1IS1A

Crystal structure of ribosome recycling factor from vibrio parahaemolyticus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
185
structure length
185
Chain Sequence
MINEIKKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEYYGAATPLNQVANVVAEDARTLAITVFDKELTQKVEKAIMMSDLGLNPMSAGTIIRVPLPPLTEERRKDLVKIVRGEAEGGRVAVRNIRRDANNDLKALLKDKEISEDEDRKAQEEIQKLTDVAVKKIDEVLAAKEKELMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME RECYCLING FACTOR
publication title Structure and binding mode of a ribosome recycling factor (RRF) from mesophilic bacterium
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Translation
total genus 68
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1is1A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1is1A02
3LF9A 1WQFA 2PHCB 4OYDB 5JSBB 1Y698 3V4GA 3OREA 3QX3A 4J3NA 3NUHA 1WIHA 2XCOA 3LPXA 2RGRA 3OPFA 4FM9A 4G0UA 3LHPS 1EK8A 3MMLB 2ZFZA 1DD5A 1BJTA 4KDDA 4KB2A 1B4AA 3OEPA 3LAJA 5JSNB 1XXCA 5CJ9A 3VA7A 4DDQA 2Y3PA 4KC6A 2KWAA 4L8IA 5JVOA 1IS1A 1ISEA 4KB4A 3LAPA 5MLC9 1GE9A 2XCQA 3L4KA 1XXBA 2P5MA 3L4JA 1AB4A 1WQHA 3FOFA 1F9NA 3FOEA 3CAGA 1BGWA 1ZVUA 3BUEA 4G0VA 4G0WA 1EH1A 4JLRC 1XXAA 3ERED 3FHZA 4KAWX 4GFQA 1WQGA 1B4BA 2XCRB
chains in the Genus database with same CATH superfamily
3S16C 2PHCB 4Y52K 5C4JC 1ZXOA 1TWFC 4J3NA 3NUHA 4GTFA 3TFJA 1L0WA 3OPFA 3GTPA 3T00A 4BKWA 5C44C 3S1NK 3N0BA 4AHCA 3HOXC 1Q8IA 1TWHC 4BY7K 5C4XK 2BE5A 2PMZL 4A93K 1G51A 3L4KA 2GSOA 2JA7C 3FOFA 3HOVK 4A3DC 1F9NA 1WSVA 2R4GA 4RMFA 2Y0SD 2R7ZA 4IP9A 1KQ4A 4BY7C 4BLBA 4C3JK 4OIRA 4OINA 4OIPA 1O2BA 1VH2A 3AD9C 4D3ZA 4P5AA 1YNNA 3S1QC 3GEEA 1IW7D 3GTMK 3I4MK 3PO3K 4YFXA 2KWAA 4G7OA 3EQLA 1RU0A 1I6HK 4BBSK 1ZQ1C 1HI9A 2P5MA 2WAQD 2CFAB 3DU6A 1TWAC 1MIUA 2JA8K 1R9TK 4A3BK 1A31A 2R93K 1I50C 3N3YA 3GTLC 4LR2A 4ILDA 1JVIA 1WQFA 5IOTA 1ZYRD 4FGUA 4H3TA 3I4NK 4A3FC 1J98A 3K7AK 3FKIK 1XPPA 4P5BA 3M3YC 2JA6C 5C3EK 3S1MC 3K5NA 1O2FB 3GTJC 2JA8C 1R9TC 4A3BC 3GTLA 2R93C 4KARA 3GTGA 2YU9K 2D6FC 4G7HA 1GE9A 2A68A 4C3IC 1JQWA 1NH3A 2E2IC 4A3MK 3SJRA 4LLGA 3FOEA 3HOUC 1TGOA 5IYCK 3K5OA 4G0WA 3S17K 1EH1A 2JA6A 2WB1D 4OIQA 4A3KC 4FXDA 3GTJA 5FJ8K 4A3CK 1I3QA 3S2HK 5JSBB 2V6UA 4LK0A 3QX3A 3RZOK 3WVOA 4AN8A 3IAYA 1WIHA 3LPXA 2RGRA 4G7ZA 2CW0D 1XZPA 2R92K 3P9AA 2B63C 3CQZC 5MLC9 2VUMA 5D4DA 3WODA 1K83C 1IBAA 4GZYA 1XZPB 3JSTA 1TWCA 1BGWA 1WCMA 1ZVUA 4BXXC 1YCLA 3H3VD 1O29A 3SZYA 2R92C 3TTGA 4GTEA 4LQYA 4LJZA 1I6VD 4QJVB 2A69D 1VLOA 3HOWC 2JA5A 1SEUA 4KN7A 5HL8A 2JH3A 3HKZA 1BDFA 5IP9C 4BBRC 3GEHA 3GTOA 4C2MC 2PMZA 5M5WK 3RZDK 1SFOC 5TMCA 1K4SA 4GTDA 4A3IC 3GTKA 4QIWD 4JLRC 2GAGC 5M3MK 2ZUFA 4YFKA 3H0GK 4LK1A 3GTPK 5IYBC 2ZUEA 2CFAA 1EI6A 1DCOA 1SFOA 2A6HD 1O25A 3AD8C 4A3LK 2ZFZA 1BJTA 1B4AA 3HKZL 5TJ3A 1PJ5A 1K4TA 1SMYA 4AH6A 3A8IA 1AB4A 1EFWA 1VRQC 4Y52C 1TWFA 5EGHA 2R7ZK 4O2DA 3SZZA 3S14K 1B4BA 2E2JK 3S1NC 1TWHA 4OIOA 5C4XC 3M4AA 4C45A 3N0CA 4A93C 3K57A 1XZQB 4FM9A 2JA7A 1O28A 1DCPA 4AYBD 5JFEA 4WJ4A 3S0XA 2O5IA 2PA8L 2FQTA 3AH5A 4MQ9A 3HOVC 4KMAA 4KC6A 3DXJA 1YNND 1PJ6A 1ZBSA 4KMDA 3GTQK 2Y0SA 2GSNA 4F3EA 3K5LA 1J6VA 1Y1VK 4KMHA 4C3JC 4A3EK 1JOEA 1YNJA 3LF9A 3GTMC 3I4MC 3PO3C 4PAAA 1C0AA 2E2HK 3GTQC 1IQ0A 1I6HC 4GT9A 4BBSC 1R49A 2NVXK 3GTGK 5IOQA 4QJVA 1TWAA 1Y1VC 5CJ9A 2WAQA 1Y1WK 1I50A 1J6WA 4L8IA 2GAHC 1TWGK 1HQMD 4C3HK 2Y0SL 4FZBA 1I3QK 3I4NC 1V9MA 2E2HC 4XLNA 3BUEA 1ZYRA 3K7AC 3FKIC 1A36A 1DCHA 5C3EC 1R9TA 3S2DK 5FLMK 3HOZK 2A6ED 2R93A 3DU5A 3S15K 2O5JA 3K59A 3GEIA 1TWGC 2YU9C 2E2IA 2NVYK 4KN4A 4A3MC 4IP8A 4DDQA 2Y3PA 5IYCC 2WAQL 3S17C 4A3CC 2WB1A 1X31C 4BLAA 5FLMC 3HOZC 3ADAC 4KM8A 5IOSA 3S2HC 3RZOC 1O27A 2NVYC 2B63A 5M5XK 4O26A 3CQZA 2NVTK 2V6SA 4OYDB 1VJEA 5IP7K 2RH6A 1K83A 1EK8A 3OEPA 3VA7A 5IYDK 3TFHA 1WORA 2R92A 1VGXA 4GTBA 1XZQA 3GTKK 4YG2A 2XCQA 4KM9A 4X6AK 2WB1L 1SC7A 1I6VA 2PMZD 5IP7C 4A3GK 3IPJA 4A3JK 4JK1A 4Q5SA 5E68A 3KYLA 1BS2A 1WQGA 2GSUA 4C2MA 2PPBA 4Y7NK 4NOIA 3RZDC 3LAJA 4NOMA 5JSNB 3S16K 4A3GC 4XCHA 2F4QA 4A3JC 5C4JK 1TL8A 1TWFK 3LAPA 2PA8D 4QIWA 1WOOA 3H0GC 3GTPC 5C44K 4KATA 3HOXK 2BE5D 4GTCA 3T01A 1TWHK 2V6TA 2EBBA 3TFIA 1UV7A 3K5MA 3GIRA 4Q5VA 4WILA 4A3LC 4GFQA 2NVQK 2JA7K 4KASA 1USMA 4MEXA 1IL2A 4A3DK 3H0GA 5CHPA 4G0UA 3LHPS 4GTLA 4PABA 4YFNA 4KMUA 2R7ZC 1ISEA 3S14C 2NVQC 4QIWL 4NOKA 3S1QK 4WJ3M 2E2JC 1WQHA 4G0VA 3BP8C 1V5VA 3S1RK 4AYBA 4MEYA 4Q4ZA 3K58A 1TWAK 3Q3QA 1IW7A 1YNJD 2XCOA 1I50K 3GSIA 4BY1K 3GTLK 3MMLB 1IE0A 1O2AA 4Q5GA 3MAQA 1EJ9A 3A8KA 3HXAA 4A3FK 1F7UA 3GDZA 3S1RC 4D3YA 1IS1A 4A3EC 3GTMA 3M3YK 2JA6K 3S1MK 3GTJK 4P9SA 4NOLA 3GTQA 5M3FK 2A68D 4BY1C 2P8TA 3BP3A 1WOPA 2NVXC 3GTGC 1Y1VA 4C3IK 3M4OK 1RR8C 2E2IK 4AYBL 3HOUK 3OREA 1Y1WC 4ZH4A 1PJ7A 5L46A 4A3KK 2W7VA 4XSZA 2O5JD 4KB2A 4C3HC 2E2HA 1HQMA 1I3QC 2VUMK 3FKIA 2NVXA 1USOA 5JVOA 1O26A 3AQPA 1TWCK 1WCMK 3M4OC 1Y1WA 3L4JA 3S2DC 3S15C 1TWGA 2B63K 2A6EA 2YU9A 3CQZK 3ERED 4KAWX 3T02A 3G4AA 3AQOA 2JA5K 1K83K 2VUMC 2CW0A 4BXXK 1A35A 1TWCC 1WCMC 1F93A 3GTOK 1O24A 1XXCA 3HOWK 5CQGA 2NVYA 4KB4A 4EJ3A 3HKZD 2JA5C 4FYDA 1XXBA 4XLPA 3PO2K 2B9SB 5IP9K 5M5YK 2NVTC 4BBRK 4QCLA 4C2MK 2A69A 1XXAA 3GTOC 4LOWA 1SFOK 4GTAA 4M1XA 1WOSA 4A3IK 1Y698 5IORA 3V4GA 5IYDC 3HOYK 5C9HA 5EGEA 1INNA 3GTKC 3PO2C 4X6AC 1DD5A 1R5ZA 4KDDA 1J6XA 4XSXA 5IYBK 1EQRA 1YX2A 4LMOA 1F7VA 3G4CA 3AD7C 3H3VL 3HOYC 1LPQA 3CAGA 1RRJA 1SMYD 4Y7NC 3FHZA 1T8IA 2FQOA 2A6HA 1WSRA 5TMFA 3A8JA 2XCRB
chains in the Genus database with same CATH topology
2A6ED 4AYBA 2R93A 2PHCB 2A69D 3DU5A 3K58A 1ZXOA 3K59A 3Q3QA 4J3NA 3NUHA 4GTFA 2JA5A 1YNJD 1SEUA 2XCOA 3OPFA 3GTPA 3MMLB 2E2IA 2JH3A 4BKWA 1O2AA 3HKZA 4Q5GA 3MAQA 4AHCA 1EJ9A 3N0BA 4IP8A 4DDQA 2Y3PA 1Q8IA 3GTOA 4C2MC 4D3YA 1IS1A 2PMZA 3L4KA 2WB1A 3GTMA 2GSOA 4BLAA 1K4SA 4GTDA 4KM8A 5IOSA 3FOFA 1F9NA 4NOLA 3GTQA 3GTKA 2R4GA 4JLRC 2A68D 1O27A 1Y1VA 2B63A 2R7ZA 4IP9A 4O26A 1RR8C 3CQZA 2CFAA 1KQ4A 4OYDB 4BLBA 3OREA 1SFOA 2A6HD 1O25A 2RH6A 1O2BA 1K83A 4D3ZA 1EK8A 4P5AA 2ZFZA 2O5JD 1BJTA 3OEPA 4KB2A 1B4AA 5TJ3A 1IW7D 2E2HA 4C3HC 3VA7A 2KWAA 3FKIA 2NVXA 2R92A 5JVOA 1K4TA 4GTBA 1O26A 3AQPA 2XCQA 4KM9A 1Y1WA 2P5MA 3L4JA 1AB4A 2CFAB 1SC7A 1TWFA 1TWGA 3DU6A 5EGHA 2YU9A 1MIUA 1A31A 3ERED 3KYLA 3N3YA 4KAWX 4LR2A 1WQGA 2GSUA 3G4AA 2XCRB 1B4BA 3AQOA 4ILDA 1WQFA 1TWHA 5IOTA 4C2MA 1ZYRD 4FGUA 4H3TA 1A35A 3M4AA 3N0CA 3K57A 4FM9A 2JA7A 1O28A 5JFEA 4P5BA 3LAJA 1O24A 3S0XA 4NOMA 3K5NA 5JSNB 3AH5A 1XXCA 2F4QA 4KMAA 4KC6A 3GTLA 5CQGA 1TL8A 1YNND 2NVYA 4KARA 4KB4A 3LAPA 3GTGA 1ZBSA 4EJ3A 4QIWA 4KMDA 1GE9A 4C3IC 4FYDA 1NH3A 1XXBA 2B9SB 2Y0SA 2GSNA 3SJRA 4F3EA 3K5LA 4KATA 2BE5D 4QCLA 1TGOA 4GTCA 4KMHA 4C3JC 3K5OA 3FOEA 4G0WA 1EH1A 3K5MA 2JA6A 1XXAA 4FXDA 3GTJA 4Q5VA 4GFQA 4GTAA 1I3QA 4M1XA 4KASA 3LF9A 5JSBB 1Y698 5IORA 3V4GA 5C9HA 5EGEA 3QX3A 3WVOA 4AN8A 3H0GA 3IAYA 1WIHA 3LPXA 2RGRA 5CHPA 4GT9A 4G0UA 3LHPS 1R49A 4GTLA 1DD5A 1R5ZA 2CW0D 3P9AA 4KDDA 5IOQA 1TWAA 5CJ9A 2WAQA 1I50A 4L8IA 1ISEA 4LMOA 5MLC9 2VUMA 3G4CA 4NOKA 1HQMD 1WQHA 4FZBA 1R9TA 1V9MA 1RRJA 1LPQA 1TWCA 1BGWA 1SMYD 1WCMA 1ZVUA 3BUEA 3CAGA 4G0VA 1O29A 3FHZA 1T8IA 1A36A 4GTEA 4LQYA 1I6VD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LF9 A;  1WQF A;  2PHC B;  4OYD B;  5JSB B;  1Y69 8;  3V4G A;  3ORE A;  3QX3 A;  4J3N A;  3NUH A;  1WIH A;  2XCO A;  3LPX A;  2RGR A;  3OPF A;  4FM9 A;  4G0U A;  3LHP S;  1EK8 A;  3MML B;  2ZFZ A;  1DD5 A;  1BJT A;  4KDD A;  4KB2 A;  1B4A A;  3OEP A;  3LAJ A;  5JSN B;  1XXC A;  5CJ9 A;  3VA7 A;  4DDQ A;  2Y3P A;  4KC6 A;  2KWA A;  4L8I A;  5JVO A;  1IS1 A;  1ISE A;  4KB4 A;  3LAP A;  5MLC 9;  1GE9 A;  2XCQ A;  3L4K A;  1XXB A;  2P5M A;  3L4J A;  1AB4 A;  1WQH A;  3FOF A;  1F9N A;  3FOE A;  3CAG A;  1BGW A;  1ZVU A;  3BUE A;  4G0V A;  4G0W A;  1EH1 A;  4JLR C;  1XXA A;  3ERE D;  3FHZ A;  4KAW X;  4GFQ A;  1WQG A;  1B4B A;  2XCR B; 
#chains in the Genus database with same CATH topology
 3S16 C;  2PHC B;  4Y52 K;  5C4J C;  1ZXO A;  1TWF C;  4J3N A;  3NUH A;  4GTF A;  3TFJ A;  1L0W A;  3OPF A;  3GTP A;  3T00 A;  4BKW A;  5C44 C;  3S1N K;  3N0B A;  4AHC A;  3HOX C;  1Q8I A;  1TWH C;  4BY7 K;  5C4X K;  2BE5 A;  2PMZ L;  4A93 K;  1G51 A;  3L4K A;  2GSO A;  2JA7 C;  3FOF A;  3HOV K;  4A3D C;  1F9N A;  1WSV A;  2R4G A;  4RMF A;  2Y0S D;  2R7Z A;  4IP9 A;  1KQ4 A;  4BY7 C;  4BLB A;  4C3J K;  4OIR A;  4OIN A;  4OIP A;  1O2B A;  1VH2 A;  3AD9 C;  4D3Z A;  4P5A A;  1YNN A;  3S1Q C;  3GEE A;  1IW7 D;  3GTM K;  3I4M K;  3PO3 K;  4YFX A;  2KWA A;  4G7O A;  3EQL A;  1RU0 A;  1I6H K;  4BBS K;  1ZQ1 C;  1HI9 A;  2P5M A;  2WAQ D;  2CFA B;  3DU6 A;  1TWA C;  1MIU A;  2JA8 K;  1R9T K;  4A3B K;  1A31 A;  2R93 K;  1I50 C;  3N3Y A;  3GTL C;  4LR2 A;  4ILD A;  1JVI A;  1WQF A;  5IOT A;  1ZYR D;  4FGU A;  4H3T A;  3I4N K;  4A3F C;  1J98 A;  3K7A K;  3FKI K;  1XPP A;  4P5B A;  3M3Y C;  2JA6 C;  5C3E K;  3S1M C;  3K5N A;  1O2F B;  3GTJ C;  2JA8 C;  1R9T C;  4A3B C;  3GTL A;  2R93 C;  4KAR A;  3GTG A;  2YU9 K;  2D6F C;  4G7H A;  1GE9 A;  2A68 A;  4C3I C;  1JQW A;  1NH3 A;  2E2I C;  4A3M K;  3SJR A;  4LLG A;  3FOE A;  3HOU C;  1TGO A;  5IYC K;  3K5O A;  4G0W A;  3S17 K;  1EH1 A;  2JA6 A;  2WB1 D;  4OIQ A;  4A3K C;  4FXD A;  3GTJ A;  5FJ8 K;  4A3C K;  1I3Q A;  3S2H K;  5JSB B;  2V6U A;  4LK0 A;  3QX3 A;  3RZO K;  3WVO A;  4AN8 A;  3IAY A;  1WIH A;  3LPX A;  2RGR A;  4G7Z A;  2CW0 D;  1XZP A;  2R92 K;  3P9A A;  2B63 C;  3CQZ C;  5MLC 9;  2VUM A;  5D4D A;  3WOD A;  1K83 C;  1IBA A;  4GZY A;  1XZP B;  3JST A;  1TWC A;  1BGW A;  1WCM A;  1ZVU A;  4BXX C;  1YCL A;  3H3V D;  1O29 A;  3SZY A;  2R92 C;  3TTG A;  4GTE A;  4LQY A;  4LJZ A;  1I6V D;  4QJV B;  2A69 D;  1VLO A;  3HOW C;  2JA5 A;  1SEU A;  4KN7 A;  5HL8 A;  2JH3 A;  3HKZ A;  1BDF A;  5IP9 C;  4BBR C;  3GEH A;  3GTO A;  4C2M C;  2PMZ A;  5M5W K;  3RZD K;  1SFO C;  5TMC A;  1K4S A;  4GTD A;  4A3I C;  3GTK A;  4QIW D;  4JLR C;  2GAG C;  5M3M K;  2ZUF A;  4YFK A;  3H0G K;  4LK1 A;  3GTP K;  5IYB C;  2ZUE A;  2CFA A;  1EI6 A;  1DCO A;  1SFO A;  2A6H D;  1O25 A;  3AD8 C;  4A3L K;  2ZFZ A;  1BJT A;  1B4A A;  3HKZ L;  5TJ3 A;  1PJ5 A;  1K4T A;  1SMY A;  4AH6 A;  3A8I A;  1AB4 A;  1EFW A;  1VRQ C;  4Y52 C;  1TWF A;  5EGH A;  2R7Z K;  4O2D A;  3SZZ A;  3S14 K;  1B4B A;  2E2J K;  3S1N C;  1TWH A;  4OIO A;  5C4X C;  3M4A A;  4C45 A;  3N0C A;  4A93 C;  3K57 A;  1XZQ B;  4FM9 A;  2JA7 A;  1O28 A;  1DCP A;  4AYB D;  5JFE A;  4WJ4 A;  3S0X A;  2O5I A;  2PA8 L;  2FQT A;  3AH5 A;  4MQ9 A;  3HOV C;  4KMA A;  4KC6 A;  3DXJ A;  1YNN D;  1PJ6 A;  1ZBS A;  4KMD A;  3GTQ K;  2Y0S A;  2GSN A;  4F3E A;  3K5L A;  1J6V A;  1Y1V K;  4KMH A;  4C3J C;  4A3E K;  1JOE A;  1YNJ A;  3LF9 A;  3GTM C;  3I4M C;  3PO3 C;  4PAA A;  1C0A A;  2E2H K;  3GTQ C;  1IQ0 A;  1I6H C;  4GT9 A;  4BBS C;  1R49 A;  2NVX K;  3GTG K;  5IOQ A;  4QJV A;  1TWA A;  1Y1V C;  5CJ9 A;  2WAQ A;  1Y1W K;  1I50 A;  1J6W A;  4L8I A;  2GAH C;  1TWG K;  1HQM D;  4C3H K;  2Y0S L;  4FZB A;  1I3Q K;  3I4N C;  1V9M A;  2E2H C;  4XLN A;  3BUE A;  1ZYR A;  3K7A C;  3FKI C;  1A36 A;  1DCH A;  5C3E C;  1R9T A;  3S2D K;  5FLM K;  3HOZ K;  2A6E D;  2R93 A;  3DU5 A;  3S15 K;  2O5J A;  3K59 A;  3GEI A;  1TWG C;  2YU9 C;  2E2I A;  2NVY K;  4KN4 A;  4A3M C;  4IP8 A;  4DDQ A;  2Y3P A;  5IYC C;  2WAQ L;  3S17 C;  4A3C C;  2WB1 A;  1X31 C;  4BLA A;  5FLM C;  3HOZ C;  3ADA C;  4KM8 A;  5IOS A;  3S2H C;  3RZO C;  1O27 A;  2NVY C;  2B63 A;  5M5X K;  4O26 A;  3CQZ A;  2NVT K;  2V6S A;  4OYD B;  1VJE A;  5IP7 K;  2RH6 A;  1K83 A;  1EK8 A;  3OEP A;  3VA7 A;  5IYD K;  3TFH A;  1WOR A;  2R92 A;  1VGX A;  4GTB A;  1XZQ A;  3GTK K;  4YG2 A;  2XCQ A;  4KM9 A;  4X6A K;  2WB1 L;  1SC7 A;  1I6V A;  2PMZ D;  5IP7 C;  4A3G K;  3IPJ A;  4A3J K;  4JK1 A;  4Q5S A;  5E68 A;  3KYL A;  1BS2 A;  1WQG A;  2GSU A;  4C2M A;  2PPB A;  4Y7N K;  4NOI A;  3RZD C;  3LAJ A;  4NOM A;  5JSN B;  3S16 K;  4A3G C;  4XCH A;  2F4Q A;  4A3J C;  5C4J K;  1TL8 A;  1TWF K;  3LAP A;  2PA8 D;  4QIW A;  1WOO A;  3H0G C;  3GTP C;  5C44 K;  4KAT A;  3HOX K;  2BE5 D;  4GTC A;  3T01 A;  1TWH K;  2V6T A;  2EBB A;  3TFI A;  1UV7 A;  3K5M A;  3GIR A;  4Q5V A;  4WIL A;  4A3L C;  4GFQ A;  2NVQ K;  2JA7 K;  4KAS A;  1USM A;  4MEX A;  1IL2 A;  4A3D K;  3H0G A;  5CHP A;  4G0U A;  3LHP S;  4GTL A;  4PAB A;  4YFN A;  4KMU A;  2R7Z C;  1ISE A;  3S14 C;  2NVQ C;  4QIW L;  4NOK A;  3S1Q K;  4WJ3 M;  2E2J C;  1WQH A;  4G0V A;  3BP8 C;  1V5V A;  3S1R K;  4AYB A;  4MEY A;  4Q4Z A;  3K58 A;  1TWA K;  3Q3Q A;  1IW7 A;  1YNJ D;  2XCO A;  1I50 K;  3GSI A;  4BY1 K;  3GTL K;  3MML B;  1IE0 A;  1O2A A;  4Q5G A;  3MAQ A;  1EJ9 A;  3A8K A;  3HXA A;  4A3F K;  1F7U A;  3GDZ A;  3S1R C;  4D3Y A;  1IS1 A;  4A3E C;  3GTM A;  3M3Y K;  2JA6 K;  3S1M K;  3GTJ K;  4P9S A;  4NOL A;  3GTQ A;  5M3F K;  2A68 D;  4BY1 C;  2P8T A;  3BP3 A;  1WOP A;  2NVX C;  3GTG C;  1Y1V A;  4C3I K;  3M4O K;  1RR8 C;  2E2I K;  4AYB L;  3HOU K;  3ORE A;  1Y1W C;  4ZH4 A;  1PJ7 A;  5L46 A;  4A3K K;  2W7V A;  4XSZ A;  2O5J D;  4KB2 A;  4C3H C;  2E2H A;  1HQM A;  1I3Q C;  2VUM K;  3FKI A;  2NVX A;  1USO A;  5JVO A;  1O26 A;  3AQP A;  1TWC K;  1WCM K;  3M4O C;  1Y1W A;  3L4J A;  3S2D C;  3S15 C;  1TWG A;  2B63 K;  2A6E A;  2YU9 A;  3CQZ K;  3ERE D;  4KAW X;  3T02 A;  3G4A A;  3AQO A;  2JA5 K;  1K83 K;  2VUM C;  2CW0 A;  4BXX K;  1A35 A;  1TWC C;  1WCM C;  1F93 A;  3GTO K;  1O24 A;  1XXC A;  3HOW K;  5CQG A;  2NVY A;  4KB4 A;  4EJ3 A;  3HKZ D;  2JA5 C;  4FYD A;  1XXB A;  4XLP A;  3PO2 K;  2B9S B;  5IP9 K;  5M5Y K;  2NVT C;  4BBR K;  4QCL A;  4C2M K;  2A69 A;  1XXA A;  3GTO C;  4LOW A;  1SFO K;  4GTA A;  4M1X A;  1WOS A;  4A3I K;  1Y69 8;  5IOR A;  3V4G A;  5IYD C;  3HOY K;  5C9H A;  5EGE A;  1INN A;  3GTK C;  3PO2 C;  4X6A C;  1DD5 A;  1R5Z A;  4KDD A;  1J6X A;  4XSX A;  5IYB K;  1EQR A;  1YX2 A;  4LMO A;  1F7V A;  3G4C A;  3AD7 C;  3H3V L;  3HOY C;  1LPQ A;  3CAG A;  1RRJ A;  1SMY D;  4Y7N C;  3FHZ A;  1T8I A;  2FQO A;  2A6H A;  1WSR A;  5TMF A;  3A8J A;  2XCR B; 
#chains in the Genus database with same CATH homology
 2A6E D;  4AYB A;  2R93 A;  2PHC B;  2A69 D;  3DU5 A;  3K58 A;  1ZXO A;  3K59 A;  3Q3Q A;  4J3N A;  3NUH A;  4GTF A;  2JA5 A;  1YNJ D;  1SEU A;  2XCO A;  3OPF A;  3GTP A;  3MML B;  2E2I A;  2JH3 A;  4BKW A;  1O2A A;  3HKZ A;  4Q5G A;  3MAQ A;  4AHC A;  1EJ9 A;  3N0B A;  4IP8 A;  4DDQ A;  2Y3P A;  1Q8I A;  3GTO A;  4C2M C;  4D3Y A;  1IS1 A;  2PMZ A;  3L4K A;  2WB1 A;  3GTM A;  2GSO A;  4BLA A;  1K4S A;  4GTD A;  4KM8 A;  5IOS A;  3FOF A;  1F9N A;  4NOL A;  3GTQ A;  3GTK A;  2R4G A;  4JLR C;  2A68 D;  1O27 A;  1Y1V A;  2B63 A;  2R7Z A;  4IP9 A;  4O26 A;  1RR8 C;  3CQZ A;  2CFA A;  1KQ4 A;  4OYD B;  4BLB A;  3ORE A;  1SFO A;  2A6H D;  1O25 A;  2RH6 A;  1O2B A;  1K83 A;  4D3Z A;  1EK8 A;  4P5A A;  2ZFZ A;  2O5J D;  1BJT A;  3OEP A;  4KB2 A;  1B4A A;  5TJ3 A;  1IW7 D;  2E2H A;  4C3H C;  3VA7 A;  2KWA A;  3FKI A;  2NVX A;  2R92 A;  5JVO A;  1K4T A;  4GTB A;  1O26 A;  3AQP A;  2XCQ A;  4KM9 A;  1Y1W A;  2P5M A;  3L4J A;  1AB4 A;  2CFA B;  1SC7 A;  1TWF A;  1TWG A;  3DU6 A;  5EGH A;  2YU9 A;  1MIU A;  1A31 A;  3ERE D;  3KYL A;  3N3Y A;  4KAW X;  4LR2 A;  1WQG A;  2GSU A;  3G4A A;  2XCR B;  1B4B A;  3AQO A;  4ILD A;  1WQF A;  1TWH A;  5IOT A;  4C2M A;  1ZYR D;  4FGU A;  4H3T A;  1A35 A;  3M4A A;  3N0C A;  3K57 A;  4FM9 A;  2JA7 A;  1O28 A;  5JFE A;  4P5B A;  3LAJ A;  1O24 A;  3S0X A;  4NOM A;  3K5N A;  5JSN B;  3AH5 A;  1XXC A;  2F4Q A;  4KMA A;  4KC6 A;  3GTL A;  5CQG A;  1TL8 A;  1YNN D;  2NVY A;  4KAR A;  4KB4 A;  3LAP A;  3GTG A;  1ZBS A;  4EJ3 A;  4QIW A;  4KMD A;  1GE9 A;  4C3I C;  4FYD A;  1NH3 A;  1XXB A;  2B9S B;  2Y0S A;  2GSN A;  3SJR A;  4F3E A;  3K5L A;  4KAT A;  2BE5 D;  4QCL A;  1TGO A;  4GTC A;  4KMH A;  4C3J C;  3K5O A;  3FOE A;  4G0W A;  1EH1 A;  3K5M A;  2JA6 A;  1XXA A;  4FXD A;  3GTJ A;  4Q5V A;  4GFQ A;  4GTA A;  1I3Q A;  4M1X A;  4KAS A;  3LF9 A;  5JSB B;  1Y69 8;  5IOR A;  3V4G A;  5C9H A;  5EGE A;  3QX3 A;  3WVO A;  4AN8 A;  3H0G A;  3IAY A;  1WIH A;  3LPX A;  2RGR A;  5CHP A;  4GT9 A;  4G0U A;  3LHP S;  1R49 A;  4GTL A;  1DD5 A;  1R5Z A;  2CW0 D;  3P9A A;  4KDD A;  5IOQ A;  1TWA A;  5CJ9 A;  2WAQ A;  1I50 A;  4L8I A;  1ISE A;  4LMO A;  5MLC 9;  2VUM A;  3G4C A;  4NOK A;  1HQM D;  1WQH A;  4FZB A;  1R9T A;  1V9M A;  1RRJ A;  1LPQ A;  1TWC A;  1BGW A;  1SMY D;  1WCM A;  1ZVU A;  3BUE A;  3CAG A;  4G0V A;  1O29 A;  3FHZ A;  1T8I A;  1A36 A;  4GTE A;  4LQY A;  1I6V D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...