4KC6A

Crystal structure of c-terminal deletion mutant of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
total genus 61
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kc6A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kc6A02
4KDDA 2XCRB 3FOEA 3ERED 3V4GA 1F9NA 4G0WA 4KB4A 3QX3A 2KWAA 1IS1A 4KC6A 1B4AA 1XXCA 3LHPS 5MLC9 4G0VA 2Y3PA 1ISEA 4JLRC 3OREA 3LAPA 3L4JA 3LPXA 3LAJA 4DDQA 2ZFZA 4L8IA 1AB4A 3CAGA 1EH1A 4J3NA 4KB2A 2PHCB 1Y698 1XXAA 5JVOA 1WIHA 3VA7A 3FHZA 4FM9A 2RGRA 1GE9A 1DD5A 1WQFA 1BJTA 2P5MA 4G0UA 3OEPA 3BUEA 1WQGA 1WQHA 1BGWA 2XCOA 2XCQA 5CJ9A 1EK8A 3FOFA 3MMLB 4KAWX 3OPFA 3LF9A 4GFQA 4OYDB 1XXBA 3NUHA 1B4BA 3L4KA 5JSNB 1ZVUA 5JSBB
chains in the Genus database with same CATH superfamily
1BDFA 3V4GA 2A6HA 3GTLK 2PA8D 3GSIA 2KWAA 4OIPA 4PABA 3M3YC 1KQ4A 4A3JK 3LAJA 4A3FC 4AYBD 1C0AA 3S1QK 1K83A 3PO3K 1WORA 4GTBA 3P9AA 4FYDA 3G4CA 1R9TC 4A3DC 4A93K 3GTJA 4NOMA 3RZDC 3LF9A 1XZPA 2R92C 4C3IK 3AQPA 1I3QA 2A69A 2NVXK 2ZUFA 1F9NA 1DCOA 2O5JD 1X31C 1HI9A 4FZBA 1PJ7A 3GTQK 4A3KC 5MLC9 2WB1L 4Q5SA 3K5LA 4KMHA 2NVYK 1SC7A 3GEIA 2JA5K 1J6XA 4GTCA 3S16K 3S17C 4YFNA 3I4NK 4GTLA 1R49A 2E2HC 3HOUK 4A3CC 4YG2A 1XZQA 3A8IA 5IORA 2R93C 1YNJD 1J6WA 2JA7K 3K7AK 1XXCA 4C3JK 3TFJA 3SZYA 1ZYRD 2A68A 3H3VD 3CQZK 1LPQA 4GT9A 1F93A 4G7OA 1TWFA 2E2IA 4A3MC 3S2HC 1WIHA 3S1MK 4A3EC 1Y1WC 4D3ZA 4OIQA 3S0XA 4G7ZA 3T00A 3HOYC 3EQLA 2D6FC 3S14K 1Y1VA 1K83C 4BLBA 3DXJA 3S17K 4LLGA 3OREA 1A35A 2CW0A 3GTJC 3H0GA 2B63K 1SMYA 4LK0A 4FXDA 3A8JA 3FHZA 2RGRA 4OIRA 4GZYA 2R93K 3GTOA 1IQ0A 1DD5A 2NVTK 3GTPA 1I3QC 5IOSA 1SFOC 3G4AA 5IYDK 4KMDA 1RRJA 1A31A 4GTDA 4LR2A 2BE5D 4A3MK 4G0WA 4YFKA 1TGOA 1I6VA 2CFAB 2P8TA 1WOPA 3HXAA 4QJVB 2PPBA 1K4SA 2GSOA 4KATA 1IW7A 3GTGK 4XSZA 5IYCK 3S2DC 2PMZA 1WQGA 2A6ED 2GAGC 3HOZK 3K59A 1XXBA 5JSNB 4QIWA 1YNND 1TWFC 2E2IC 1TWAA 4LJZA 1JQWA 2YU9C 1A36A 4BBSK 1I3QK 4OIOA 1TWGK 1WOSA 5IYBK 1TWHK 4MQ9A 4BY7C 4A3IK 3HKZD 5JVOA 4KASA 4BXXK 4Y7NK 3I4MK 2VUMK 1WCMA 1Y1VC 1I6HK 2WAQA 2RH6A 3RZOK 4Q5VA 3S1NK 5IP7K 4XSXA 3M4OK 4KDDA 3GTMK 4A3LC 3FKIK 4KB4A 3H0GC 3PO2K 4XCHA 3GTKA 1ISEA 3GTOC 1EI6A 3LAPA 5C4JC 3GTPC 2Y0SD 3N0CA 4LQYA 4EJ3A 5IP9K 3Q3QA 3JSTA 1GE9A 1SFOK 2YU9K 1L0WA 5L46A 2JH3A 1ZXOA 2E2IK 3K58A 3GTLA 3S1RC 2GSUA 2PMZL 1DCHA 3NUHA 5C4XC 3M3YK 1USMA 4ZH4A 2XCRB 4AYBA 4A3FK 4LOWA 3M4AA 1V5VA 4C3HC 4QIWL 4XLNA 4A3DK 1R9TK 4L8IA 3RZDK 4YFXA 2JA8C 5CQGA 1JOEA 2R92K 3WVOA 4P9SA 3IPJA 3HOWC 5FLMC 2NVXA 3BUEA 2W7VA 3HOXC 2O5JA 3MMLB 1J98A 4A3KK 1EJ9A 1TWAC 1K4TA 3A8KA 1NH3A 4OYDB 3AD8C 2E2JC 5TJ3A 5C4JK 3GTPK 2NVYA 2V6TA 3T01A 3N0BA 5C3EC 5C44C 2WAQL 1HQMD 1TL8A 4Y52C 2JA5A 1J6VA 4LMOA 1B4AA 4C2MA 5IOQA 1R5ZA 2WB1D 4PAAA 1XZPB 4KMAA 1WCMC 2E2HK 1BS2A 1Y698 4A3CK 4Q4ZA 2EBBA 2XCOA 1YNJA 4KN7A 4C3HK 2JA7A 3GIRA 4P5AA 1ZYRA 3GTKC 1B4BA 3CQZA 3T02A 5E68A 1WOOA 4MEYA 2JA8K 3GEEA 1IS1A 3S2HK 2R7ZA 4AYBL 5FLMK 4A3EK 1Y1WK 1IL2A 2NVQC 3LPXA 4GTAA 4JK1A 3GTLC 2A6HD 1XZQB 4X6AC 1EFWA 4BBRC 3HOYK 4H3TA 2ZUEA 1VLOA 2B9SB 3AQOA 3AD7C 1I50A 5C44K 4A3JC 5M3FK 5M5YK 1XPPA 1PJ6A 1K83K 4GFQA 2R4GA 5JSBB 2Y3PA 3SJRA 3K5NA 4A93C 3GTJK 3QX3A 2B63A 4OINA 3MAQA 4BKWA 4LK1A 4KN4A 4C3IC 3K5MA 1TWCA 2A69D 2NVXC 4NOKA 2GSNA 5IOTA 1AB4A 3S15C 5M5WK 1XXAA 4P5BA 5HL8A 3TFIA 3HOVC 4FGUA 4IP9A 1O2BA 4O2DA 5EGHA 1VGXA 2BE5A 4A3GC 3KYLA 1EK8A 4O26A 4C2MC 2JA6A 2NVQK 3S16C 1O26A 4WJ4A 3ERED 4BY1C 3I4NC 4X6AK 1G51A 4C45A 4BBRK 3H3VL 4KC6A 3HOUC 3GTGA 4F3EA 3DU6A 1O2FB 3AH5A 2O5IA 5JFEA 3S2DK 2A6EA 5TMFA 1VJEA 2JA7C 3K7AC 4C3JC 4GTFA 1V9MA 2V6SA 1WQFA 2A68D 3CQZC 4XLPA 3OEPA 1BGWA 1RU0A 4WILA 1YNNA 1RR8C 1TWFK 1DCPA 2R7ZC 3S1MC 1TWGA 3FOEA 1TWHA 3N3YA 1WSVA 3S15K 5EGEA 4KARA 3TFHA 4BY7K 1F7UA 1Q8IA 3AD9C 3HKZA 5CHPA 3HOVK 1MIUA 4G0VA 3IAYA 4JLRC 5TMCA 2FQOA 3S14C 4A3GK 1I50C 1O29A 2ZFZA 2VUMA 4AN8A 4C2MK 1Y1VK 4BLAA 2FQTA 2PHCB 1WSRA 4NOLA 2CFAA 2P5MA 3GTMA 4BY1K 4A3LK 2CW0D 3FKIA 1VRQC 3H0GK 2B63C 4KM8A 1SMYD 4QCLA 4QJVA 3GTQA 3K5OA 3GTOK 2NVTC 1ZVUA 1TWCC 2Y0SA 5IYDC 3WODA 1YCLA 4NOIA 4KMUA 4AHCA 3ADAC 1SFOA 2YU9A 3S1RK 2GAHC 1O27A 1I6VD 3CAGA 2R7ZK 3K57A 5C4XK 2JA6C 5M5XK 4G0UA 2XCQA 1YX2A 4KAWX 3OPFA 5M3MK 3GTGC 1IW7D 1PJ5A 1I50K 5IYCC 1IBAA 4ILDA 1R9TA 2PA8L 2PMZD 3HOZC 3LHPS 2R92A 1USOA 4A3BC 4MEXA 3DU5A 1SEUA 1EQRA 3HOWK 3BP8C 3TTGA 3L4JA 1ZQ1C 4QIWD 3HKZL 4D3YA 3HOXK 1UV7A 4J3NA 1TWAK 2E2JK 3VA7A 1VH2A 4BBSC 1BJTA 1TWCK 1TWGC 3BP3A 5IYBC 5C3EK 5CJ9A 1WQHA 1TWHC 1HQMA 1O25A 1F7VA 3FOFA 4Y52K 4A3IC 3S1QC 4GTEA 5C9HA 2F4QA 3PO3C 4BXXC 3L4KA 4M1XA 2WB1A 4Y7NC 3I4MC 2VUMC 1IE0A 2E2HA 1WCMK 3GDZA 1I6HC 2WAQD 1ZBSA 2Y0SL 2JA6K 3RZOC 3S1NC 1INNA 2R93A 5IP7C 4Q5GA 3M4OC 4KM9A 3GTMC 1O24A 3FKIC 4DDQA 5D4DA 3PO2C 2V6UA 4FM9A 1EH1A 1JVIA 4KB2A 1O28A 4AH6A 3GEHA 3GTQC 3SZZA 3GTKK 4RMFA 5FJ8K 1O2AA 2NVYC 4WJ3M 4IP8A 4A3BK 1T8IA 5IP9C 4G7HA 2JA5C 1Y1WA
chains in the Genus database with same CATH topology
4GTDA 3N0BA 4LR2A 1TWHA 3FOEA 2BE5D 3N3YA 1HQMD 3V4GA 4G0WA 1TL8A 5EGEA 2JA5A 1TGOA 2KWAA 4LMOA 4KARA 1Q8IA 4C2MA 3HKZA 1B4AA 2CFAB 5CHPA 1MIUA 5IOQA 4G0VA 1R5ZA 3IAYA 4JLRC 1KQ4A 3LAJA 1O29A 4KMAA 2ZFZA 2VUMA 4AN8A 1K83A 4BLAA 1K4SA 2GSOA 2PHCB 1Y698 4KATA 4GTBA 4NOLA 2CFAA 2P5MA 3P9AA 4FYDA 3G4CA 2PMZA 3GTMA 1WQGA 2XCOA 3GTJA 2A6ED 2CW0D 3FKIA 4NOMA 2JA7A 4KM8A 1SMYD 4QCLA 3LF9A 3K59A 3GTQA 1XXBA 3K5OA 4P5AA 1B4BA 3AQPA 3CQZA 5JSNB 1I3QA 1ZVUA 4QIWA 2Y0SA 1F9NA 1YNND 2O5JD 4FZBA 1IS1A 1TWAA 5MLC9 2R7ZA 4AHCA 1A36A 1SFOA 2YU9A 3K5LA 4KMHA 3LPXA 4GTAA 1SC7A 2A6HD 1O27A 1I6VD 3CAGA 4GTCA 3K57A 4H3TA 5JVOA 4KASA 2B9SB 3AQOA 1I50A 4G0UA 2XCQA 1WCMA 4GTLA 1R49A 4KAWX 3OPFA 2WAQA 2RH6A 1IW7D 4GFQA 4Q5VA 2R4GA 5IORA 5JSBB 2Y3PA 1R9TA 3SJRA 3K5NA 4KDDA 4ILDA 1YNJD 4KB4A 3QX3A 2B63A 3MAQA 4BKWA 1XXCA 3LHPS 2R92A 3DU5A 1ZYRD 1SEUA 3GTKA 1ISEA 4C3IC 3K5MA 3LAPA 3L4JA 1TWCA 2A69D 1LPQA 4GT9A 4D3YA 4NOKA 1TWFA 2GSNA 2E2IA 3N0CA 4LQYA 5IOTA 4EJ3A 1AB4A 4J3NA 3Q3QA 1XXAA 4P5BA 3VA7A 1WIHA 4FGUA 4IP9A 1GE9A 1BJTA 1O2BA 4D3ZA 2JH3A 3S0XA 1ZXOA 1WQHA 5CJ9A 5EGHA 3K58A 3GTLA 3KYLA 1O25A 1EK8A 4O26A 3FOFA 2GSUA 4GTEA 5C9HA 2F4QA 4C2MC 3NUHA 2JA6A 3L4KA 4M1XA 1O26A 2WB1A 2XCRB 3ERED 4AYBA 3M4AA 1Y1VA 2E2HA 4KC6A 4C3HC 3GTGA 4F3EA 3DU6A 1ZBSA 3AH5A 4BLBA 2R93A 5JFEA 4Q5GA 3OREA 1A35A 4KM9A 3H0GA 1O24A 4DDQA 4L8IA 5CQGA 4FM9A 1EH1A 4FXDA 4KB2A 1O28A 4GTFA 4C3JC 3WVOA 3FHZA 2RGRA 1V9MA 3GTOA 1DD5A 1WQFA 2A68D 3GTPA 5IOSA 2NVXA 3OEPA 3BUEA 1O2AA 1BGWA 1RR8C 3G4AA 4IP8A 1T8IA 3MMLB 4KMDA 1RRJA 1EJ9A 1K4TA 1A31A 1NH3A 4OYDB 5TJ3A 1Y1WA 1TWGA 2NVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDD A;  2XCR B;  3FOE A;  3ERE D;  3V4G A;  1F9N A;  4G0W A;  4KB4 A;  3QX3 A;  2KWA A;  1IS1 A;  4KC6 A;  1B4A A;  1XXC A;  3LHP S;  5MLC 9;  4G0V A;  2Y3P A;  1ISE A;  4JLR C;  3ORE A;  3LAP A;  3L4J A;  3LPX A;  3LAJ A;  4DDQ A;  2ZFZ A;  4L8I A;  1AB4 A;  3CAG A;  1EH1 A;  4J3N A;  4KB2 A;  2PHC B;  1Y69 8;  1XXA A;  5JVO A;  1WIH A;  3VA7 A;  3FHZ A;  4FM9 A;  2RGR A;  1GE9 A;  1DD5 A;  1WQF A;  1BJT A;  2P5M A;  4G0U A;  3OEP A;  3BUE A;  1WQG A;  1WQH A;  1BGW A;  2XCO A;  2XCQ A;  5CJ9 A;  1EK8 A;  3FOF A;  3MML B;  4KAW X;  3OPF A;  3LF9 A;  4GFQ A;  4OYD B;  1XXB A;  3NUH A;  1B4B A;  3L4K A;  5JSN B;  1ZVU A;  5JSB B; 
#chains in the Genus database with same CATH topology
 1BDF A;  3V4G A;  2A6H A;  3GTL K;  2PA8 D;  3GSI A;  2KWA A;  4OIP A;  4PAB A;  3M3Y C;  1KQ4 A;  4A3J K;  3LAJ A;  4A3F C;  4AYB D;  1C0A A;  3S1Q K;  1K83 A;  3PO3 K;  1WOR A;  4GTB A;  3P9A A;  4FYD A;  3G4C A;  1R9T C;  4A3D C;  4A93 K;  3GTJ A;  4NOM A;  3RZD C;  3LF9 A;  1XZP A;  2R92 C;  4C3I K;  3AQP A;  1I3Q A;  2A69 A;  2NVX K;  2ZUF A;  1F9N A;  1DCO A;  2O5J D;  1X31 C;  1HI9 A;  4FZB A;  1PJ7 A;  3GTQ K;  4A3K C;  5MLC 9;  2WB1 L;  4Q5S A;  3K5L A;  4KMH A;  2NVY K;  1SC7 A;  3GEI A;  2JA5 K;  1J6X A;  4GTC A;  3S16 K;  3S17 C;  4YFN A;  3I4N K;  4GTL A;  1R49 A;  2E2H C;  3HOU K;  4A3C C;  4YG2 A;  1XZQ A;  3A8I A;  5IOR A;  2R93 C;  1YNJ D;  1J6W A;  2JA7 K;  3K7A K;  1XXC A;  4C3J K;  3TFJ A;  3SZY A;  1ZYR D;  2A68 A;  3H3V D;  3CQZ K;  1LPQ A;  4GT9 A;  1F93 A;  4G7O A;  1TWF A;  2E2I A;  4A3M C;  3S2H C;  1WIH A;  3S1M K;  4A3E C;  1Y1W C;  4D3Z A;  4OIQ A;  3S0X A;  4G7Z A;  3T00 A;  3HOY C;  3EQL A;  2D6F C;  3S14 K;  1Y1V A;  1K83 C;  4BLB A;  3DXJ A;  3S17 K;  4LLG A;  3ORE A;  1A35 A;  2CW0 A;  3GTJ C;  3H0G A;  2B63 K;  1SMY A;  4LK0 A;  4FXD A;  3A8J A;  3FHZ A;  2RGR A;  4OIR A;  4GZY A;  2R93 K;  3GTO A;  1IQ0 A;  1DD5 A;  2NVT K;  3GTP A;  1I3Q C;  5IOS A;  1SFO C;  3G4A A;  5IYD K;  4KMD A;  1RRJ A;  1A31 A;  4GTD A;  4LR2 A;  2BE5 D;  4A3M K;  4G0W A;  4YFK A;  1TGO A;  1I6V A;  2CFA B;  2P8T A;  1WOP A;  3HXA A;  4QJV B;  2PPB A;  1K4S A;  2GSO A;  4KAT A;  1IW7 A;  3GTG K;  4XSZ A;  5IYC K;  3S2D C;  2PMZ A;  1WQG A;  2A6E D;  2GAG C;  3HOZ K;  3K59 A;  1XXB A;  5JSN B;  4QIW A;  1YNN D;  1TWF C;  2E2I C;  1TWA A;  4LJZ A;  1JQW A;  2YU9 C;  1A36 A;  4BBS K;  1I3Q K;  4OIO A;  1TWG K;  1WOS A;  5IYB K;  1TWH K;  4MQ9 A;  4BY7 C;  4A3I K;  3HKZ D;  5JVO A;  4KAS A;  4BXX K;  4Y7N K;  3I4M K;  2VUM K;  1WCM A;  1Y1V C;  1I6H K;  2WAQ A;  2RH6 A;  3RZO K;  4Q5V A;  3S1N K;  5IP7 K;  4XSX A;  3M4O K;  4KDD A;  3GTM K;  4A3L C;  3FKI K;  4KB4 A;  3H0G C;  3PO2 K;  4XCH A;  3GTK A;  1ISE A;  3GTO C;  1EI6 A;  3LAP A;  5C4J C;  3GTP C;  2Y0S D;  3N0C A;  4LQY A;  4EJ3 A;  5IP9 K;  3Q3Q A;  3JST A;  1GE9 A;  1SFO K;  2YU9 K;  1L0W A;  5L46 A;  2JH3 A;  1ZXO A;  2E2I K;  3K58 A;  3GTL A;  3S1R C;  2GSU A;  2PMZ L;  1DCH A;  3NUH A;  5C4X C;  3M3Y K;  1USM A;  4ZH4 A;  2XCR B;  4AYB A;  4A3F K;  4LOW A;  3M4A A;  1V5V A;  4C3H C;  4QIW L;  4XLN A;  4A3D K;  1R9T K;  4L8I A;  3RZD K;  4YFX A;  2JA8 C;  5CQG A;  1JOE A;  2R92 K;  3WVO A;  4P9S A;  3IPJ A;  3HOW C;  5FLM C;  2NVX A;  3BUE A;  2W7V A;  3HOX C;  2O5J A;  3MML B;  1J98 A;  4A3K K;  1EJ9 A;  1TWA C;  1K4T A;  3A8K A;  1NH3 A;  4OYD B;  3AD8 C;  2E2J C;  5TJ3 A;  5C4J K;  3GTP K;  2NVY A;  2V6T A;  3T01 A;  3N0B A;  5C3E C;  5C44 C;  2WAQ L;  1HQM D;  1TL8 A;  4Y52 C;  2JA5 A;  1J6V A;  4LMO A;  1B4A A;  4C2M A;  5IOQ A;  1R5Z A;  2WB1 D;  4PAA A;  1XZP B;  4KMA A;  1WCM C;  2E2H K;  1BS2 A;  1Y69 8;  4A3C K;  4Q4Z A;  2EBB A;  2XCO A;  1YNJ A;  4KN7 A;  4C3H K;  2JA7 A;  3GIR A;  4P5A A;  1ZYR A;  3GTK C;  1B4B A;  3CQZ A;  3T02 A;  5E68 A;  1WOO A;  4MEY A;  2JA8 K;  3GEE A;  1IS1 A;  3S2H K;  2R7Z A;  4AYB L;  5FLM K;  4A3E K;  1Y1W K;  1IL2 A;  2NVQ C;  3LPX A;  4GTA A;  4JK1 A;  3GTL C;  2A6H D;  1XZQ B;  4X6A C;  1EFW A;  4BBR C;  3HOY K;  4H3T A;  2ZUE A;  1VLO A;  2B9S B;  3AQO A;  3AD7 C;  1I50 A;  5C44 K;  4A3J C;  5M3F K;  5M5Y K;  1XPP A;  1PJ6 A;  1K83 K;  4GFQ A;  2R4G A;  5JSB B;  2Y3P A;  3SJR A;  3K5N A;  4A93 C;  3GTJ K;  3QX3 A;  2B63 A;  4OIN A;  3MAQ A;  4BKW A;  4LK1 A;  4KN4 A;  4C3I C;  3K5M A;  1TWC A;  2A69 D;  2NVX C;  4NOK A;  2GSN A;  5IOT A;  1AB4 A;  3S15 C;  5M5W K;  1XXA A;  4P5B A;  5HL8 A;  3TFI A;  3HOV C;  4FGU A;  4IP9 A;  1O2B A;  4O2D A;  5EGH A;  1VGX A;  2BE5 A;  4A3G C;  3KYL A;  1EK8 A;  4O26 A;  4C2M C;  2JA6 A;  2NVQ K;  3S16 C;  1O26 A;  4WJ4 A;  3ERE D;  4BY1 C;  3I4N C;  4X6A K;  1G51 A;  4C45 A;  4BBR K;  3H3V L;  4KC6 A;  3HOU C;  3GTG A;  4F3E A;  3DU6 A;  1O2F B;  3AH5 A;  2O5I A;  5JFE A;  3S2D K;  2A6E A;  5TMF A;  1VJE A;  2JA7 C;  3K7A C;  4C3J C;  4GTF A;  1V9M A;  2V6S A;  1WQF A;  2A68 D;  3CQZ C;  4XLP A;  3OEP A;  1BGW A;  1RU0 A;  4WIL A;  1YNN A;  1RR8 C;  1TWF K;  1DCP A;  2R7Z C;  3S1M C;  1TWG A;  3FOE A;  1TWH A;  3N3Y A;  1WSV A;  3S15 K;  5EGE A;  4KAR A;  3TFH A;  4BY7 K;  1F7U A;  1Q8I A;  3AD9 C;  3HKZ A;  5CHP A;  3HOV K;  1MIU A;  4G0V A;  3IAY A;  4JLR C;  5TMC A;  2FQO A;  3S14 C;  4A3G K;  1I50 C;  1O29 A;  2ZFZ A;  2VUM A;  4AN8 A;  4C2M K;  1Y1V K;  4BLA A;  2FQT A;  2PHC B;  1WSR A;  4NOL A;  2CFA A;  2P5M A;  3GTM A;  4BY1 K;  4A3L K;  2CW0 D;  3FKI A;  1VRQ C;  3H0G K;  2B63 C;  4KM8 A;  1SMY D;  4QCL A;  4QJV A;  3GTQ A;  3K5O A;  3GTO K;  2NVT C;  1ZVU A;  1TWC C;  2Y0S A;  5IYD C;  3WOD A;  1YCL A;  4NOI A;  4KMU A;  4AHC A;  3ADA C;  1SFO A;  2YU9 A;  3S1R K;  2GAH C;  1O27 A;  1I6V D;  3CAG A;  2R7Z K;  3K57 A;  5C4X K;  2JA6 C;  5M5X K;  4G0U A;  2XCQ A;  1YX2 A;  4KAW X;  3OPF A;  5M3M K;  3GTG C;  1IW7 D;  1PJ5 A;  1I50 K;  5IYC C;  1IBA A;  4ILD A;  1R9T A;  2PA8 L;  2PMZ D;  3HOZ C;  3LHP S;  2R92 A;  1USO A;  4A3B C;  4MEX A;  3DU5 A;  1SEU A;  1EQR A;  3HOW K;  3BP8 C;  3TTG A;  3L4J A;  1ZQ1 C;  4QIW D;  3HKZ L;  4D3Y A;  3HOX K;  1UV7 A;  4J3N A;  1TWA K;  2E2J K;  3VA7 A;  1VH2 A;  4BBS C;  1BJT A;  1TWC K;  1TWG C;  3BP3 A;  5IYB C;  5C3E K;  5CJ9 A;  1WQH A;  1TWH C;  1HQM A;  1O25 A;  1F7V A;  3FOF A;  4Y52 K;  4A3I C;  3S1Q C;  4GTE A;  5C9H A;  2F4Q A;  3PO3 C;  4BXX C;  3L4K A;  4M1X A;  2WB1 A;  4Y7N C;  3I4M C;  2VUM C;  1IE0 A;  2E2H A;  1WCM K;  3GDZ A;  1I6H C;  2WAQ D;  1ZBS A;  2Y0S L;  2JA6 K;  3RZO C;  3S1N C;  1INN A;  2R93 A;  5IP7 C;  4Q5G A;  3M4O C;  4KM9 A;  3GTM C;  1O24 A;  3FKI C;  4DDQ A;  5D4D A;  3PO2 C;  2V6U A;  4FM9 A;  1EH1 A;  1JVI A;  4KB2 A;  1O28 A;  4AH6 A;  3GEH A;  3GTQ C;  3SZZ A;  3GTK K;  4RMF A;  5FJ8 K;  1O2A A;  2NVY C;  4WJ3 M;  4IP8 A;  4A3B K;  1T8I A;  5IP9 C;  4G7H A;  2JA5 C;  1Y1W A; 
#chains in the Genus database with same CATH homology
 4GTD A;  3N0B A;  4LR2 A;  1TWH A;  3FOE A;  2BE5 D;  3N3Y A;  1HQM D;  3V4G A;  4G0W A;  1TL8 A;  5EGE A;  2JA5 A;  1TGO A;  2KWA A;  4LMO A;  4KAR A;  1Q8I A;  4C2M A;  3HKZ A;  1B4A A;  2CFA B;  5CHP A;  1MIU A;  5IOQ A;  4G0V A;  1R5Z A;  3IAY A;  4JLR C;  1KQ4 A;  3LAJ A;  1O29 A;  4KMA A;  2ZFZ A;  2VUM A;  4AN8 A;  1K83 A;  4BLA A;  1K4S A;  2GSO A;  2PHC B;  1Y69 8;  4KAT A;  4GTB A;  4NOL A;  2CFA A;  2P5M A;  3P9A A;  4FYD A;  3G4C A;  2PMZ A;  3GTM A;  1WQG A;  2XCO A;  3GTJ A;  2A6E D;  2CW0 D;  3FKI A;  4NOM A;  2JA7 A;  4KM8 A;  1SMY D;  4QCL A;  3LF9 A;  3K59 A;  3GTQ A;  1XXB A;  3K5O A;  4P5A A;  1B4B A;  3AQP A;  3CQZ A;  5JSN B;  1I3Q A;  1ZVU A;  4QIW A;  2Y0S A;  1F9N A;  1YNN D;  2O5J D;  4FZB A;  1IS1 A;  1TWA A;  5MLC 9;  2R7Z A;  4AHC A;  1A36 A;  1SFO A;  2YU9 A;  3K5L A;  4KMH A;  3LPX A;  4GTA A;  1SC7 A;  2A6H D;  1O27 A;  1I6V D;  3CAG A;  4GTC A;  3K57 A;  4H3T A;  5JVO A;  4KAS A;  2B9S B;  3AQO A;  1I50 A;  4G0U A;  2XCQ A;  1WCM A;  4GTL A;  1R49 A;  4KAW X;  3OPF A;  2WAQ A;  2RH6 A;  1IW7 D;  4GFQ A;  4Q5V A;  2R4G A;  5IOR A;  5JSB B;  2Y3P A;  1R9T A;  3SJR A;  3K5N A;  4KDD A;  4ILD A;  1YNJ D;  4KB4 A;  3QX3 A;  2B63 A;  3MAQ A;  4BKW A;  1XXC A;  3LHP S;  2R92 A;  3DU5 A;  1ZYR D;  1SEU A;  3GTK A;  1ISE A;  4C3I C;  3K5M A;  3LAP A;  3L4J A;  1TWC A;  2A69 D;  1LPQ A;  4GT9 A;  4D3Y A;  4NOK A;  1TWF A;  2GSN A;  2E2I A;  3N0C A;  4LQY A;  5IOT A;  4EJ3 A;  1AB4 A;  4J3N A;  3Q3Q A;  1XXA A;  4P5B A;  3VA7 A;  1WIH A;  4FGU A;  4IP9 A;  1GE9 A;  1BJT A;  1O2B A;  4D3Z A;  2JH3 A;  3S0X A;  1ZXO A;  1WQH A;  5CJ9 A;  5EGH A;  3K58 A;  3GTL A;  3KYL A;  1O25 A;  1EK8 A;  4O26 A;  3FOF A;  2GSU A;  4GTE A;  5C9H A;  2F4Q A;  4C2M C;  3NUH A;  2JA6 A;  3L4K A;  4M1X A;  1O26 A;  2WB1 A;  2XCR B;  3ERE D;  4AYB A;  3M4A A;  1Y1V A;  2E2H A;  4KC6 A;  4C3H C;  3GTG A;  4F3E A;  3DU6 A;  1ZBS A;  3AH5 A;  4BLB A;  2R93 A;  5JFE A;  4Q5G A;  3ORE A;  1A35 A;  4KM9 A;  3H0G A;  1O24 A;  4DDQ A;  4L8I A;  5CQG A;  4FM9 A;  1EH1 A;  4FXD A;  4KB2 A;  1O28 A;  4GTF A;  4C3J C;  3WVO A;  3FHZ A;  2RGR A;  1V9M A;  3GTO A;  1DD5 A;  1WQF A;  2A68 D;  3GTP A;  5IOS A;  2NVX A;  3OEP A;  3BUE A;  1O2A A;  1BGW A;  1RR8 C;  3G4A A;  4IP8 A;  1T8I A;  3MML B;  4KMD A;  1RRJ A;  1EJ9 A;  1K4T A;  1A31 A;  1NH3 A;  4OYD B;  5TJ3 A;  1Y1W A;  1TWG A;  2NVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...