4KC6A

Crystal structure of c-terminal deletion mutant of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 61
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kc6A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kc6A02
5JSNB 3OPFA 3ERED 4G0UA 1DD5A 1EK8A 4DDQA 2XCQA 4FM9A 3V4GA 4KAWX 2RGRA 3FOEA 3LAPA 1BJTA 1XXCA 2P5MA 1WQHA 3FOFA 5JVOA 4KB2A 1WQGA 1AB4A 1WQFA 4L8IA 2KWAA 3CAGA 3FHZA 3L4KA 2Y3PA 3OEPA 1B4BA 3OREA 2PHCB 5CJ9A 3L4JA 3LAJA 2XCOA 4KDDA 1ZVUA 3LPXA 4G0WA 4JLRC 1F9NA 4G0VA 4OYDB 3VA7A 2XCRB 1IS1A 3LHPS 4KB4A 5MLC9 2ZFZA 3MMLB 1XXBA 4KC6A 1GE9A 1Y698 1ISEA 1B4AA 3NUHA 1WIHA 3LF9A 1EH1A 4GFQA 3BUEA 4J3NA 1BGWA 1XXAA 5JSBB 3QX3A
chains in the Genus database with same CATH superfamily
3GTJC 2NVXC 3M4OK 4KMUA 4NOIA 4OIQA 2B63C 3K5NA 2VUMK 2Y0SA 3DU6A 3M3YC 3GTMK 2VUMA 1Q8IA 2A6EA 1BS2A 1XZQA 3GTMA 5IYCK 4BY7K 1WQFA 1Y1VC 3GSIA 5IORA 3IAYA 4QIWL 4C3HK 4YFKA 2NVXK 3GTPA 4C2MK 4A3KC 1O24A 1TWCC 3GTQA 5M5XK 4LJZA 2E2JK 1PJ6A 3ERED 1JVIA 1LPQA 2CW0A 4G0UA 4GTCA 4A3EC 1WSVA 1IW7A 1Y1WC 5HL8A 1R9TC 4X6AK 2ZUFA 4GT9A 2JA7C 3K5OA 3GTLK 3T00A 1TGOA 3S17C 1YNJA 1WSRA 2NVTC 1O2BA 1O28A 2GAHC 1TWFC 1DCHA 5C44C 3HOZC 5C3EK 4D3YA 1BGWA 2E2HC 3QX3A 4AYBD 4FGUA 5M5YK 5C4JK 3RZOC 1F7VA 1EK8A 4Y52C 2FQTA 2RGRA 2BE5D 4LLGA 4C2MA 4ZH4A 4KASA 2V6SA 1I3QK 1AB4A 3S15K 4QJVA 1EFWA 3GDZA 2A68A 2PA8L 4Y52K 4KMAA 5CJ9A 3GTKA 4GTAA 4Y7NC 1G51A 1F9NA 4MEXA 3HOUK 3HOWC 2EBBA 3FHZA 3HOYK 3OPFA 5TMFA 2E2IC 1O2AA 1BJTA 2A6HA 4QCLA 2P5MA 3GTOK 5JVOA 4BKWA 3S1QK 1ZBSA 2KWAA 3GTKK 2WB1D 2Y3PA 4FZBA 4BXXC 1K83A 3JSTA 2D6FC 3L4JA 2GSOA 1ZQ1C 2R93A 4H3TA 2R7ZA 1TWGA 1YNNA 1WOSA 2CFAA 3K59A 1TWGK 4BBSK 2WAQD 3HOVK 2YU9K 1I50C 4EJ3A 2GSNA 3HOUC 1O29A 3BUEA 3HOWK 3S14C 5EGEA 3AQOA 4C2MC 1JQWA 4XSZA 4XCHA 4OIOA 4GTEA 1J6XA 1Y1VK 4MQ9A 5IYBK 1TWHC 4Y7NK 1WQGA 1HI9A 3S1MK 1TWHK 4AYBA 3L4KA 5IYCC 2PMZA 1O25A 3RZOK 1C0AA 3M4AA 4BLBA 3T01A 2WAQA 2JA7A 2JA5K 3SZYA 2JH3A 3H3VL 4A3IK 1V5VA 1XPPA 4A3DK 1I50K 2NVTK 2WB1L 5JSBB 2JA6A 3H0GC 1SFOA 5IOSA 4AYBL 5CHPA 4G7ZA 4DDQA 1JOEA 2GAGC 4KATA 1YNND 3N3YA 4X6AC 1TWAC 2R7ZK 2WAQL 5IP7K 1WOOA 4L8IA 2R7ZC 1R49A 1R9TK 1SEUA 4A3MK 2R93C 4IP9A 3GIRA 4P5AA 1A31A 1TWAK 3LPXA 5D4DA 4GZYA 4BLAA 2O5JA 5L46A 2R92A 1SMYD 1GE9A 4A3IC 4AN8A 4A3JK 4GFQA 5IP9K 1WCMK 4A3KK 3LAPA 1TWHA 5C4XC 4AHCA 3AH5A 3K7AC 3RZDK 2NVXA 4WJ3M 3S1NC 3GTJA 1R9TA 4BY7C 1XZPA 4GTBA 2JA8K 3K57A 2B63A 5C9HA 4F3EA 3M3YK 2JA8C 1WORA 4QIWD 3GEEA 1IBAA 2F4QA 5C3EC 3I4NC 2YU9C 4A3BK 3MMLB 5C4JC 1B4AA 1ZXOA 3ADAC 3HOZK 1WCMC 4A3FK 1TWCA 2PPBA 4C3IK 4JK1A 4OINA 4KN4A 3K58A 3BP3A 4BBRK 1SMYA 3GTQK 2O5JD 1RR8C 3DXJA 3GEIA 1L0WA 5IP7C 5M3FK 2NVYA 3GTKC 1I6HK 2W7VA 3OREA 2NVYK 1Y1WK 3GTGC 2E2IK 4KDDA 1Y1WA 4BBRC 1RU0A 2PA8D 4OYDB 2ZFZA 4G7HA 4A3GK 1Y698 4C3IC 3NUHA 1IL2A 2E2JC 4A3BC 3AQPA 2JA5C 2XCOA 1YX2A 5FJ8K 3WODA 1X31C 4NOMA 3EQLA 3FKIC 4OIPA 4Q4ZA 1MIUA 1K4SA 1TWFA 3FKIK 3GTJK 3TFJA 3K7AK 3RZDC 4A3CC 5IP9C 2PMZL 1XZQB 3GTLA 1O27A 5CQGA 2V6UA 1VGXA 4LR2A 4Q5GA 4O2DA 1USOA 2A69A 2NVYC 4FYDA 2WB1A 3CQZC 5TMCA 1BDFA 1R5ZA 3CQZK 4A3EK 3FKIA 1HQMA 1VH2A 4G0WA 3H0GK 2CW0D 3A8KA 3HOYC 3LF9A 2E2IA 1EH1A 4LOWA 4A93C 4KMHA 3PO3C 3HXAA 2XCQA 4A3LC 3I4NK 3S15C 3FOEA 1IQ0A 3SZZA 1A35A 3S1MC 2V6TA 3AD8C 3AD9C 4KB2A 3G4CA 4Q5SA 4LK0A 3HOXK 4YG2A 4NOLA 2PHCB 4A3LK 1ZVUA 5C4XK 4LQYA 4BY1C 3AD7C 1IS1A 3BP8C 4KC6A 5TJ3A 2E2HK 4IP8A 4A93K 3GTPK 1HQMD 5E68A 3CQZA 4RMFA 4D3ZA 3HKZA 1A36A 5IYDC 4XLPA 2JA7K 3GEHA 1I6HC 1I3QA 3H0GA 2FQOA 2JA6C 1SFOC 3GTGK 4KN7A 3FOFA 1PJ5A 4KMDA 4A3MC 2JA6K 3CAGA 4LMOA 3S0XA 4KM8A 3S2DC 2A69D 1PJ7A 4P9SA 3LAJA 5IYDK 4YFXA 4A3FC 3GTPC 2E2HA 2XCRB 4C3JK 1J6WA 3DU5A 4P5BA 1ISEA 4Q5VA 2ZUEA 2R92C 3S16K 1F93A 3G4AA 1WOPA 4NOKA 1DD5A 4MEYA 4C3HC 4FM9A 2A68D 3GTOA 3K5LA 3IPJA 1K4TA 4QIWA 1WQHA 3A8JA 2PMZD 4G7OA 1XZPB 1VJEA 3S1NK 4O26A 2GSUA 1I3QC 2BE5A 1B4BA 1EJ9A 4GTFA 1VLOA 3PO3K 5IYBC 4G0VA 1KQ4A 3N0CA 4XSXA 3S16C 3S1RK 1K83C 1XXBA 2JA5A 2Y0SD 3S14K 4C3JC 1TWGC 4BBSC 3I4MC 2R92K 4WILA 5C44K 4J3NA 4PABA 3PO2C 1I6VA 1WCMA 3V4GA 4PAAA 4KAWX 3S2DK 2R93K 3TFHA 4LK1A 4FXDA 4BXXK 3MAQA 3OEPA 3S1QC 1USMA 1V9MA 2YU9A 1YCLA 4OIRA 2RH6A 1VRQC 3GTGA 4KM9A 1ZYRA 5JFEA 3LHPS 4KB4A 1I50A 2B9SB 1T8IA 3A8IA 1J6VA 1WIHA 3T02A 1K83K 3Q3QA 3I4MK 4A3CK 3P9AA 3K5MA 1NH3A 5M5WK 1EQRA 3S1RC 1TWCK 3S2HC 2O5IA 4BY1K 1O26A 1INNA 3HOXC 4AH6A 4GTDA 3N0BA 1XXCA 3TTGA 5IOTA 4KARA 2R4GA 1TWAA 3H3VD 2B63K 2VUMC 3S2HK 4QJVB 5IOQA 1Y1VA 3GTMC 1EI6A 4GTLA 2P8TA 1SC7A 2A6ED 1TL8A 3VA7A 1YNJD 5MLC9 3M4OC 1UV7A 4A3JC 3KYLA 4A3GC 5FLMK 2CFAB 3HOVC 3WVOA 1DCOA 1XXAA 5EGHA 4M1XA 1TWFK 5M3MK 3GTLC 5JSNB 1RRJA 1J98A 3TFIA 4YFNA 3S17K 2NVQC 1ZYRD 4C45A 3GTOC 3HKZL 2A6HD 4XLNA 1SFOK 3SJRA 1I6VD 4ILDA 2Y0SL 1DCPA 3GTQC 1F7UA 3PO2K 4JLRC 2NVQK 1IW7D 4WJ4A 1O2FB 5FLMC 3HKZD 4A3DC 1IE0A
chains in the Genus database with same CATH topology
4C2MC 1DD5A 4C3HC 4FM9A 2A68D 3K5NA 3GTOA 2Y0SA 4NOMA 3DU6A 4GTEA 3K5LA 1K4TA 2VUMA 4QIWA 1Q8IA 1WQHA 1WQGA 3GTMA 1WQFA 4O26A 2GSUA 4AYBA 3L4KA 1B4BA 2PMZA 1EJ9A 5IORA 1MIUA 3IAYA 4GTFA 1K4SA 1O25A 3GTPA 1TWFA 3M4AA 4BLBA 4G0VA 1KQ4A 2WAQA 3N0CA 2JA7A 1O24A 3GTLA 1O27A 1XXBA 5CQGA 2JA5A 2JH3A 3GTQA 4C3JC 5EGEA 4J3NA 5JSBB 4LR2A 2JA6A 4Q5GA 1SFOA 3G4AA 3ERED 1WCMA 1LPQA 5IOSA 4G0UA 5CHPA 4DDQA 3V4GA 4KAWX 4GTCA 4KATA 1YNND 4FYDA 3N3YA 2WB1A 4FXDA 3MAQA 1R5ZA 4L8IA 1R49A 1SEUA 3FKIA 3OEPA 1V9MA 2YU9A 4IP9A 4GT9A 4P5AA 1A31A 3K5OA 3LPXA 4G0WA 2RH6A 3GTGA 1TGOA 4KM9A 4BLAA 5JFEA 3LHPS 4KB4A 2CW0D 1I50A 2R92A 1SMYD 2B9SB 1T8IA 1GE9A 1O2BA 1O28A 4AN8A 3LF9A 2E2IA 1EH1A 4GFQA 1WIHA 3Q3QA 4KMHA 4D3YA 1BGWA 3LAPA 3P9AA 1TWHA 3QX3A 4FGUA 3K5MA 1NH3A 1EK8A 4AHCA 2XCQA 3AH5A 2RGRA 2BE5D 1O26A 4C2MA 3FOEA 2NVXA 4GTDA 1A35A 3GTJA 1R9TA 1XXCA 3N0BA 4KASA 4GTBA 4KB2A 3G4CA 3K57A 1AB4A 2B63A 5C9HA 4F3EA 4KARA 5IOTA 2R4GA 1TWAA 4NOLA 2PHCB 4KMAA 5CJ9A 5IOQA 3GTKA 1Y1VA 4GTAA 1ZVUA 1F9NA 4GTLA 4LQYA 2F4QA 1SC7A 2A6ED 1IS1A 1TL8A 1YNJD 5MLC9 3MMLB 3VA7A 4KC6A 1B4AA 1ZXOA 3KYLA 5TJ3A 4IP8A 2CFAB 3WVOA 1HQMD 1TWCA 1XXAA 5EGHA 4M1XA 3FHZA 3CQZA 5JSNB 1RRJA 3OPFA 4D3ZA 3HKZA 1A36A 3K58A 1O2AA 1I3QA 3H0GA 1BJTA 2P5MA 4QCLA 1ZYRD 2O5JD 1RR8C 3FOFA 5JVOA 4KMDA 4BKWA 2A6HD 2NVYA 3SJRA 1ZBSA 2KWAA 3CAGA 1I6VD 4LMOA 2Y3PA 3S0XA 4KM8A 3OREA 4FZBA 2A69D 1K83A 4ILDA 3L4JA 2GSOA 3LAJA 4KDDA 2R93A 1Y1WA 4H3TA 4JLRC 1TWGA 2R7ZA 4OYDB 2E2HA 1IW7D 2CFAA 3K59A 2XCRB 2ZFZA 3DU5A 4P5BA 1Y698 1ISEA 3NUHA 4C3IC 4Q5VA 2GSNA 4EJ3A 3AQPA 1O29A 3BUEA 4NOKA 2XCOA 3AQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JSN B;  3OPF A;  3ERE D;  4G0U A;  1DD5 A;  1EK8 A;  4DDQ A;  2XCQ A;  4FM9 A;  3V4G A;  4KAW X;  2RGR A;  3FOE A;  3LAP A;  1BJT A;  1XXC A;  2P5M A;  1WQH A;  3FOF A;  5JVO A;  4KB2 A;  1WQG A;  1AB4 A;  1WQF A;  4L8I A;  2KWA A;  3CAG A;  3FHZ A;  3L4K A;  2Y3P A;  3OEP A;  1B4B A;  3ORE A;  2PHC B;  5CJ9 A;  3L4J A;  3LAJ A;  2XCO A;  4KDD A;  1ZVU A;  3LPX A;  4G0W A;  4JLR C;  1F9N A;  4G0V A;  4OYD B;  3VA7 A;  2XCR B;  1IS1 A;  3LHP S;  4KB4 A;  5MLC 9;  2ZFZ A;  3MML B;  1XXB A;  4KC6 A;  1GE9 A;  1Y69 8;  1ISE A;  1B4A A;  3NUH A;  1WIH A;  3LF9 A;  1EH1 A;  4GFQ A;  3BUE A;  4J3N A;  1BGW A;  1XXA A;  5JSB B;  3QX3 A; 
#chains in the Genus database with same CATH topology
 3GTJ C;  2NVX C;  3M4O K;  4KMU A;  4NOI A;  4OIQ A;  2B63 C;  3K5N A;  2VUM K;  2Y0S A;  3DU6 A;  3M3Y C;  3GTM K;  2VUM A;  1Q8I A;  2A6E A;  1BS2 A;  1XZQ A;  3GTM A;  5IYC K;  4BY7 K;  1WQF A;  1Y1V C;  3GSI A;  5IOR A;  3IAY A;  4QIW L;  4C3H K;  4YFK A;  2NVX K;  3GTP A;  4C2M K;  4A3K C;  1O24 A;  1TWC C;  3GTQ A;  5M5X K;  4LJZ A;  2E2J K;  1PJ6 A;  3ERE D;  1JVI A;  1LPQ A;  2CW0 A;  4G0U A;  4GTC A;  4A3E C;  1WSV A;  1IW7 A;  1Y1W C;  5HL8 A;  1R9T C;  4X6A K;  2ZUF A;  4GT9 A;  2JA7 C;  3K5O A;  3GTL K;  3T00 A;  1TGO A;  3S17 C;  1YNJ A;  1WSR A;  2NVT C;  1O2B A;  1O28 A;  2GAH C;  1TWF C;  1DCH A;  5C44 C;  3HOZ C;  5C3E K;  4D3Y A;  1BGW A;  2E2H C;  3QX3 A;  4AYB D;  4FGU A;  5M5Y K;  5C4J K;  3RZO C;  1F7V A;  1EK8 A;  4Y52 C;  2FQT A;  2RGR A;  2BE5 D;  4LLG A;  4C2M A;  4ZH4 A;  4KAS A;  2V6S A;  1I3Q K;  1AB4 A;  3S15 K;  4QJV A;  1EFW A;  3GDZ A;  2A68 A;  2PA8 L;  4Y52 K;  4KMA A;  5CJ9 A;  3GTK A;  4GTA A;  4Y7N C;  1G51 A;  1F9N A;  4MEX A;  3HOU K;  3HOW C;  2EBB A;  3FHZ A;  3HOY K;  3OPF A;  5TMF A;  2E2I C;  1O2A A;  1BJT A;  2A6H A;  4QCL A;  2P5M A;  3GTO K;  5JVO A;  4BKW A;  3S1Q K;  1ZBS A;  2KWA A;  3GTK K;  2WB1 D;  2Y3P A;  4FZB A;  4BXX C;  1K83 A;  3JST A;  2D6F C;  3L4J A;  2GSO A;  1ZQ1 C;  2R93 A;  4H3T A;  2R7Z A;  1TWG A;  1YNN A;  1WOS A;  2CFA A;  3K59 A;  1TWG K;  4BBS K;  2WAQ D;  3HOV K;  2YU9 K;  1I50 C;  4EJ3 A;  2GSN A;  3HOU C;  1O29 A;  3BUE A;  3HOW K;  3S14 C;  5EGE A;  3AQO A;  4C2M C;  1JQW A;  4XSZ A;  4XCH A;  4OIO A;  4GTE A;  1J6X A;  1Y1V K;  4MQ9 A;  5IYB K;  1TWH C;  4Y7N K;  1WQG A;  1HI9 A;  3S1M K;  1TWH K;  4AYB A;  3L4K A;  5IYC C;  2PMZ A;  1O25 A;  3RZO K;  1C0A A;  3M4A A;  4BLB A;  3T01 A;  2WAQ A;  2JA7 A;  2JA5 K;  3SZY A;  2JH3 A;  3H3V L;  4A3I K;  1V5V A;  1XPP A;  4A3D K;  1I50 K;  2NVT K;  2WB1 L;  5JSB B;  2JA6 A;  3H0G C;  1SFO A;  5IOS A;  4AYB L;  5CHP A;  4G7Z A;  4DDQ A;  1JOE A;  2GAG C;  4KAT A;  1YNN D;  3N3Y A;  4X6A C;  1TWA C;  2R7Z K;  2WAQ L;  5IP7 K;  1WOO A;  4L8I A;  2R7Z C;  1R49 A;  1R9T K;  1SEU A;  4A3M K;  2R93 C;  4IP9 A;  3GIR A;  4P5A A;  1A31 A;  1TWA K;  3LPX A;  5D4D A;  4GZY A;  4BLA A;  2O5J A;  5L46 A;  2R92 A;  1SMY D;  1GE9 A;  4A3I C;  4AN8 A;  4A3J K;  4GFQ A;  5IP9 K;  1WCM K;  4A3K K;  3LAP A;  1TWH A;  5C4X C;  4AHC A;  3AH5 A;  3K7A C;  3RZD K;  2NVX A;  4WJ3 M;  3S1N C;  3GTJ A;  1R9T A;  4BY7 C;  1XZP A;  4GTB A;  2JA8 K;  3K57 A;  2B63 A;  5C9H A;  4F3E A;  3M3Y K;  2JA8 C;  1WOR A;  4QIW D;  3GEE A;  1IBA A;  2F4Q A;  5C3E C;  3I4N C;  2YU9 C;  4A3B K;  3MML B;  5C4J C;  1B4A A;  1ZXO A;  3ADA C;  3HOZ K;  1WCM C;  4A3F K;  1TWC A;  2PPB A;  4C3I K;  4JK1 A;  4OIN A;  4KN4 A;  3K58 A;  3BP3 A;  4BBR K;  1SMY A;  3GTQ K;  2O5J D;  1RR8 C;  3DXJ A;  3GEI A;  1L0W A;  5IP7 C;  5M3F K;  2NVY A;  3GTK C;  1I6H K;  2W7V A;  3ORE A;  2NVY K;  1Y1W K;  3GTG C;  2E2I K;  4KDD A;  1Y1W A;  4BBR C;  1RU0 A;  2PA8 D;  4OYD B;  2ZFZ A;  4G7H A;  4A3G K;  1Y69 8;  4C3I C;  3NUH A;  1IL2 A;  2E2J C;  4A3B C;  3AQP A;  2JA5 C;  2XCO A;  1YX2 A;  5FJ8 K;  3WOD A;  1X31 C;  4NOM A;  3EQL A;  3FKI C;  4OIP A;  4Q4Z A;  1MIU A;  1K4S A;  1TWF A;  3FKI K;  3GTJ K;  3TFJ A;  3K7A K;  3RZD C;  4A3C C;  5IP9 C;  2PMZ L;  1XZQ B;  3GTL A;  1O27 A;  5CQG A;  2V6U A;  1VGX A;  4LR2 A;  4Q5G A;  4O2D A;  1USO A;  2A69 A;  2NVY C;  4FYD A;  2WB1 A;  3CQZ C;  5TMC A;  1BDF A;  1R5Z A;  3CQZ K;  4A3E K;  3FKI A;  1HQM A;  1VH2 A;  4G0W A;  3H0G K;  2CW0 D;  3A8K A;  3HOY C;  3LF9 A;  2E2I A;  1EH1 A;  4LOW A;  4A93 C;  4KMH A;  3PO3 C;  3HXA A;  2XCQ A;  4A3L C;  3I4N K;  3S15 C;  3FOE A;  1IQ0 A;  3SZZ A;  1A35 A;  3S1M C;  2V6T A;  3AD8 C;  3AD9 C;  4KB2 A;  3G4C A;  4Q5S A;  4LK0 A;  3HOX K;  4YG2 A;  4NOL A;  2PHC B;  4A3L K;  1ZVU A;  5C4X K;  4LQY A;  4BY1 C;  3AD7 C;  1IS1 A;  3BP8 C;  4KC6 A;  5TJ3 A;  2E2H K;  4IP8 A;  4A93 K;  3GTP K;  1HQM D;  5E68 A;  3CQZ A;  4RMF A;  4D3Z A;  3HKZ A;  1A36 A;  5IYD C;  4XLP A;  2JA7 K;  3GEH A;  1I6H C;  1I3Q A;  3H0G A;  2FQO A;  2JA6 C;  1SFO C;  3GTG K;  4KN7 A;  3FOF A;  1PJ5 A;  4KMD A;  4A3M C;  2JA6 K;  3CAG A;  4LMO A;  3S0X A;  4KM8 A;  3S2D C;  2A69 D;  1PJ7 A;  4P9S A;  3LAJ A;  5IYD K;  4YFX A;  4A3F C;  3GTP C;  2E2H A;  2XCR B;  4C3J K;  1J6W A;  3DU5 A;  4P5B A;  1ISE A;  4Q5V A;  2ZUE A;  2R92 C;  3S16 K;  1F93 A;  3G4A A;  1WOP A;  4NOK A;  1DD5 A;  4MEY A;  4C3H C;  4FM9 A;  2A68 D;  3GTO A;  3K5L A;  3IPJ A;  1K4T A;  4QIW A;  1WQH A;  3A8J A;  2PMZ D;  4G7O A;  1XZP B;  1VJE A;  3S1N K;  4O26 A;  2GSU A;  1I3Q C;  2BE5 A;  1B4B A;  1EJ9 A;  4GTF A;  1VLO A;  3PO3 K;  5IYB C;  4G0V A;  1KQ4 A;  3N0C A;  4XSX A;  3S16 C;  3S1R K;  1K83 C;  1XXB A;  2JA5 A;  2Y0S D;  3S14 K;  4C3J C;  1TWG C;  4BBS C;  3I4M C;  2R92 K;  4WIL A;  5C44 K;  4J3N A;  4PAB A;  3PO2 C;  1I6V A;  1WCM A;  3V4G A;  4PAA A;  4KAW X;  3S2D K;  2R93 K;  3TFH A;  4LK1 A;  4FXD A;  4BXX K;  3MAQ A;  3OEP A;  3S1Q C;  1USM A;  1V9M A;  2YU9 A;  1YCL A;  4OIR A;  2RH6 A;  1VRQ C;  3GTG A;  4KM9 A;  1ZYR A;  5JFE A;  3LHP S;  4KB4 A;  1I50 A;  2B9S B;  1T8I A;  3A8I A;  1J6V A;  1WIH A;  3T02 A;  1K83 K;  3Q3Q A;  3I4M K;  4A3C K;  3P9A A;  3K5M A;  1NH3 A;  5M5W K;  1EQR A;  3S1R C;  1TWC K;  3S2H C;  2O5I A;  4BY1 K;  1O26 A;  1INN A;  3HOX C;  4AH6 A;  4GTD A;  3N0B A;  1XXC A;  3TTG A;  5IOT A;  4KAR A;  2R4G A;  1TWA A;  3H3V D;  2B63 K;  2VUM C;  3S2H K;  4QJV B;  5IOQ A;  1Y1V A;  3GTM C;  1EI6 A;  4GTL A;  2P8T A;  1SC7 A;  2A6E D;  1TL8 A;  3VA7 A;  1YNJ D;  5MLC 9;  3M4O C;  1UV7 A;  4A3J C;  3KYL A;  4A3G C;  5FLM K;  2CFA B;  3HOV C;  3WVO A;  1DCO A;  1XXA A;  5EGH A;  4M1X A;  1TWF K;  5M3M K;  3GTL C;  5JSN B;  1RRJ A;  1J98 A;  3TFI A;  4YFN A;  3S17 K;  2NVQ C;  1ZYR D;  4C45 A;  3GTO C;  3HKZ L;  2A6H D;  4XLN A;  1SFO K;  3SJR A;  1I6V D;  4ILD A;  2Y0S L;  1DCP A;  3GTQ C;  1F7U A;  3PO2 K;  4JLR C;  2NVQ K;  1IW7 D;  4WJ4 A;  1O2F B;  5FLM C;  3HKZ D;  4A3D C;  1IE0 A; 
#chains in the Genus database with same CATH homology
 4C2M C;  1DD5 A;  4C3H C;  4FM9 A;  2A68 D;  3K5N A;  3GTO A;  2Y0S A;  4NOM A;  3DU6 A;  4GTE A;  3K5L A;  1K4T A;  2VUM A;  4QIW A;  1Q8I A;  1WQH A;  1WQG A;  3GTM A;  1WQF A;  4O26 A;  2GSU A;  4AYB A;  3L4K A;  1B4B A;  2PMZ A;  1EJ9 A;  5IOR A;  1MIU A;  3IAY A;  4GTF A;  1K4S A;  1O25 A;  3GTP A;  1TWF A;  3M4A A;  4BLB A;  4G0V A;  1KQ4 A;  2WAQ A;  3N0C A;  2JA7 A;  1O24 A;  3GTL A;  1O27 A;  1XXB A;  5CQG A;  2JA5 A;  2JH3 A;  3GTQ A;  4C3J C;  5EGE A;  4J3N A;  5JSB B;  4LR2 A;  2JA6 A;  4Q5G A;  1SFO A;  3G4A A;  3ERE D;  1WCM A;  1LPQ A;  5IOS A;  4G0U A;  5CHP A;  4DDQ A;  3V4G A;  4KAW X;  4GTC A;  4KAT A;  1YNN D;  4FYD A;  3N3Y A;  2WB1 A;  4FXD A;  3MAQ A;  1R5Z A;  4L8I A;  1R49 A;  1SEU A;  3FKI A;  3OEP A;  1V9M A;  2YU9 A;  4IP9 A;  4GT9 A;  4P5A A;  1A31 A;  3K5O A;  3LPX A;  4G0W A;  2RH6 A;  3GTG A;  1TGO A;  4KM9 A;  4BLA A;  5JFE A;  3LHP S;  4KB4 A;  2CW0 D;  1I50 A;  2R92 A;  1SMY D;  2B9S B;  1T8I A;  1GE9 A;  1O2B A;  1O28 A;  4AN8 A;  3LF9 A;  2E2I A;  1EH1 A;  4GFQ A;  1WIH A;  3Q3Q A;  4KMH A;  4D3Y A;  1BGW A;  3LAP A;  3P9A A;  1TWH A;  3QX3 A;  4FGU A;  3K5M A;  1NH3 A;  1EK8 A;  4AHC A;  2XCQ A;  3AH5 A;  2RGR A;  2BE5 D;  1O26 A;  4C2M A;  3FOE A;  2NVX A;  4GTD A;  1A35 A;  3GTJ A;  1R9T A;  1XXC A;  3N0B A;  4KAS A;  4GTB A;  4KB2 A;  3G4C A;  3K57 A;  1AB4 A;  2B63 A;  5C9H A;  4F3E A;  4KAR A;  5IOT A;  2R4G A;  1TWA A;  4NOL A;  2PHC B;  4KMA A;  5CJ9 A;  5IOQ A;  3GTK A;  1Y1V A;  4GTA A;  1ZVU A;  1F9N A;  4GTL A;  4LQY A;  2F4Q A;  1SC7 A;  2A6E D;  1IS1 A;  1TL8 A;  1YNJ D;  5MLC 9;  3MML B;  3VA7 A;  4KC6 A;  1B4A A;  1ZXO A;  3KYL A;  5TJ3 A;  4IP8 A;  2CFA B;  3WVO A;  1HQM D;  1TWC A;  1XXA A;  5EGH A;  4M1X A;  3FHZ A;  3CQZ A;  5JSN B;  1RRJ A;  3OPF A;  4D3Z A;  3HKZ A;  1A36 A;  3K58 A;  1O2A A;  1I3Q A;  3H0G A;  1BJT A;  2P5M A;  4QCL A;  1ZYR D;  2O5J D;  1RR8 C;  3FOF A;  5JVO A;  4KMD A;  4BKW A;  2A6H D;  2NVY A;  3SJR A;  1ZBS A;  2KWA A;  3CAG A;  1I6V D;  4LMO A;  2Y3P A;  3S0X A;  4KM8 A;  3ORE A;  4FZB A;  2A69 D;  1K83 A;  4ILD A;  3L4J A;  2GSO A;  3LAJ A;  4KDD A;  2R93 A;  1Y1W A;  4H3T A;  4JLR C;  1TWG A;  2R7Z A;  4OYD B;  2E2H A;  1IW7 D;  2CFA A;  3K59 A;  2XCR B;  2ZFZ A;  3DU5 A;  4P5B A;  1Y69 8;  1ISE A;  3NUH A;  4C3I C;  4Q5V A;  2GSN A;  4EJ3 A;  3AQP A;  1O29 A;  3BUE A;  4NOK A;  2XCO A;  3AQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...