4KC6A

Crystal structure of c-terminal deletion mutant of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
b'IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 61
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kc6A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kc6A02
3FHZA 3QX3A 5JSNB 3VA7A 4KC6A 2XCOA 1Y698 2KWAA 3L4JA 3OEPA 3ERED 4G0VA 1XXCA 3V4GA 4JLRC 1ZVUA 3LF9A 1WIHA 1EK8A 2RGRA 1EH1A 4G0WA 4L8IA 2XCQA 4KB2A 1AB4A 5JSBB 3LHPS 4KB4A 1GE9A 1B4AA 3FOFA 3NUHA 3LAPA 1XXAA 4J3NA 2Y3PA 2P5MA 4KDDA 5MLC9 1BJTA 1WQHA 1WQGA 5JVOA 1ISEA 3OPFA 3CAGA 1IS1A 4GFQA 3LAJA 3LPXA 2PHCB 3OREA 4KAWX 4OYDB 3MMLB 1BGWA 1B4BA 5CJ9A 4DDQA 2XCRB 3FOEA 4FM9A 3L4KA 3BUEA 2ZFZA 4G0UA 1XXBA 1F9NA 1DD5A 1WQFA
chains in the Genus database with same CATH superfamily
2R93K 3S15C 3GTLC 5C44C 5M3MK 5IORA 2P8TA 2R93A 2GSNA 4XSXA 1TWHK 4A3MC 1IW7D 4OIOA 4FYDA 3HOUC 3K57A 1ZYRA 3GEIA 2A68D 1TWHA 1KQ4A 2R4GA 2YU9C 2Y3PA 4BXXC 4A3DC 4D3YA 1O24A 4H3TA 3S1QC 4BY1C 2GSOA 3PO3K 1BDFA 1F9NA 3S15K 3GTLK 2V6TA 4IP9A 5C44K 3VA7A 3K5OA 4A3MK 3G4AA 1L0WA 3GTLA 2E2JC 4GZYA 3HOUK 1EI6A 4GT9A 4QCLA 4P5AA 4KB2A 2YU9K 4BXXK 1VH2A 1SEUA 3LAPA 1J6WA 4A3DK 4WILA 1WCMC 1WOPA 1WQGA 1IS1A 3S1QK 4AYBA 4GTLA 4BY1K 1SFOA 2VUMC 4LJZA 4QJVA 5CJ9A 1R9TA 1EQRA 1VJEA 4C2MC 4GTFA 4A3KC 4GTCA 3S2DC 1HI9A 2E2IC 5FLMC 3A8KA 2E2JK 4GTBA 3S1NK 4OIQA 3GEHA 4AYBL 1AB4A 1WCMK 3A8IA 1O29A 4RMFA 3I4MC 2FQOA 1O2AA 2VUMK 1WCMA 1ZXOA 1TWFC 3TFHA 4WJ4A 1USOA 1PJ6A 4C2MK 4OYDB 1VRQC 2VUMA 3N0BA 1I50C 4XLNA 2R92A 4A3KK 3S2DK 2ZFZA 4LOWA 4C2MA 4Y52C 1Y1WK 2E2IA 4C3HK 4OINA 3AD7C 4KM8A 2PMZA 1XXCA 3HOYC 3M3YC 1RU0A 1INNA 1MIUA 1J98A 4X6AC 3HOVC 4G0WA 4OIRA 3I4MK 4AYBD 4KARA 1TWCC 2WAQA 1TL8A 3GDZA 1TWFK 3ADAC 1K83C 4XLPA 4KMUA 1TWGA 4XCHA 3GSIA 1TWFA 1BGWA 1G51A 1I50A 4Y52K 2PMZL 1F93A 3K7AK 5JVOA 2F4QA 1XPPA 3M3YK 3HOYK 5D4DA 4Y7NC 4X6AK 2E2HC 2WAQL 4ZH4A 1T8IA 3HOVK 4JLRC 4BKWA 1TWCK 5C4XK 5HL8A 1K83K 3HXAA 1YNJD 3HOWC 1TWCA 4EJ3A 4KDDA 5C9HA 1ISEA 1K83A 4MEYA 3CQZC 2NVQC 2XCRB 4A3CC 2GAGC 5IOTA 1K4TA 4FXDA 5L46A 3S14C 3S16C 4Y7NK 2NVYC 2XCOA 1Y698 2E2HK 4O2DA 1V9MA 1YNND 3GTPA 1XZQA 3V4GA 2WAQD 2NVXA 4YFNA 1ZVUA 2WB1D 4IP8A 2E2HA 2CFAA 4LK1A 4A3EC 1EH1A 3A8JA 3HOWK 1B4AA 3LHPS 1IE0A 1GE9A 4P9SA 3FKIK 1XZPB 2R7ZC 3GTOC 2JA6C 3CQZK 2NVQK 5C3EC 1F7VA 4A3CK 2O5JD 3TFIA 2PHCB 3M4OC 3CQZA 3SJRA 1RRJA 3BUEA 3S14K 3S16K 4YFKA 1R49A 2NVYK 4ILDA 3I4NC 3FHZA 3RZOC 4KMAA 2NVYA 4A3EK 3T02A 3S1NC 1VLOA 1A35A 2R7ZK 3GTOK 3RZDC 5M5XK 2JA6K 5M5WK 1SMYD 5MLC9 5C3EK 2R7ZA 3Q3QA 2JH3A 3TFJA 2A69A 3M4OK 2YU9A 4BLBA 1I6VA 2JA6A 2ZUEA 4YFXA 4C45A 5TJ3A 3I4NK 1A36A 3HKZA 3RZOK 1V5VA 1DD5A 1IBAA 2Y0SA 4LR2A 3AD8C 4KC6A 3KYLA 3IAYA 2KWAA 1O2BA 2PPBA 1JOEA 4O26A 3GIRA 1ZYRD 1Y1WC 4C3HC 4A3GC 3RZDK 4G7ZA 2P5MA 1WQHA 1O28A 2B63C 3HKZL 5CHPA 4A3BK 2ZUFA 2Y0SL 4MEXA 3K59A 5IYDC 3HOZC 1O2FB 2CFAB 4A3LC 4Q5VA 3S1RC 3K7AC 3S0XA 4A3GK 4FGUA 2NVTC 1Y1WA 1WIHA 1EJ9A 2A69D 2XCQA 5M5YK 4GTAA 2B63K 3NUHA 1XXAA 3K5NA 5C4XC 1PJ5A 3HKZD 3M4AA 1I3QC 3HOZK 5C4JC 3LAJA 4KATA 5IYDK 3EQLA 4QIWA 2Y0SD 3H0GK 4JK1A 1C0AA 4KN7A 3GTQC 1USMA 4A3LK 3S1RK 2A6EA 4P5BA 3P9AA 4A3IC 2W7VA 4GTDA 3ERED 2NVTK 3DU6A 1DCOA 4G7HA 3T00A 3DU5A 2RGRA 2PA8L 3GTJC 3S1MC 5JSBB 4KB4A 4A93C 4QIWL 5FJ8K 4QJVB 1IQ0A 1O25A 4LMOA 4M1XA 4KN4A 3PO2C 1I3QK 5C4JK 4MQ9A 3FKIC 4A3JC 3K5MA 4GFQA 3GTQK 1SC7A 1I3QA 4F3EA 1YCLA 3MMLB 4BLAA 3GTKC 4FZBA 1K4SA 3SZYA 4AN8A 5TMCA 1XXBA 4A3IK 3GTQA 3N3YA 2PMZD 4NOKA 1JQWA 3T01A 4BBSC 4G0VA 3GTJK 3WODA 3S1MK 1EK8A 4A93K 1YX2A 2PA8D 3FOFA 3PO2K 1J6VA 3AQOA 1O26A 4A3JK 1TGOA 1BJTA 5E68A 4D3ZA 3OPFA 3AH5A 1EFWA 4Q5SA 3GTKK 2EBBA 2A6ED 3FKIA 3WVOA 4KM9A 1VGXA 1O27A 3GTKA 2RH6A 1WQFA 2BE5A 3K58A 4BBSK 3L4JA 2GSUA 3TTGA 4NOIA 2V6UA 2D6FC 3LF9A 4C3IC 5IP9C 1Q8IA 4LK0A 1SFOC 4LLGA 4BBRC 3CAGA 3BP8C 1R9TC 3GTOA 1J6XA 3GTGC 5IYBC 3LPXA 3FOEA 4A3BC 4G0UA 1ZQ1C 1WSRA 1F7UA 3QX3A 1BS2A 2V6SA 2JA8C 1DCPA 2JA5C 4KMDA 4Q5GA 3HOXC 4C3IK 5IP9K 4BY7C 4OIPA 4L8IA 2JA7C 4XSZA 5EGEA 1SFOK 4AHCA 4BBRK 3JSTA 3G4CA 1R9TK 4KMHA 4LQYA 3GTGK 1A31A 5IYBK 1NH3A 2R92C 2BE5D 4KAWX 1IL2A 3GTGA 4C3JC 3L4KA 1TWAC 1XZQB 3H0GC 1I6HC 3S2HC 2JA8K 2JA5K 3HOXK 5IP7C 5IYCC 4BY7K 2JA7K 2JA5A 1HQMA 4PABA 3BP3A 2JA7A 1TWGC 1I6VD 1WORA 5IOQA 2A6HA 2R92K 5CQGA 5JFEA 4C3JK 2B63A 1YNJA 2CW0A 1XZPA 4NOLA 1B4BA 1TWAK 3GTMC 2E2IK 3K5LA 4A3FC 5FLMK 1I6HK 3S2HK 4Q4ZA 1TWAA 1UV7A 5JSNB 3H0GA 5IP7K 4YG2A 5IYCK 3GEEA 3SZZA 1RR8C 1Y1VC 4WJ3M 1WSVA 1WOSA 1TWGK 1YNNA 3N0CA 3DXJA 1JVIA 2WB1A 4PAAA 1IW7A 1R5ZA 3AQPA 5EGHA 2GAHC 1I50K 2A68A 3GTMK 1DCHA 3H3VL 4A3FK 4FM9A 4DDQA 4AH6A 3IPJA 3GTMA 3S17C 5M3FK 2O5JA 1Y1VK 3GTPC 4GTEA 2NVXC 3MAQA 3OEPA 4NOMA 2R93C 1HQMD 1WOOA 2WB1L 1X31C 1Y1VA 2A6HD 1LPQA 1PJ7A 3AD9C 4KASA 1TWHC 1ZBSA 2FQTA 5TMFA 2CW0D 4J3NA 2O5IA 3GTJA 4QIWD 1SMYA 3H3VD 3OREA 2B9SB 3S17K 4G7OA 5IOSA 3GTPK 3PO3C 2NVXK
chains in the Genus database with same CATH topology
3QX3A 2CFAB 2F4QA 4Q5VA 3S0XA 4KMDA 4Q5GA 1T8IA 4JLRC 2R93A 2GSNA 4BKWA 5IORA 1IW7D 4FGUA 1Y1WA 4FYDA 1WIHA 3K57A 1EJ9A 2A69D 4L8IA 2XCQA 5EGEA 2A68D 4GTAA 1TWHA 4AHCA 1KQ4A 3NUHA 1XXAA 2R4GA 1YNJD 3K5NA 1TWCA 2Y3PA 4EJ3A 4KDDA 3G4CA 4KMHA 4LQYA 1A31A 5C9HA 1ISEA 4D3YA 1K83A 1NH3A 1O24A 3M4AA 3LAJA 4H3TA 4KATA 4QIWA 2BE5D 4KAWX 3GTGA 2GSOA 4C3JC 2XCRB 3L4KA 1F9NA 5IOTA 1K4TA 4FXDA 4P5BA 3P9AA 4IP9A 5CJ9A 3VA7A 3K5OA 2XCOA 1Y698 1V9MA 1YNND 3G4AA 3GTPA 3GTLA 3DU6A 4GTDA 3ERED 3V4GA 2NVXA 1ZVUA 2JA5A 4IP8A 2E2HA 2CFAA 3DU5A 2RGRA 1EH1A 4QCLA 4GT9A 4P5AA 4KB2A 1B4AA 5JSBB 3LHPS 4KB4A 1SEUA 1GE9A 2JA7A 3LAPA 1I6VD 4M1XA 1O25A 4LMOA 5IOQA 1WQGA 1IS1A 5CQGA 4AYBA 4GTLA 5JFEA 3K5MA 4GFQA 1SFOA 2O5JD 2B63A 2PHCB 1SC7A 4NOLA 4F3EA 1I3QA 1R9TA 1B4BA 3MMLB 4FZBA 3CQZA 1K4SA 3SJRA 3K5LA 4AN8A 1RRJA 3BUEA 4GTFA 4C2MC 1XXBA 1R49A 3GTQA 3N3YA 4GTCA 4ILDA 3FHZA 1TWAA 4NOKA 5JSNB 3H0GA 4KMAA 1RR8C 2NVYA 4GTBA 4G0VA 1EK8A 1A35A 1AB4A 3N0CA 3FOFA 2WB1A 1O29A 3AQOA 1O26A 1SMYD 1R5ZA 1TGOA 5MLC9 1BJTA 3AQPA 1O2AA 5EGHA 4D3ZA 1WCMA 2R7ZA 1ZXOA 2JH3A 3AH5A 3OPFA 2YU9A 3Q3QA 4BLBA 2JA6A 2A6ED 3FKIA 3WVOA 4KM9A 4OYDB 4FM9A 2VUMA 3N0BA 5TJ3A 4DDQA 2R92A 1O27A 1A36A 3GTKA 2ZFZA 3HKZA 3GTMA 4C2MA 2RH6A 1DD5A 1WQFA 2Y0SA 4LR2A 3K58A 4KC6A 3KYLA 3IAYA 2KWAA 1O2BA 2E2IA 4GTEA 3MAQA 2GSUA 3OEPA 3L4JA 4NOMA 4O26A 4KM8A 1HQMD 2PMZA 1XXCA 1ZYRD 1Y1VA 1MIUA 3LF9A 4C3HC 2A6HD 1LPQA 4KASA 4G0WA 4C3IC 1ZBSA 4KARA 1Q8IA 2CW0D 2WAQA 1TL8A 4J3NA 3GTJA 2P5MA 1WQHA 1O28A 1TWGA 3CAGA 5CHPA 3GTOA 3LPXA 1TWFA 3OREA 2B9SB 1BGWA 3K59A 3FOEA 4BLAA 5IOSA 4G0UA 1I50A 5JVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHZ A;  3QX3 A;  5JSN B;  3VA7 A;  4KC6 A;  2XCO A;  1Y69 8;  2KWA A;  3L4J A;  3OEP A;  3ERE D;  4G0V A;  1XXC A;  3V4G A;  4JLR C;  1ZVU A;  3LF9 A;  1WIH A;  1EK8 A;  2RGR A;  1EH1 A;  4G0W A;  4L8I A;  2XCQ A;  4KB2 A;  1AB4 A;  5JSB B;  3LHP S;  4KB4 A;  1GE9 A;  1B4A A;  3FOF A;  3NUH A;  3LAP A;  1XXA A;  4J3N A;  2Y3P A;  2P5M A;  4KDD A;  5MLC 9;  1BJT A;  1WQH A;  1WQG A;  5JVO A;  1ISE A;  3OPF A;  3CAG A;  1IS1 A;  4GFQ A;  3LAJ A;  3LPX A;  2PHC B;  3ORE A;  4KAW X;  4OYD B;  3MML B;  1BGW A;  1B4B A;  5CJ9 A;  4DDQ A;  2XCR B;  3FOE A;  4FM9 A;  3L4K A;  3BUE A;  2ZFZ A;  4G0U A;  1XXB A;  1F9N A;  1DD5 A;  1WQF A; 
#chains in the Genus database with same CATH topology
 2R93 K;  3S15 C;  3GTL C;  5C44 C;  5M3M K;  5IOR A;  2P8T A;  2R93 A;  2GSN A;  4XSX A;  1TWH K;  4A3M C;  1IW7 D;  4OIO A;  4FYD A;  3HOU C;  3K57 A;  1ZYR A;  3GEI A;  2A68 D;  1TWH A;  1KQ4 A;  2R4G A;  2YU9 C;  2Y3P A;  4BXX C;  4A3D C;  4D3Y A;  1O24 A;  4H3T A;  3S1Q C;  4BY1 C;  2GSO A;  3PO3 K;  1BDF A;  1F9N A;  3S15 K;  3GTL K;  2V6T A;  4IP9 A;  5C44 K;  3VA7 A;  3K5O A;  4A3M K;  3G4A A;  1L0W A;  3GTL A;  2E2J C;  4GZY A;  3HOU K;  1EI6 A;  4GT9 A;  4QCL A;  4P5A A;  4KB2 A;  2YU9 K;  4BXX K;  1VH2 A;  1SEU A;  3LAP A;  1J6W A;  4A3D K;  4WIL A;  1WCM C;  1WOP A;  1WQG A;  1IS1 A;  3S1Q K;  4AYB A;  4GTL A;  4BY1 K;  1SFO A;  2VUM C;  4LJZ A;  4QJV A;  5CJ9 A;  1R9T A;  1EQR A;  1VJE A;  4C2M C;  4GTF A;  4A3K C;  4GTC A;  3S2D C;  1HI9 A;  2E2I C;  5FLM C;  3A8K A;  2E2J K;  4GTB A;  3S1N K;  4OIQ A;  3GEH A;  4AYB L;  1AB4 A;  1WCM K;  3A8I A;  1O29 A;  4RMF A;  3I4M C;  2FQO A;  1O2A A;  2VUM K;  1WCM A;  1ZXO A;  1TWF C;  3TFH A;  4WJ4 A;  1USO A;  1PJ6 A;  4C2M K;  4OYD B;  1VRQ C;  2VUM A;  3N0B A;  1I50 C;  4XLN A;  2R92 A;  4A3K K;  3S2D K;  2ZFZ A;  4LOW A;  4C2M A;  4Y52 C;  1Y1W K;  2E2I A;  4C3H K;  4OIN A;  3AD7 C;  4KM8 A;  2PMZ A;  1XXC A;  3HOY C;  3M3Y C;  1RU0 A;  1INN A;  1MIU A;  1J98 A;  4X6A C;  3HOV C;  4G0W A;  4OIR A;  3I4M K;  4AYB D;  4KAR A;  1TWC C;  2WAQ A;  1TL8 A;  3GDZ A;  1TWF K;  3ADA C;  1K83 C;  4XLP A;  4KMU A;  1TWG A;  4XCH A;  3GSI A;  1TWF A;  1BGW A;  1G51 A;  1I50 A;  4Y52 K;  2PMZ L;  1F93 A;  3K7A K;  5JVO A;  2F4Q A;  1XPP A;  3M3Y K;  3HOY K;  5D4D A;  4Y7N C;  4X6A K;  2E2H C;  2WAQ L;  4ZH4 A;  1T8I A;  3HOV K;  4JLR C;  4BKW A;  1TWC K;  5C4X K;  5HL8 A;  1K83 K;  3HXA A;  1YNJ D;  3HOW C;  1TWC A;  4EJ3 A;  4KDD A;  5C9H A;  1ISE A;  1K83 A;  4MEY A;  3CQZ C;  2NVQ C;  2XCR B;  4A3C C;  2GAG C;  5IOT A;  1K4T A;  4FXD A;  5L46 A;  3S14 C;  3S16 C;  4Y7N K;  2NVY C;  2XCO A;  1Y69 8;  2E2H K;  4O2D A;  1V9M A;  1YNN D;  3GTP A;  1XZQ A;  3V4G A;  2WAQ D;  2NVX A;  4YFN A;  1ZVU A;  2WB1 D;  4IP8 A;  2E2H A;  2CFA A;  4LK1 A;  4A3E C;  1EH1 A;  3A8J A;  3HOW K;  1B4A A;  3LHP S;  1IE0 A;  1GE9 A;  4P9S A;  3FKI K;  1XZP B;  2R7Z C;  3GTO C;  2JA6 C;  3CQZ K;  2NVQ K;  5C3E C;  1F7V A;  4A3C K;  2O5J D;  3TFI A;  2PHC B;  3M4O C;  3CQZ A;  3SJR A;  1RRJ A;  3BUE A;  3S14 K;  3S16 K;  4YFK A;  1R49 A;  2NVY K;  4ILD A;  3I4N C;  3FHZ A;  3RZO C;  4KMA A;  2NVY A;  4A3E K;  3T02 A;  3S1N C;  1VLO A;  1A35 A;  2R7Z K;  3GTO K;  3RZD C;  5M5X K;  2JA6 K;  5M5W K;  1SMY D;  5MLC 9;  5C3E K;  2R7Z A;  3Q3Q A;  2JH3 A;  3TFJ A;  2A69 A;  3M4O K;  2YU9 A;  4BLB A;  1I6V A;  2JA6 A;  2ZUE A;  4YFX A;  4C45 A;  5TJ3 A;  3I4N K;  1A36 A;  3HKZ A;  3RZO K;  1V5V A;  1DD5 A;  1IBA A;  2Y0S A;  4LR2 A;  3AD8 C;  4KC6 A;  3KYL A;  3IAY A;  2KWA A;  1O2B A;  2PPB A;  1JOE A;  4O26 A;  3GIR A;  1ZYR D;  1Y1W C;  4C3H C;  4A3G C;  3RZD K;  4G7Z A;  2P5M A;  1WQH A;  1O28 A;  2B63 C;  3HKZ L;  5CHP A;  4A3B K;  2ZUF A;  2Y0S L;  4MEX A;  3K59 A;  5IYD C;  3HOZ C;  1O2F B;  2CFA B;  4A3L C;  4Q5V A;  3S1R C;  3K7A C;  3S0X A;  4A3G K;  4FGU A;  2NVT C;  1Y1W A;  1WIH A;  1EJ9 A;  2A69 D;  2XCQ A;  5M5Y K;  4GTA A;  2B63 K;  3NUH A;  1XXA A;  3K5N A;  5C4X C;  1PJ5 A;  3HKZ D;  3M4A A;  1I3Q C;  3HOZ K;  5C4J C;  3LAJ A;  4KAT A;  5IYD K;  3EQL A;  4QIW A;  2Y0S D;  3H0G K;  4JK1 A;  1C0A A;  4KN7 A;  3GTQ C;  1USM A;  4A3L K;  3S1R K;  2A6E A;  4P5B A;  3P9A A;  4A3I C;  2W7V A;  4GTD A;  3ERE D;  2NVT K;  3DU6 A;  1DCO A;  4G7H A;  3T00 A;  3DU5 A;  2RGR A;  2PA8 L;  3GTJ C;  3S1M C;  5JSB B;  4KB4 A;  4A93 C;  4QIW L;  5FJ8 K;  4QJV B;  1IQ0 A;  1O25 A;  4LMO A;  4M1X A;  4KN4 A;  3PO2 C;  1I3Q K;  5C4J K;  4MQ9 A;  3FKI C;  4A3J C;  3K5M A;  4GFQ A;  3GTQ K;  1SC7 A;  1I3Q A;  4F3E A;  1YCL A;  3MML B;  4BLA A;  3GTK C;  4FZB A;  1K4S A;  3SZY A;  4AN8 A;  5TMC A;  1XXB A;  4A3I K;  3GTQ A;  3N3Y A;  2PMZ D;  4NOK A;  1JQW A;  3T01 A;  4BBS C;  4G0V A;  3GTJ K;  3WOD A;  3S1M K;  1EK8 A;  4A93 K;  1YX2 A;  2PA8 D;  3FOF A;  3PO2 K;  1J6V A;  3AQO A;  1O26 A;  4A3J K;  1TGO A;  1BJT A;  5E68 A;  4D3Z A;  3OPF A;  3AH5 A;  1EFW A;  4Q5S A;  3GTK K;  2EBB A;  2A6E D;  3FKI A;  3WVO A;  4KM9 A;  1VGX A;  1O27 A;  3GTK A;  2RH6 A;  1WQF A;  2BE5 A;  3K58 A;  4BBS K;  3L4J A;  2GSU A;  3TTG A;  4NOI A;  2V6U A;  2D6F C;  3LF9 A;  4C3I C;  5IP9 C;  1Q8I A;  4LK0 A;  1SFO C;  4LLG A;  4BBR C;  3CAG A;  3BP8 C;  1R9T C;  3GTO A;  1J6X A;  3GTG C;  5IYB C;  3LPX A;  3FOE A;  4A3B C;  4G0U A;  1ZQ1 C;  1WSR A;  1F7U A;  3QX3 A;  1BS2 A;  2V6S A;  2JA8 C;  1DCP A;  2JA5 C;  4KMD A;  4Q5G A;  3HOX C;  4C3I K;  5IP9 K;  4BY7 C;  4OIP A;  4L8I A;  2JA7 C;  4XSZ A;  5EGE A;  1SFO K;  4AHC A;  4BBR K;  3JST A;  3G4C A;  1R9T K;  4KMH A;  4LQY A;  3GTG K;  1A31 A;  5IYB K;  1NH3 A;  2R92 C;  2BE5 D;  4KAW X;  1IL2 A;  3GTG A;  4C3J C;  3L4K A;  1TWA C;  1XZQ B;  3H0G C;  1I6H C;  3S2H C;  2JA8 K;  2JA5 K;  3HOX K;  5IP7 C;  5IYC C;  4BY7 K;  2JA7 K;  2JA5 A;  1HQM A;  4PAB A;  3BP3 A;  2JA7 A;  1TWG C;  1I6V D;  1WOR A;  5IOQ A;  2A6H A;  2R92 K;  5CQG A;  5JFE A;  4C3J K;  2B63 A;  1YNJ A;  2CW0 A;  1XZP A;  4NOL A;  1B4B A;  1TWA K;  3GTM C;  2E2I K;  3K5L A;  4A3F C;  5FLM K;  1I6H K;  3S2H K;  4Q4Z A;  1TWA A;  1UV7 A;  5JSN B;  3H0G A;  5IP7 K;  4YG2 A;  5IYC K;  3GEE A;  3SZZ A;  1RR8 C;  1Y1V C;  4WJ3 M;  1WSV A;  1WOS A;  1TWG K;  1YNN A;  3N0C A;  3DXJ A;  1JVI A;  2WB1 A;  4PAA A;  1IW7 A;  1R5Z A;  3AQP A;  5EGH A;  2GAH C;  1I50 K;  2A68 A;  3GTM K;  1DCH A;  3H3V L;  4A3F K;  4FM9 A;  4DDQ A;  4AH6 A;  3IPJ A;  3GTM A;  3S17 C;  5M3F K;  2O5J A;  1Y1V K;  3GTP C;  4GTE A;  2NVX C;  3MAQ A;  3OEP A;  4NOM A;  2R93 C;  1HQM D;  1WOO A;  2WB1 L;  1X31 C;  1Y1V A;  2A6H D;  1LPQ A;  1PJ7 A;  3AD9 C;  4KAS A;  1TWH C;  1ZBS A;  2FQT A;  5TMF A;  2CW0 D;  4J3N A;  2O5I A;  3GTJ A;  4QIW D;  1SMY A;  3H3V D;  3ORE A;  2B9S B;  3S17 K;  4G7O A;  5IOS A;  3GTP K;  3PO3 C;  2NVX K; 
#chains in the Genus database with same CATH homology
 3QX3 A;  2CFA B;  2F4Q A;  4Q5V A;  3S0X A;  4KMD A;  4Q5G A;  1T8I A;  4JLR C;  2R93 A;  2GSN A;  4BKW A;  5IOR A;  1IW7 D;  4FGU A;  1Y1W A;  4FYD A;  1WIH A;  3K57 A;  1EJ9 A;  2A69 D;  4L8I A;  2XCQ A;  5EGE A;  2A68 D;  4GTA A;  1TWH A;  4AHC A;  1KQ4 A;  3NUH A;  1XXA A;  2R4G A;  1YNJ D;  3K5N A;  1TWC A;  2Y3P A;  4EJ3 A;  4KDD A;  3G4C A;  4KMH A;  4LQY A;  1A31 A;  5C9H A;  1ISE A;  4D3Y A;  1K83 A;  1NH3 A;  1O24 A;  3M4A A;  3LAJ A;  4H3T A;  4KAT A;  4QIW A;  2BE5 D;  4KAW X;  3GTG A;  2GSO A;  4C3J C;  2XCR B;  3L4K A;  1F9N A;  5IOT A;  1K4T A;  4FXD A;  4P5B A;  3P9A A;  4IP9 A;  5CJ9 A;  3VA7 A;  3K5O A;  2XCO A;  1Y69 8;  1V9M A;  1YNN D;  3G4A A;  3GTP A;  3GTL A;  3DU6 A;  4GTD A;  3ERE D;  3V4G A;  2NVX A;  1ZVU A;  2JA5 A;  4IP8 A;  2E2H A;  2CFA A;  3DU5 A;  2RGR A;  1EH1 A;  4QCL A;  4GT9 A;  4P5A A;  4KB2 A;  1B4A A;  5JSB B;  3LHP S;  4KB4 A;  1SEU A;  1GE9 A;  2JA7 A;  3LAP A;  1I6V D;  4M1X A;  1O25 A;  4LMO A;  5IOQ A;  1WQG A;  1IS1 A;  5CQG A;  4AYB A;  4GTL A;  5JFE A;  3K5M A;  4GFQ A;  1SFO A;  2O5J D;  2B63 A;  2PHC B;  1SC7 A;  4NOL A;  4F3E A;  1I3Q A;  1R9T A;  1B4B A;  3MML B;  4FZB A;  3CQZ A;  1K4S A;  3SJR A;  3K5L A;  4AN8 A;  1RRJ A;  3BUE A;  4GTF A;  4C2M C;  1XXB A;  1R49 A;  3GTQ A;  3N3Y A;  4GTC A;  4ILD A;  3FHZ A;  1TWA A;  4NOK A;  5JSN B;  3H0G A;  4KMA A;  1RR8 C;  2NVY A;  4GTB A;  4G0V A;  1EK8 A;  1A35 A;  1AB4 A;  3N0C A;  3FOF A;  2WB1 A;  1O29 A;  3AQO A;  1O26 A;  1SMY D;  1R5Z A;  1TGO A;  5MLC 9;  1BJT A;  3AQP A;  1O2A A;  5EGH A;  4D3Z A;  1WCM A;  2R7Z A;  1ZXO A;  2JH3 A;  3AH5 A;  3OPF A;  2YU9 A;  3Q3Q A;  4BLB A;  2JA6 A;  2A6E D;  3FKI A;  3WVO A;  4KM9 A;  4OYD B;  4FM9 A;  2VUM A;  3N0B A;  5TJ3 A;  4DDQ A;  2R92 A;  1O27 A;  1A36 A;  3GTK A;  2ZFZ A;  3HKZ A;  3GTM A;  4C2M A;  2RH6 A;  1DD5 A;  1WQF A;  2Y0S A;  4LR2 A;  3K58 A;  4KC6 A;  3KYL A;  3IAY A;  2KWA A;  1O2B A;  2E2I A;  4GTE A;  3MAQ A;  2GSU A;  3OEP A;  3L4J A;  4NOM A;  4O26 A;  4KM8 A;  1HQM D;  2PMZ A;  1XXC A;  1ZYR D;  1Y1V A;  1MIU A;  3LF9 A;  4C3H C;  2A6H D;  1LPQ A;  4KAS A;  4G0W A;  4C3I C;  1ZBS A;  4KAR A;  1Q8I A;  2CW0 D;  2WAQ A;  1TL8 A;  4J3N A;  3GTJ A;  2P5M A;  1WQH A;  1O28 A;  1TWG A;  3CAG A;  5CHP A;  3GTO A;  3LPX A;  1TWF A;  3ORE A;  2B9S B;  1BGW A;  3K59 A;  3FOE A;  4BLA A;  5IOS A;  4G0U A;  1I50 A;  5JVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...