WOR A;  2CFA B;  3S15 C;  2JA7 A;  4BLA A;  4D3Y A;  1EK8 A;  5IP7 C;  1B4A A;  1EJ9 A;  1BJT A;  3HOV C;  1ZQ1 C;  4WIL A;  2A69 D;  3N0C A;  4KN7 A;  1J98 A;  3BP3 A;  3M4O K;  3A8J A;  3TFJ A;  3FKI C;  2W7V A;  4P5B A;  3BUE A;  1XXC A;  2V6U A;  4LR2 A;  3GTJ C;  1TWG K;  2PHC B;  3M3Y K;  4WJ4 A;  4RMF A;  1DCH A;  5IOR A;  3G4C A;  3Q3Q A;  5FLM K;  1WQF A;  4A3D K;  4BLB A;  2KWA A;  1L0W A;  2E2J C;  3S1M C;  3M4A A;  1TWC K;  1GE9 A;  3OPF A;  3TFI A;  4KAT A;  1IL2 A;  1R5Z A;  3GTJ K;  3EQL A;  3CQZ C;  5C4J K;  3GTO K;  2V6T A;  1TWG A;  1R49 A;  2PMZ D;  1R9T C;  2PPB A;  2V6S A;  4LMO A;  3SZZ A;  3GTM C;  4BKW A;  3K7A C;  2Y0S L;  4BBS C;  5IYB C;  4C3J C;  1F7V A;  1TWC A;  1ZBS A;  3QX3 A;  4A3C K;  3RZD C;  4EJ3 A;  1I6H C;  3DU5 A;  4XLN A;  3CQZ K;  2WB1 D;  4KB4 A;  5JFE A;  3GTO A;  2E2I C;  4OIQ A;  3ERE D;  2JA6 K;  3SJR A;  5E68 A;  1R9T K;  4C3H K;  4KN4 A;  1Y1V A;  3A8I A;  4G7O A;  1VRQ C;  5TMC A;  1JOE A;  1BDF A;  3K7A K;  2JH3 A;  3LF9 A;  5IYB K;  4A3I C;  3ADA C;  4Y52 K;  3FHZ A;  4G7H A;  4OYD B;  3RZD K;  1Y1W K;  1I6H K;  5C4X C;  3CQZ A;  1NH3 A;  2E2I K;  1J6V A;  1LPQ A;  4A3G K;  2JA6 A;  1O2B A;  2R92 C;  1IW7 A;  2R4G A;  3GTG K;  1I50 C;  3GTQ K;  3WVO A;  4BY1 K; 
#chains in the Genus database with same CATH homology
 3FKI A;  4H3T A;  2RH6 A;  5TJ3 A;  1KQ4 A;  3N3Y A;  1ZXO A;  3GTJ A;  1TWA A;  4NOM A;  4FZB A;  3FOF A;  4KAS A;  4FM9 A;  1DD5 A;  2E2H A;  1A35 A;  4KB2 A;  4AN8 A;  1ZVU A;  3MAQ A;  3HKZ A;  3GTP A;  1Y1W A;  3AQP A;  4G0W A;  1T8I A;  4KMA A;  1AB4 A;  4G0V A;  3S0X A;  4P5A A;  3NUH A;  2GSN A;  3GTG A;  4GTC A;  5MLC 9;  1SC7 A;  3GTQ A;  2A6E D;  2RGR A;  1BGW A;  5IOS A;  2JA5 A;  1SMY D;  5CQG A;  3VA7 A;  3K5L A;  1R9T A;  3GTL A;  2BE5 D;  4GT9 A;  1HQM D;  1F9N A;  1O25 A;  1TWH A;  1WQH A;  3GTM A;  2CFA B;  4FYD A;  2JA7 A;  4BLA A;  4D3Y A;  3K58 A;  2CW0 D;  1EK8 A;  1B4A A;  4AYB A;  1EJ9 A;  1K4T A;  5C9H A;  1O24 A;  2GSO A;  2B63 A;  3DU6 A;  1BJT A;  2A69 D;  4KM8 A;  3N0C A;  3L4J A;  2O5J D;  4L8I A;  1K83 A;  2ZFZ A;  4C3H C;  4O26 A;  4C2M C;  2P5M A;  4JLR C;  3K5N A;  4GFQ A;  4F3E A;  1XXC A;  2E2I A;  2YU9 A;  3BUE A;  4LR2 A;  3LPX A;  1Y69 8;  4P5B A;  4KAR A;  4LQY A;  2PHC B;  1SFO A;  4D3Z A;  3IAY A;  4GTF A;  5IOR A;  4GTD A;  4M1X A;  1WQG A;  5JSN B;  3G4C A;  4DDQ A;  3Q3Q A;  3LAJ A;  1WQF A;  4GTL A;  2R7Z A;  2KWA A;  4BLB A;  3MML B;  4J3N A;  1K4S A;  4QIW A;  3K57 A;  4KC6 A;  3AQO A;  3V4G A;  3M4A A;  3FOE A;  2B9S B;  3LHP S;  1GE9 A;  3N0B A;  3OEP A;  3OPF A;  2Y0S A;  3K5O A;  4KAT A;  4FGU A;  4FXD A;  4GTA A;  1R5Z A;  1YNJ D;  1IS1 A;  1WCM A;  2R92 A;  5JVO A;  4C3I C;  1TWG A;  5CHP A;  1EH1 A;  1I50 A;  1R49 A;  2A6H D;  2XCQ A;  3ORE A;  4LMO A;  3H0G A;  2Y3P A;  2XCR B;  4NOK A;  1V9M A;  1TWF A;  1B4B A;  3AH5 A;  4KMD A;  2NVX A;  1A31 A;  4BKW A;  5EGH A;  1IW7 D;  4Q5G A;  1XXA A;  1Q8I A;  4GTE A;  3K59 A;  5EGE A;  4KAW X;  4C3J C;  5IOT A;  2R93 A;  1TWC A;  1ZBS A;  4C2M A;  4Q5V A;  3QX3 A;  3L4K A;  2VUM A;  4EJ3 A;  4NOL A;  3K5M A;  3DU5 A;  1O27 A;  1O26 A;  5JSB B;  1I6V D;  4KB4 A;  5JFE A;  3GTO A;  1O28 A;  2WAQ A;  3ERE D;  3SJR A;  3GTK A;  4KMH A;  2WB1 A;  1O29 A;  1SEU A;  1Y1V A;  2F4Q A;  2XCO A;  4IP8 A;  3LAP A;  4KDD A;  4GTB A;  4G0U A;  2JH3 A;  3LF9 A;  1I3Q A;  4QCL A;  5CJ9 A;  3FHZ A;  4OYD B;  4AHC A;  5IOQ A;  1RR8 C;  3P9A A;  3CAG A;  2PMZ A;  1ISE A;  1YNN D;  1ZYR D;  4ILD A;  3CQZ A;  1NH3 A;  1A36 A;  2A68 D;  1MIU A;  1LPQ A;  1WIH A;  4KM9 A;  1TGO A;  2JA6 A;  1XXB A;  4IP9 A;  1O2B A;  2CFA A;  3G4A A;  2R4G A;  1TL8 A;  1RRJ A;  1O2A A;  2GSU A;  3KYL A;  2NVY A;  3WVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...