4KC6A

Crystal structure of c-terminal deletion mutant of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 61
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kc6A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kc6A02
4L8IA 3L4JA 4G0WA 5JVOA 2RGRA 3LAPA 1B4AA 2KWAA 3VA7A 5CJ9A 2XCOA 3LPXA 2ZFZA 1AB4A 1WQFA 1ISEA 3OPFA 3CAGA 3OEPA 3LF9A 4GFQA 4JLRC 3ERED 3FHZA 4KC6A 4FM9A 3FOFA 4KAWX 1EH1A 1GE9A 1F9NA 1IS1A 1B4BA 1XXCA 5JSNB 4OYDB 1BJTA 1ZVUA 1WIHA 2P5MA 4DDQA 3FOEA 1DD5A 1WQHA 5JSBB 1BGWA 1XXBA 3BUEA 3NUHA 4G0VA 1WQGA 3L4KA 3LHPS 4KB4A 3V4GA 3LAJA 4J3NA 1EK8A 1Y698 3QX3A 2PHCB 1XXAA 2XCQA 2Y3PA 2XCRB 4G0UA 4KDDA 4KB2A 3OREA 3MMLB 5MLC9
chains in the Genus database with same CATH superfamily
5JVOA 2JA6C 1WCMA 2R93A 5E68A 1K4SA 3GTJK 2EBBA 1HQMA 1VH2A 3K58A 3HOXK 3FHZA 3HXAA 2JA6K 1ZQ1C 3ADAC 1GE9A 2WB1D 2FQOA 4KMUA 1I6VD 1USOA 1I6HC 1DCPA 1IBAA 4D3ZA 1IQ0A 1VGXA 3FKIC 3GIRA 2XCRB 2W7VA 4A3CC 3GTLC 1SFOA 1SC7A 3GTQA 5D4DA 1I6HK 3BP3A 1EJ9A 3Q3QA 4C3JC 1VLOA 2A69A 3FKIK 3SZZA 1R49A 1WOOA 4LK0A 3OPFA 1Y1VC 4A3CK 4KARA 3ERED 1F7VA 1JVIA 3GTLK 4A3BC 3S17C 5IYDC 4C3JK 1O28A 3JSTA 1Y1WC 4DDQA 1IW7D 1Y1VK 2B9SB 3GTPC 4A3BK 3K5NA 1K83A 2YU9C 5IYDK 2PHCB 1XXAA 1YNJD 3GTPK 1O2AA 2CW0D 2YU9K 2BE5D 3EQLA 3MAQA 4BBRC 4C45A 5L46A 2NVYA 5C9HA 3CAGA 5CHPA 4A3EK 4QJVB 2JA5C 3CQZC 3GSIA 1J98A 4YG2A 1EH1A 4GTDA 4BBRK 4NOIA 2P8TA 5IYCC 3GTJA 4Q5SA 4XSZA 4QCLA 4G0VA 2JA5K 4G7HA 1TL8A 1RR8C 2D6FC 2JA6A 3CQZK 5C44C 4A3DK 1SEUA 4A3IC 3RZDC 5IYCK 3GTOK 5IYBC 3WODA 4Y52C 5FJ8K 4C2MC 3AD7C 4GTEA 4A3IK 4WILA 3RZDK 4Y52K 2A6HD 2NVTC 4C2MK 4OINA 3FKIA 1BDFA 3HKZD 2WAQD 4AYBL 3GEEA 3GTLA 3K5MA 3K57A 1HI9A 2Y0SD 3S15C 1SMYD 2NVTK 3AD9C 1YNND 1Y1VA 1B4AA 4NOLA 2WB1A 4A3KC 3S15K 2FQTA 2A68A 1ISEA 3OEPA 2V6TA 1KQ4A 3S14C 1Y1WA 3AQOA 4BLAA 4FM9A 3GTPA 2R4GA 3DU6A 5IP7C 5JSNB 2YU9A 3H3VL 4A3KK 4WJ3M 1TWFK 3S1NC 4Y7NC 3S14K 5EGHA 3N0CA 1DCHA 4MEYA 2VUMC 4NOMA 2CFAA 4G7OA 5C4XC 3S1NK 4WJ4A 1XPPA 4Y7NK 3G4CA 2E2JK 2V6SA 3AD8C 1F7UA 2JA5A 3GTGC 4KMAA 1AB4A 3CQZA 3K7AC 5M5YK 2VUMK 1IE0A 4LOWA 3LF9A 1EFWA 5C4XK 1USMA 1MIUA 1A31A 1WSRA 4LK1A 4YFKA 1IS1A 2V6UA 3GTGK 3HOWC 3HOVC 1O27A 3K7AK 3KYLA 5M3FK 4AN8A 1WQGA 1WOPA 1TGOA 2GSOA 4AYBA 2R92C 3HOWK 3HOVK 4LJZA 5JFEA 2PMZL 4L8IA 4C2MA 2O5JD 4EJ3A 2O5IA 3S1MC 2KWAA 1PJ6A 4M1XA 4ZH4A 4G7ZA 3GTMC 3PO3C 2R92K 4FXDA 5C4JC 3SJRA 3S1MK 3N0BA 3G4AA 1TWGC 3P9AA 1PJ5A 3I4MC 2NVXC 3FOEA 4D3YA 3GTMK 3PO3K 1BGWA 3M4OC 4GTLA 5C4JK 4P5AA 1EK8A 3A8IA 2R7ZC 4F3EA 4KATA 1XZPA 2ZUFA 1TWGK 4OIOA 3I4MK 4A3EC 2NVXK 5IORA 3L4JA 2WB1L 3M4OK 2RH6A 4LMOA 3AQPA 2R7ZK 4A3JC 4C3HK 2GSNA 3HKZA 3GEHA 2JH3A 4KAWX 1ZYRA 2Y0SA 4A3DC 1WIHA 4A3JK 1WQHA 2VUMA 3NUHA 3GTOC 3V4GA 4NOKA 4FGUA 5EGEA 3GTKC 3GTGA 4H3TA 4G0WA 1T8IA 1G51A 1O2FB 2PMZA 1VRQC 2ZFZA 4Q4ZA 4BY1C 3GTKK 1ZXOA 2PA8D 4O26A 1YX2A 1O24A 2A69D 3HOZC 5C3EC 3WVOA 4P5BA 1B4BA 4XSXA 3GEIA 2P5MA 4BY1K 1PJ7A 2R92A 2A6ED 4YFXA 3QX3A 3HOZK 5C3EK 1XZQA 4G0UA 1Q8IA 2B63C 3DU5A 4QIWD 3GTMA 5M5WK 1O29A 4BBSC 5CJ9A 5IP9C 4P9SA 1TWAC 3LPXA 1J6VA 4X6AC 1J6WA 1JQWA 1TWFC 2B63K 5HL8A 1TWGA 2NVXA 1I6VA 3T00A 5M5XK 1IL2A 4BBSK 1O2BA 5IP9K 3GTQK 1TWAK 2R7ZA 1BJTA 3IPJA 4GTCA 4X6AK 2E2JC 1R5ZA 4J3NA 4GTAA 3S1QC 4O2DA 4Q5GA 1V9MA 3OREA 5MLC9 3K5LA 3M4AA 4A3FC 3HOUK 1RU0A 1L0WA 3S1QK 3HKZL 2WAQL 2F4QA 1TWCC 4GTBA 1IW7A 2Y0SL 4A3FK 3IAYA 3GTOA 1O25A 4GT9A 1F9NA 1YCLA 4A3GK 1YNJA 4YFNA 5JSBB 1XXBA 1LPQA 3GTKA 1TWCK 3A8JA 4OIQA 3RZOC 2CFAB 4PABA 2CW0A 1EQRA 2BE5A 5IOSA 4XLPA 1WORA 3LAPA 2GAHC 2JA7C 1UV7A 1I3QC 2JA8C 3RZOK 1WQFA 5IOQA 5FLMC 4JLRC 4A3MC 4KC6A 2JA7K 1ZBSA 2A68D 1XXCA 1I3QK 4IP8A 4FZBA 2JA8K 4OYDB 4ILDA 3AH5A 4BKWA 5FLMK 2B63A 4A3MK 2Y3PA 4KM9A 2XCQA 1EI6A 3BP8C 4A3LC 4C3HC 1R9TC 1TWAA 3T02A 1TWFA 1I50C 1INNA 3TTGA 2A6HA 1VJEA 4A3LK 4GFQA 1R9TK 3A8KA 3TFJA 2PPBA 2WAQA 1J6XA 2A6EA 3S16C 5TMFA 4QJVA 4BXXC 4C3IC 1HQMD 1I50K 4Q5VA 1SMYA 3T01A 4QIWA 1TWHC 4AH6A 3L4KA 4KB4A 3S17K 1XZPB 3S2HC 1YNNA 2E2HC 4KMHA 3S16K 4OIRA 1V5VA 4BXXK 3GDZA 1Y1WK 2E2IC 4C3IK 3MMLB 4XLNA 2RGRA 1X31C 4GZYA 4RMFA 1C0AA 1TWCA 1TWHK 3H0GC 4MEXA 4PAAA 4AYBD 3S2HK 1DCOA 2E2HK 4A93C 4KM8A 1NH3A 3M3YC 4IP9A 4LQYA 2E2IK 1WCMC 2R93C 5TMCA 3S2DC 3H0GK 4FYDA 3DXJA 4A93K 3I4NC 3M3YK 3N3YA 4KMDA 1DD5A 1K4TA 1WCMK 3BUEA 2R93K 2GSUA 3S2DK 1WOSA 1Y698 2ZUEA 2JA7A 1O26A 5IOTA 4GTFA 4KDDA 4KB2A 1F93A 3I4NK 1RRJA 1I3QA 3TFHA 4OIPA 3H3VD 4BLBA 4LLGA 3K5OA 4KN4A 3VA7A 5C44K 2XCOA 1JOEA 1SFOC 3GTQC 4BY7C 5IYBK 4JK1A 3FOFA 3TFIA 4MQ9A 1SFOK 2GAGC 2NVQC 4BY7K 1R9TA 1XZQB 3LAJA 3HOUC 2O5JA 1ZYRD 5CQGA 2PA8L 4KASA 1I50A 1K83C 3PO2C 3S0XA 4AHCA 2NVQK 3S1RC 3HOYC 4LR2A 1A36A 1WSVA 4A3GC 1A35A 1K83K 3PO2K 2PMZD 2NVYC 1BS2A 3S1RK 1TWHA 3K59A 4KN7A 4QIWL 3HOYK 2E2HA 1ZVUA 5M3MK 4XCHA 2E2IA 3LHPS 3SZYA 2NVYK 5IP7K 3GTJC 5TJ3A 3H0GA 3HOXC
chains in the Genus database with same CATH topology
4G0WA 5JVOA 1YNND 1T8IA 1TWFA 1WCMA 1Y1VA 2R93A 1B4AA 4NOLA 2PMZA 2WB1A 1K4SA 2ZFZA 1TWAA 1ISEA 3OEPA 3K58A 1ZXOA 4GFQA 1KQ4A 4O26A 1Y1WA 3FHZA 3AQOA 4BLAA 2WAQA 4FM9A 1O24A 2A69D 3GTPA 3WVOA 2R4GA 1GE9A 4P5BA 3DU6A 1B4BA 5JSNB 2YU9A 4C3IC 1HQMD 4Q5VA 2P5MA 1I6VD 4QIWA 2R92A 3L4KA 4KB4A 4D3ZA 5EGHA 2A6ED 3N0CA 3QX3A 4KMHA 2XCRB 4G0UA 1Q8IA 4NOMA 3MMLB 2CFAA 1SFOA 3DU5A 1SC7A 3GTQA 3GTMA 2RGRA 3G4CA 1TWCA 1EJ9A 1O29A 3Q3QA 4C3JC 2JA5A 5CJ9A 4KMAA 3LPXA 4KM8A 1NH3A 1AB4A 3CQZA 1R49A 4IP9A 4LQYA 3OPFA 3LF9A 4KARA 1TWGA 3ERED 5IOTA 2NVXA 1MIUA 1A31A 4FYDA 1O2BA 1IS1A 1O28A 2R7ZA 1BJTA 1O27A 3N3YA 4GTCA 4KMDA 3KYLA 1DD5A 4DDQA 1IW7D 4AN8A 1K4TA 2B9SB 3BUEA 1WQGA 2GSUA 1R5ZA 3K5NA 1K83A 4J3NA 1Y698 4GTAA 2PHCB 1XXAA 1TGOA 2GSOA 2JA7A 4AYBA 1O26A 1YNJD 4KDDA 4KB2A 4GTFA 4Q5GA 1V9MA 3OREA 1RRJA 1I3QA 5MLC9 3K5LA 5JFEA 4L8IA 4C2MA 2O5JD 4EJ3A 3M4AA 4BLBA 1O2AA 3K5OA 2KWAA 3VA7A 2CW0D 2BE5D 2XCOA 4M1XA 3MAQA 2NVYA 5C9HA 2F4QA 3CAGA 5CHPA 4FXDA 4GTBA 3SJRA 3IAYA 3N0BA 3FOFA 3GTOA 1EH1A 1O25A 1F9NA 3G4AA 4GTDA 4GT9A 3P9AA 3FOEA 4D3YA 3GTJA 5JSBB 1BGWA 1XXBA 1LPQA 3GTKA 4QCLA 4G0VA 4GTLA 1R9TA 1TL8A 4P5AA 3LAJA 1RR8C 1ZYRD 1EK8A 2JA6A 4F3EA 2CFAB 5CQGA 4KASA 1SEUA 4KATA 5IOSA 1I50A 5IORA 3L4JA 3S0XA 3LAPA 4AHCA 2RH6A 4LMOA 3AQPA 4LR2A 1WQFA 4C2MC 5IOQA 4GTEA 1A36A 2GSNA 3HKZA 4JLRC 1A35A 4KC6A 2JH3A 4KAWX 1ZBSA 1TWHA 3K59A 2A68D 2Y0SA 2A6HD 1XXCA 4IP8A 4FZBA 2E2HA 4OYDB 4ILDA 1ZVUA 3FKIA 1WIHA 3AH5A 4BKWA 1WQHA 2VUMA 3NUHA 2E2IA 2B63A 3LHPS 3GTLA 3V4GA 4NOKA 3K5MA 4FGUA 3K57A 2Y3PA 4KM9A 2XCQA 5TJ3A 3H0GA 1SMYD 5EGEA 3GTGA 4C3HC 4H3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8I A;  3L4J A;  4G0W A;  5JVO A;  2RGR A;  3LAP A;  1B4A A;  2KWA A;  3VA7 A;  5CJ9 A;  2XCO A;  3LPX A;  2ZFZ A;  1AB4 A;  1WQF A;  1ISE A;  3OPF A;  3CAG A;  3OEP A;  3LF9 A;  4GFQ A;  4JLR C;  3ERE D;  3FHZ A;  4KC6 A;  4FM9 A;  3FOF A;  4KAW X;  1EH1 A;  1GE9 A;  1F9N A;  1IS1 A;  1B4B A;  1XXC A;  5JSN B;  4OYD B;  1BJT A;  1ZVU A;  1WIH A;  2P5M A;  4DDQ A;  3FOE A;  1DD5 A;  1WQH A;  5JSB B;  1BGW A;  1XXB A;  3BUE A;  3NUH A;  4G0V A;  1WQG A;  3L4K A;  3LHP S;  4KB4 A;  3V4G A;  3LAJ A;  4J3N A;  1EK8 A;  1Y69 8;  3QX3 A;  2PHC B;  1XXA A;  2XCQ A;  2Y3P A;  2XCR B;  4G0U A;  4KDD A;  4KB2 A;  3ORE A;  3MML B;  5MLC 9; 
#chains in the Genus database with same CATH topology
 5JVO A;  2JA6 C;  1WCM A;  2R93 A;  5E68 A;  1K4S A;  3GTJ K;  2EBB A;  1HQM A;  1VH2 A;  3K58 A;  3HOX K;  3FHZ A;  3HXA A;  2JA6 K;  1ZQ1 C;  3ADA C;  1GE9 A;  2WB1 D;  2FQO A;  4KMU A;  1I6V D;  1USO A;  1I6H C;  1DCP A;  1IBA A;  4D3Z A;  1IQ0 A;  1VGX A;  3FKI C;  3GIR A;  2XCR B;  2W7V A;  4A3C C;  3GTL C;  1SFO A;  1SC7 A;  3GTQ A;  5D4D A;  1I6H K;  3BP3 A;  1EJ9 A;  3Q3Q A;  4C3J C;  1VLO A;  2A69 A;  3FKI K;  3SZZ A;  1R49 A;  1WOO A;  4LK0 A;  3OPF A;  1Y1V C;  4A3C K;  4KAR A;  3ERE D;  1F7V A;  1JVI A;  3GTL K;  4A3B C;  3S17 C;  5IYD C;  4C3J K;  1O28 A;  3JST A;  1Y1W C;  4DDQ A;  1IW7 D;  1Y1V K;  2B9S B;  3GTP C;  4A3B K;  3K5N A;  1K83 A;  2YU9 C;  5IYD K;  2PHC B;  1XXA A;  1YNJ D;  3GTP K;  1O2A A;  2CW0 D;  2YU9 K;  2BE5 D;  3EQL A;  3MAQ A;  4BBR C;  4C45 A;  5L46 A;  2NVY A;  5C9H A;  3CAG A;  5CHP A;  4A3E K;  4QJV B;  2JA5 C;  3CQZ C;  3GSI A;  1J98 A;  4YG2 A;  1EH1 A;  4GTD A;  4BBR K;  4NOI A;  2P8T A;  5IYC C;  3GTJ A;  4Q5S A;  4XSZ A;  4QCL A;  4G0V A;  2JA5 K;  4G7H A;  1TL8 A;  1RR8 C;  2D6F C;  2JA6 A;  3CQZ K;  5C44 C;  4A3D K;  1SEU A;  4A3I C;  3RZD C;  5IYC K;  3GTO K;  5IYB C;  3WOD A;  4Y52 C;  5FJ8 K;  4C2M C;  3AD7 C;  4GTE A;  4A3I K;  4WIL A;  3RZD K;  4Y52 K;  2A6H D;  2NVT C;  4C2M K;  4OIN A;  3FKI A;  1BDF A;  3HKZ D;  2WAQ D;  4AYB L;  3GEE A;  3GTL A;  3K5M A;  3K57 A;  1HI9 A;  2Y0S D;  3S15 C;  1SMY D;  2NVT K;  3AD9 C;  1YNN D;  1Y1V A;  1B4A A;  4NOL A;  2WB1 A;  4A3K C;  3S15 K;  2FQT A;  2A68 A;  1ISE A;  3OEP A;  2V6T A;  1KQ4 A;  3S14 C;  1Y1W A;  3AQO A;  4BLA A;  4FM9 A;  3GTP A;  2R4G A;  3DU6 A;  5IP7 C;  5JSN B;  2YU9 A;  3H3V L;  4A3K K;  4WJ3 M;  1TWF K;  3S1N C;  4Y7N C;  3S14 K;  5EGH A;  3N0C A;  1DCH A;  4MEY A;  2VUM C;  4NOM A;  2CFA A;  4G7O A;  5C4X C;  3S1N K;  4WJ4 A;  1XPP A;  4Y7N K;  3G4C A;  2E2J K;  2V6S A;  3AD8 C;  1F7U A;  2JA5 A;  3GTG C;  4KMA A;  1AB4 A;  3CQZ A;  3K7A C;  5M5Y K;  2VUM K;  1IE0 A;  4LOW A;  3LF9 A;  1EFW A;  5C4X K;  1USM A;  1MIU A;  1A31 A;  1WSR A;  4LK1 A;  4YFK A;  1IS1 A;  2V6U A;  3GTG K;  3HOW C;  3HOV C;  1O27 A;  3K7A K;  3KYL A;  5M3F K;  4AN8 A;  1WQG A;  1WOP A;  1TGO A;  2GSO A;  4AYB A;  2R92 C;  3HOW K;  3HOV K;  4LJZ A;  5JFE A;  2PMZ L;  4L8I A;  4C2M A;  2O5J D;  4EJ3 A;  2O5I A;  3S1M C;  2KWA A;  1PJ6 A;  4M1X A;  4ZH4 A;  4G7Z A;  3GTM C;  3PO3 C;  2R92 K;  4FXD A;  5C4J C;  3SJR A;  3S1M K;  3N0B A;  3G4A A;  1TWG C;  3P9A A;  1PJ5 A;  3I4M C;  2NVX C;  3FOE A;  4D3Y A;  3GTM K;  3PO3 K;  1BGW A;  3M4O C;  4GTL A;  5C4J K;  4P5A A;  1EK8 A;  3A8I A;  2R7Z C;  4F3E A;  4KAT A;  1XZP A;  2ZUF A;  1TWG K;  4OIO A;  3I4M K;  4A3E C;  2NVX K;  5IOR A;  3L4J A;  2WB1 L;  3M4O K;  2RH6 A;  4LMO A;  3AQP A;  2R7Z K;  4A3J C;  4C3H K;  2GSN A;  3HKZ A;  3GEH A;  2JH3 A;  4KAW X;  1ZYR A;  2Y0S A;  4A3D C;  1WIH A;  4A3J K;  1WQH A;  2VUM A;  3NUH A;  3GTO C;  3V4G A;  4NOK A;  4FGU A;  5EGE A;  3GTK C;  3GTG A;  4H3T A;  4G0W A;  1T8I A;  1G51 A;  1O2F B;  2PMZ A;  1VRQ C;  2ZFZ A;  4Q4Z A;  4BY1 C;  3GTK K;  1ZXO A;  2PA8 D;  4O26 A;  1YX2 A;  1O24 A;  2A69 D;  3HOZ C;  5C3E C;  3WVO A;  4P5B A;  1B4B A;  4XSX A;  3GEI A;  2P5M A;  4BY1 K;  1PJ7 A;  2R92 A;  2A6E D;  4YFX A;  3QX3 A;  3HOZ K;  5C3E K;  1XZQ A;  4G0U A;  1Q8I A;  2B63 C;  3DU5 A;  4QIW D;  3GTM A;  5M5W K;  1O29 A;  4BBS C;  5CJ9 A;  5IP9 C;  4P9S A;  1TWA C;  3LPX A;  1J6V A;  4X6A C;  1J6W A;  1JQW A;  1TWF C;  2B63 K;  5HL8 A;  1TWG A;  2NVX A;  1I6V A;  3T00 A;  5M5X K;  1IL2 A;  4BBS K;  1O2B A;  5IP9 K;  3GTQ K;  1TWA K;  2R7Z A;  1BJT A;  3IPJ A;  4GTC A;  4X6A K;  2E2J C;  1R5Z A;  4J3N A;  4GTA A;  3S1Q C;  4O2D A;  4Q5G A;  1V9M A;  3ORE A;  5MLC 9;  3K5L A;  3M4A A;  4A3F C;  3HOU K;  1RU0 A;  1L0W A;  3S1Q K;  3HKZ L;  2WAQ L;  2F4Q A;  1TWC C;  4GTB A;  1IW7 A;  2Y0S L;  4A3F K;  3IAY A;  3GTO A;  1O25 A;  4GT9 A;  1F9N A;  1YCL A;  4A3G K;  1YNJ A;  4YFN A;  5JSB B;  1XXB A;  1LPQ A;  3GTK A;  1TWC K;  3A8J A;  4OIQ A;  3RZO C;  2CFA B;  4PAB A;  2CW0 A;  1EQR A;  2BE5 A;  5IOS A;  4XLP A;  1WOR A;  3LAP A;  2GAH C;  2JA7 C;  1UV7 A;  1I3Q C;  2JA8 C;  3RZO K;  1WQF A;  5IOQ A;  5FLM C;  4JLR C;  4A3M C;  4KC6 A;  2JA7 K;  1ZBS A;  2A68 D;  1XXC A;  1I3Q K;  4IP8 A;  4FZB A;  2JA8 K;  4OYD B;  4ILD A;  3AH5 A;  4BKW A;  5FLM K;  2B63 A;  4A3M K;  2Y3P A;  4KM9 A;  2XCQ A;  1EI6 A;  3BP8 C;  4A3L C;  4C3H C;  1R9T C;  1TWA A;  3T02 A;  1TWF A;  1I50 C;  1INN A;  3TTG A;  2A6H A;  1VJE A;  4A3L K;  4GFQ A;  1R9T K;  3A8K A;  3TFJ A;  2PPB A;  2WAQ A;  1J6X A;  2A6E A;  3S16 C;  5TMF A;  4QJV A;  4BXX C;  4C3I C;  1HQM D;  1I50 K;  4Q5V A;  1SMY A;  3T01 A;  4QIW A;  1TWH C;  4AH6 A;  3L4K A;  4KB4 A;  3S17 K;  1XZP B;  3S2H C;  1YNN A;  2E2H C;  4KMH A;  3S16 K;  4OIR A;  1V5V A;  4BXX K;  3GDZ A;  1Y1W K;  2E2I C;  4C3I K;  3MML B;  4XLN A;  2RGR A;  1X31 C;  4GZY A;  4RMF A;  1C0A A;  1TWC A;  1TWH K;  3H0G C;  4MEX A;  4PAA A;  4AYB D;  3S2H K;  1DCO A;  2E2H K;  4A93 C;  4KM8 A;  1NH3 A;  3M3Y C;  4IP9 A;  4LQY A;  2E2I K;  1WCM C;  2R93 C;  5TMC A;  3S2D C;  3H0G K;  4FYD A;  3DXJ A;  4A93 K;  3I4N C;  3M3Y K;  3N3Y A;  4KMD A;  1DD5 A;  1K4T A;  1WCM K;  3BUE A;  2R93 K;  2GSU A;  3S2D K;  1WOS A;  1Y69 8;  2ZUE A;  2JA7 A;  1O26 A;  5IOT A;  4GTF A;  4KDD A;  4KB2 A;  1F93 A;  3I4N K;  1RRJ A;  1I3Q A;  3TFH A;  4OIP A;  3H3V D;  4BLB A;  4LLG A;  3K5O A;  4KN4 A;  3VA7 A;  5C44 K;  2XCO A;  1JOE A;  1SFO C;  3GTQ C;  4BY7 C;  5IYB K;  4JK1 A;  3FOF A;  3TFI A;  4MQ9 A;  1SFO K;  2GAG C;  2NVQ C;  4BY7 K;  1R9T A;  1XZQ B;  3LAJ A;  3HOU C;  2O5J A;  1ZYR D;  5CQG A;  2PA8 L;  4KAS A;  1I50 A;  1K83 C;  3PO2 C;  3S0X A;  4AHC A;  2NVQ K;  3S1R C;  3HOY C;  4LR2 A;  1A36 A;  1WSV A;  4A3G C;  1A35 A;  1K83 K;  3PO2 K;  2PMZ D;  2NVY C;  1BS2 A;  3S1R K;  1TWH A;  3K59 A;  4KN7 A;  4QIW L;  3HOY K;  2E2H A;  1ZVU A;  5M3M K;  4XCH A;  2E2I A;  3LHP S;  3SZY A;  2NVY K;  5IP7 K;  3GTJ C;  5TJ3 A;  3H0G A;  3HOX C; 
#chains in the Genus database with same CATH homology
 4G0W A;  5JVO A;  1YNN D;  1T8I A;  1TWF A;  1WCM A;  1Y1V A;  2R93 A;  1B4A A;  4NOL A;  2PMZ A;  2WB1 A;  1K4S A;  2ZFZ A;  1TWA A;  1ISE A;  3OEP A;  3K58 A;  1ZXO A;  4GFQ A;  1KQ4 A;  4O26 A;  1Y1W A;  3FHZ A;  3AQO A;  4BLA A;  2WAQ A;  4FM9 A;  1O24 A;  2A69 D;  3GTP A;  3WVO A;  2R4G A;  1GE9 A;  4P5B A;  3DU6 A;  1B4B A;  5JSN B;  2YU9 A;  4C3I C;  1HQM D;  4Q5V A;  2P5M A;  1I6V D;  4QIW A;  2R92 A;  3L4K A;  4KB4 A;  4D3Z A;  5EGH A;  2A6E D;  3N0C A;  3QX3 A;  4KMH A;  2XCR B;  4G0U A;  1Q8I A;  4NOM A;  3MML B;  2CFA A;  1SFO A;  3DU5 A;  1SC7 A;  3GTQ A;  3GTM A;  2RGR A;  3G4C A;  1TWC A;  1EJ9 A;  1O29 A;  3Q3Q A;  4C3J C;  2JA5 A;  5CJ9 A;  4KMA A;  3LPX A;  4KM8 A;  1NH3 A;  1AB4 A;  3CQZ A;  1R49 A;  4IP9 A;  4LQY A;  3OPF A;  3LF9 A;  4KAR A;  1TWG A;  3ERE D;  5IOT A;  2NVX A;  1MIU A;  1A31 A;  4FYD A;  1O2B A;  1IS1 A;  1O28 A;  2R7Z A;  1BJT A;  1O27 A;  3N3Y A;  4GTC A;  4KMD A;  3KYL A;  1DD5 A;  4DDQ A;  1IW7 D;  4AN8 A;  1K4T A;  2B9S B;  3BUE A;  1WQG A;  2GSU A;  1R5Z A;  3K5N A;  1K83 A;  4J3N A;  1Y69 8;  4GTA A;  2PHC B;  1XXA A;  1TGO A;  2GSO A;  2JA7 A;  4AYB A;  1O26 A;  1YNJ D;  4KDD A;  4KB2 A;  4GTF A;  4Q5G A;  1V9M A;  3ORE A;  1RRJ A;  1I3Q A;  5MLC 9;  3K5L A;  5JFE A;  4L8I A;  4C2M A;  2O5J D;  4EJ3 A;  3M4A A;  4BLB A;  1O2A A;  3K5O A;  2KWA A;  3VA7 A;  2CW0 D;  2BE5 D;  2XCO A;  4M1X A;  3MAQ A;  2NVY A;  5C9H A;  2F4Q A;  3CAG A;  5CHP A;  4FXD A;  4GTB A;  3SJR A;  3IAY A;  3N0B A;  3FOF A;  3GTO A;  1EH1 A;  1O25 A;  1F9N A;  3G4A A;  4GTD A;  4GT9 A;  3P9A A;  3FOE A;  4D3Y A;  3GTJ A;  5JSB B;  1BGW A;  1XXB A;  1LPQ A;  3GTK A;  4QCL A;  4G0V A;  4GTL A;  1R9T A;  1TL8 A;  4P5A A;  3LAJ A;  1RR8 C;  1ZYR D;  1EK8 A;  2JA6 A;  4F3E A;  2CFA B;  5CQG A;  4KAS A;  1SEU A;  4KAT A;  5IOS A;  1I50 A;  5IOR A;  3L4J A;  3S0X A;  3LAP A;  4AHC A;  2RH6 A;  4LMO A;  3AQP A;  4LR2 A;  1WQF A;  4C2M C;  5IOQ A;  4GTE A;  1A36 A;  2GSN A;  3HKZ A;  4JLR C;  1A35 A;  4KC6 A;  2JH3 A;  4KAW X;  1ZBS A;  1TWH A;  3K59 A;  2A68 D;  2Y0S A;  2A6H D;  1XXC A;  4IP8 A;  4FZB A;  2E2H A;  4OYD B;  4ILD A;  1ZVU A;  3FKI A;  1WIH A;  3AH5 A;  4BKW A;  1WQH A;  2VUM A;  3NUH A;  2E2I A;  2B63 A;  3LHP S;  3GTL A;  3V4G A;  4NOK A;  3K5M A;  4FGU A;  3K57 A;  2Y3P A;  4KM9 A;  2XCQ A;  5TJ3 A;  3H0G A;  1SMY D;  5EGE A;  3GTG A;  4C3H C;  4H3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...