1IS1A

Crystal structure of ribosome recycling factor from vibrio parahaemolyticus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
185
structure length
185
Chain Sequence
MINEIKKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEYYGAATPLNQVANVVAEDARTLAITVFDKELTQKVEKAIMMSDLGLNPMSAGTIIRVPLPPLTEERRKDLVKIVRGEAEGGRVAVRNIRRDANNDLKALLKDKEISEDEDRKAQEEIQKLTDVAVKKIDEVLAAKEKELMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME RECYCLING FACTOR
publication title Structure and binding mode of a ribosome recycling factor (RRF) from mesophilic bacterium
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Translation
total genus 68
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1is1A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1is1A02
2P5MA 1BJTA 3QX3A 3LF9A 2XCRB 4KAWX 1Y698 1EK8A 4OYDB 3MMLB 4KDDA 4GFQA 2ZFZA 3L4KA 1EH1A 1XXAA 1GE9A 1WIHA 2PHCB 4J3NA 5MLC9 3FHZA 3FOFA 4L8IA 4JLRC 1B4BA 1B4AA 3FOEA 4FM9A 1IS1A 1ISEA 4G0VA 2XCOA 3NUHA 1F9NA 3CAGA 3LPXA 5CJ9A 1BGWA 3OEPA 1AB4A 1XXBA 1DD5A 1WQHA 3LHPS 1ZVUA 3OPFA 2Y3PA 5JSBB 3L4JA 3OREA 4KB2A 2RGRA 3BUEA 3V4GA 3ERED 5JSNB 3LAJA 5JVOA 4G0WA 3VA7A 4G0UA 4DDQA 4KC6A 1WQGA 3LAPA 1WQFA 1XXCA 2KWAA 2XCQA 4KB4A
chains in the Genus database with same CATH superfamily
4EJ3A 2E2JK 1WOSA 4A3KC 1IBAA 1EFWA 2Y0SA 3S17C 3RZDC 1J6XA 2JA7K 1TWGK 5IORA 5C44K 3K5OA 1SFOA 1WSRA 3S0XA 4A3MK 4LK1A 4BLBA 5IYDK 3PO3K 1JVIA 3SJRA 2RH6A 5L46A 3S16C 3JSTA 4A93C 1WOOA 3HOWK 3AQPA 3KYLA 4LLGA 2PA8L 4GTEA 3VA7A 4A3FK 2ZUFA 1ZYRD 1SMYA 3LAPA 2A6HD 1R5ZA 2NVYK 2JA7A 1TWGA 3BP3A 3AQOA 2PMZA 5IYCK 1I6HC 2P5MA 2A68A 4XCHA 3S1RC 1Y1VC 3FOEA 4J3NA 1PJ6A 4A3GC 2O5JD 3GTMK 5HL8A 4GZYA 4LR2A 4YFXA 4YFNA 2B63C 2NVYA 3OEPA 1K4SA 5CHPA 2VUMC 3LHPS 4X6AK 5IYBK 2Y0SD 4KMHA 3LAJA 4LJZA 4A3JK 1O28A 4A3KK 2CFAB 3H0GC 3GTMA 4FZBA 3G4AA 4Y7NC 1O26A 4GTDA 5M5XK 3GTPK 3RZDK 4AHCA 3HXAA 2ZUEA 2YU9C 5TMFA 2R4GA 3M3YC 4G7HA 1F93A 1SMYD 3M4OC 1I6VD 3GTKC 3NUHA 3S2DK 3FKIK 4A93K 2PMZD 3A8JA 1VRQC 2A68D 4M1XA 1DD5A 3CQZK 3V4GA 3GDZA 3GTPA 4DDQA 4KASA 3N0CA 1I6HK 1WOPA 1HQMD 4A3LC 3GTLC 2NVXC 4AN8A 4OIQA 1O24A 3S1RK 3RZOC 1Y1VK 3FKIA 1O29A 1UV7A 3N0BA 2JA8K 4A3GK 4LMOA 5C4JK 3HOXC 1TWCC 3A8IA 3SZZA 3CQZA 1K83K 5M5YK 1F7UA 2E2HA 4G7OA 4D3ZA 2VUMK 1IE0A 3AD9C 4NOIA 4C3JK 5TMCA 4PABA 1YX2A 2A6ED 4G0VA 2NVQC 4OIPA 4Y7NK 1K83A 4KAWX 4A3IC 3DU6A 2VUMA 4NOMA 4QIWL 5MLC9 5EGEA 1SC7A 4C3IC 3GTKK 2P8TA 1J6WA 1XPPA 2R92C 1F9NA 3CAGA 1JQWA 1XZPA 3HOZC 4WJ4A 1YNNA 1ZVUA 4Y52K 5JSBB 3I4MC 2EBBA 4OIOA 4C2MK 1RR8C 3H3VL 1WQGA 5C3EC 2JA6C 2KWAA 1IQ0A 2WAQL 3GTLK 3TFHA 3K57A 2NVXK 4GTAA 2GAHC 1INNA 1SEUA 5IP9C 1EK8A 4MEYA 4BXXC 2PA8D 1B4BA 3GEHA 1IW7A 3GTJK 1TWFC 2R7ZK 4C2MA 3I4NC 4OINA 1I3QC 5E68A 5EGHA 5CQGA 3GTLA 3S1QC 2NVXA 4KM9A 3K59A 4A3DC 1EI6A 1VH2A 3T00A 4A3EK 2FQTA 3K5NA 1DCHA 2NVQK 4D3YA 2O5IA 3S14C 1PJ7A 4P5BA 2PPBA 4GT9A 3HKZL 3DXJA 3S1NC 2JA5C 1VLOA 3GTJA 1YNND 4A3IK 1XZQB 2R7ZA 3Q3QA 2NVTK 2BE5D 2ZFZA 4O2DA 4YFKA 1XXAA 1GE9A 4RMFA 4AYBD 4QJVB 2R93K 4LK0A 2WB1L 4XLPA 1MIUA 2XCOA 3HOZK 5D4DA 5IOQA 3TFJA 1BGWA 3MAQA 4FGUA 3I4MK 1XXBA 4IP8A 2V6UA 3GTGK 1HI9A 4BY7C 2W7VA 3K7AC 5C3EK 2V6SA 1TWHC 2XCQA 2R93A 1XZQA 4OIRA 1WCMC 5IP9K 2XCRB 3S1MC 3T02A 1TWAC 3SZYA 4BXXK 4QJVA 3S17K 3GTOC 4QIWA 4JLRC 2A69A 3GTGA 2E2IC 4MQ9A 1ISEA 4KATA 1J98A 1EQRA 5CJ9A 3S16K 3GTQC 4A3DK 1WQHA 4KN4A 4G7ZA 3IAYA 3AD7C 1Y1WC 5C4XC 4IP9A 1LPQA 3S14K 3HOUC 3S1NK 2JA5K 2CFAA 3GSIA 3S2HC 1I50C 1BJTA 4Q4ZA 5TJ3A 1A36A 3L4KA 3K5MA 3FHZA 1B4AA 5IP7C 5FLMC 5IOSA 4Q5VA 2B63K 2JA5A 4G0WA 3HOVC 3OPFA 3OREA 1SFOC 5JSNB 4QIWD 4G0UA 1Y1VA 2A69D 1DCOA 2PMZL 2GSOA 4C45A 1IL2A 4KMDA 3H0GK 3HKZA 1PJ5A 2E2JC 4JK1A 3G4CA 4OYDB 4KMUA 3ADAC 2B63A 2YU9K 2JA7C 3M3YK 1TWGC 1USOA 1VGXA 4BY1C 1IS1A 5M3FK 3M4OK 4A3MC 3H3VD 4AH6A 5IYDC 3PO3C 3S15C 1WSVA 4Q5GA 3GIRA 3H0GA 4LOWA 3TTGA 3P9AA 2YU9A 4O26A 4F3EA 1O25A 2Y3PA 1BS2A 4A3LK 4NOLA 3AD8C 4KN7A 3GTKA 3RZOK 1YCLA 4GFQA 2D6FC 3HOXK 5IP7K 1TWCK 2GSNA 2A6HA 4YG2A 4FYDA 3LPXA 5JFEA 1C0AA 1BDFA 1YNJA 1X31C 1AB4A 1J6VA 3K58A 4BBSC 4KB2A 2RGRA 3PO2C 3EQLA 1Q8IA 4MEXA 4BLAA 4P5AA 1TWCA 4A3BC 4ZH4A 4KB4A 1JOEA 3WODA 3GTPC 4WILA 4FM9A 4KMAA 4BY1K 4C3IK 4WJ3M 2R92K 3HOYC 3S2DC 1NH3A 4QCLA 3S15K 3FKIC 4C3HC 4A3CC 2F4QA 2FQOA 3M4AA 5FJ8K 1O2AA 1ZXOA 3CQZC 3ERED 1R9TC 3K5LA 4GTLA 2CW0A 2E2HC 1I6VA 1G51A 2JA6K 1IW7D 1O27A 3BP8C 3A8KA 3QX3A 1TGOA 1YNJD 2R92A 2JA8C 1WIHA 2PHCB 5C4JC 4XLNA 4XSZA 1K83C 1TWFK 1HQMA 1O2FB 3I4NK 1VJEA 1I3QK 2JA6A 4C3JC 3S1QK 4BBSK 1O2BA 4AYBL 4BKWA 3PO2K 3BUEA 4A3BK 3GEEA 1A31A 1ZBSA 1K4TA 1F7VA 2WAQA 1TWFA 1V9MA 1Y698 2A6EA 2Y0SL 4BBRC 4KDDA 1I3QA 1EH1A 4P9SA 2CW0D 3HOYK 4A3CK 5C9HA 4C3HK 4PAAA 1TL8A 2GSUA 3L4JA 2JH3A 4Y52C 1KQ4A 1R9TK 4BY7K 2E2HK 2V6TA 5JVOA 3K7AK 4C2MC 1TWHK 4GTBA 5IOTA 1WCMK 3LF9A 4KARA 5M5WK 3S1MK 1RU0A 1TWAK 3AH5A 3TFIA 5M3MK 2GAGC 3IPJA 4XSXA 4LQYA 3FOFA 3GTOK 4FXDA 4GTFA 4ILDA 1R9TA 3DU5A 4KM8A 2E2IK 5C44C 3GTJC 2WB1A 2R7ZC 4Q5SA 1TWHA 1XZPB 2WAQD 3GTQK 4NOKA 4GTCA 1Y1WK 1WCMA 3HOWC 4A3EC 1V5VA 5C4XK 1R49A 1TWAA 4KC6A 4A3FC 3HOUK 1WQFA 1XXCA 3GTOA 1RRJA 3S2HK 2NVYC 1DCPA 2E2IA 1I50K 5IYCC 4BBRK 1T8IA 2B9SB 1WORA 2NVTC 1USMA 3GTQA 1A35A 3N3YA 4L8IA 1Y1WA 2R93C 1ZYRA 5FLMK 1L0WA 3GTMC 1ZQ1C 1EJ9A 3GEIA 3HKZD 2BE5A 3HOVK 1I50A 4X6AC 1SFOK 3GTGC 4AYBA 5IYBC 4H3TA 4A3JC 2O5JA 3T01A 3MMLB 3WVOA 2WB1D
chains in the Genus database with same CATH topology
4EJ3A 1K83A 1BJTA 1TGOA 3QX3A 4KAWX 1YNJD 2R92A 2Y0SA 5TJ3A 1A36A 3DU6A 2VUMA 3L4KA 4NOMA 3K5MA 1WIHA 2PHCB 3FHZA 5MLC9 5EGEA 1B4AA 5IORA 3K5OA 1SC7A 1SFOA 4C3IC 3S0XA 5IOSA 4BLBA 1F9NA 4Q5VA 3CAGA 3SJRA 2JA6A 2RH6A 5EGHA 2JA5A 4G0WA 4C3JC 1ZVUA 3OPFA 5JSBB 3KYLA 3AQPA 3OREA 1O2BA 4BKWA 3BUEA 5JSNB 4GTEA 3VA7A 4G0UA 1Y1VA 2A69D 1ZYRD 1WQGA 1RR8C 3LAPA 2A6HD 1R5ZA 2GSOA 2KWAA 1A31A 2JA7A 1ZBSA 1TWGA 3K57A 4KMDA 3HKZA 2PMZA 1K4TA 3AQOA 2WAQA 2P5MA 1TWFA 4GTAA 1SEUA 1V9MA 3G4CA 1Y698 1EK8A 4OYDB 4KDDA 1I3QA 2B63A 1EH1A 3FOEA 4G0VA 4J3NA 2CW0D 1B4BA 2O5JD 1IS1A 4LR2A 5C9HA 4C2MA 1TL8A 5CQGA 2NVYA 3OEPA 1K4SA 4Q5GA 3GTLA 2GSUA 3LHPS 5CHPA 3H0GA 2NVXA 2JH3A 3K59A 4KM9A 1KQ4A 3L4JA 4KMHA 3P9AA 3K5NA 3LAJA 5JVOA 4C2MC 1O28A 4D3YA 2YU9A 4O26A 4F3EA 1O25A 2Y3PA 4GTBA 4GT9A 4P5BA 5IOTA 4NOLA 2CFAB 3GTMA 4FZBA 3GTJA 1YNND 3LF9A 3G4AA 1O26A 3GTKA 4GTDA 4KARA 2R7ZA 3Q3QA 2BE5D 4GFQA 2ZFZA 3AH5A 4AHCA 1XXAA 1GE9A 4LQYA 3FOFA 4FXDA 2GSNA 2R4GA 4GTFA 4ILDA 1R9TA 3DU5A 4KM8A 1MIUA 1SMYD 1I6VD 2XCOA 2WB1A 3NUHA 5IOQA 4FYDA 3LPXA 5JFEA 1TWHA 2A68D 3MAQA 4FGUA 1AB4A 1BGWA 1DD5A 4NOKA 1XXBA 3K58A 4M1XA 4GTCA 4IP8A 1WCMA 4KB2A 2RGRA 3V4GA 1R49A 3GTPA 1TWAA 4DDQA 4KC6A 1Q8IA 4KASA 1WQFA 3N0CA 1XXCA 3GTOA 4P5AA 1TWCA 1RRJA 2XCQA 4BLAA 4KB4A 1HQMD 2R93A 2E2IA 4AN8A 2XCRB 1O24A 1T8IA 2B9SB 3FKIA 1O29A 3N0BA 3GTQA 1A35A 4LMOA 4FM9A 3N3YA 4QIWA 4L8IA 4JLRC 4KMAA 1Y1WA 3CQZA 3GTGA 1ISEA 2E2HA 4KATA 1NH3A 4QCLA 4C3HC 2F4QA 4D3ZA 1EJ9A 5CJ9A 3M4AA 1WQHA 1O2AA 1ZXOA 1I50A 3IAYA 2A6ED 4AYBA 3ERED 3K5LA 4IP9A 4GTLA 4H3TA 1LPQA 3MMLB 1IW7D 3WVOA 2CFAA 1O27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5M A;  1BJT A;  3QX3 A;  3LF9 A;  2XCR B;  4KAW X;  1Y69 8;  1EK8 A;  4OYD B;  3MML B;  4KDD A;  4GFQ A;  2ZFZ A;  3L4K A;  1EH1 A;  1XXA A;  1GE9 A;  1WIH A;  2PHC B;  4J3N A;  5MLC 9;  3FHZ A;  3FOF A;  4L8I A;  4JLR C;  1B4B A;  1B4A A;  3FOE A;  4FM9 A;  1IS1 A;  1ISE A;  4G0V A;  2XCO A;  3NUH A;  1F9N A;  3CAG A;  3LPX A;  5CJ9 A;  1BGW A;  3OEP A;  1AB4 A;  1XXB A;  1DD5 A;  1WQH A;  3LHP S;  1ZVU A;  3OPF A;  2Y3P A;  5JSB B;  3L4J A;  3ORE A;  4KB2 A;  2RGR A;  3BUE A;  3V4G A;  3ERE D;  5JSN B;  3LAJ A;  5JVO A;  4G0W A;  3VA7 A;  4G0U A;  4DDQ A;  4KC6 A;  1WQG A;  3LAP A;  1WQF A;  1XXC A;  2KWA A;  2XCQ A;  4KB4 A; 
#chains in the Genus database with same CATH topology
 4EJ3 A;  2E2J K;  1WOS A;  4A3K C;  1IBA A;  1EFW A;  2Y0S A;  3S17 C;  3RZD C;  1J6X A;  2JA7 K;  1TWG K;  5IOR A;  5C44 K;  3K5O A;  1SFO A;  1WSR A;  3S0X A;  4A3M K;  4LK1 A;  4BLB A;  5IYD K;  3PO3 K;  1JVI A;  3SJR A;  2RH6 A;  5L46 A;  3S16 C;  3JST A;  4A93 C;  1WOO A;  3HOW K;  3AQP A;  3KYL A;  4LLG A;  2PA8 L;  4GTE A;  3VA7 A;  4A3F K;  2ZUF A;  1ZYR D;  1SMY A;  3LAP A;  2A6H D;  1R5Z A;  2NVY K;  2JA7 A;  1TWG A;  3BP3 A;  3AQO A;  2PMZ A;  5IYC K;  1I6H C;  2P5M A;  2A68 A;  4XCH A;  3S1R C;  1Y1V C;  3FOE A;  4J3N A;  1PJ6 A;  4A3G C;  2O5J D;  3GTM K;  5HL8 A;  4GZY A;  4LR2 A;  4YFX A;  4YFN A;  2B63 C;  2NVY A;  3OEP A;  1K4S A;  5CHP A;  2VUM C;  3LHP S;  4X6A K;  5IYB K;  2Y0S D;  4KMH A;  3LAJ A;  4LJZ A;  4A3J K;  1O28 A;  4A3K K;  2CFA B;  3H0G C;  3GTM A;  4FZB A;  3G4A A;  4Y7N C;  1O26 A;  4GTD A;  5M5X K;  3GTP K;  3RZD K;  4AHC A;  3HXA A;  2ZUE A;  2YU9 C;  5TMF A;  2R4G A;  3M3Y C;  4G7H A;  1F93 A;  1SMY D;  3M4O C;  1I6V D;  3GTK C;  3NUH A;  3S2D K;  3FKI K;  4A93 K;  2PMZ D;  3A8J A;  1VRQ C;  2A68 D;  4M1X A;  1DD5 A;  3CQZ K;  3V4G A;  3GDZ A;  3GTP A;  4DDQ A;  4KAS A;  3N0C A;  1I6H K;  1WOP A;  1HQM D;  4A3L C;  3GTL C;  2NVX C;  4AN8 A;  4OIQ A;  1O24 A;  3S1R K;  3RZO C;  1Y1V K;  3FKI A;  1O29 A;  1UV7 A;  3N0B A;  2JA8 K;  4A3G K;  4LMO A;  5C4J K;  3HOX C;  1TWC C;  3A8I A;  3SZZ A;  3CQZ A;  1K83 K;  5M5Y K;  1F7U A;  2E2H A;  4G7O A;  4D3Z A;  2VUM K;  1IE0 A;  3AD9 C;  4NOI A;  4C3J K;  5TMC A;  4PAB A;  1YX2 A;  2A6E D;  4G0V A;  2NVQ C;  4OIP A;  4Y7N K;  1K83 A;  4KAW X;  4A3I C;  3DU6 A;  2VUM A;  4NOM A;  4QIW L;  5MLC 9;  5EGE A;  1SC7 A;  4C3I C;  3GTK K;  2P8T A;  1J6W A;  1XPP A;  2R92 C;  1F9N A;  3CAG A;  1JQW A;  1XZP A;  3HOZ C;  4WJ4 A;  1YNN A;  1ZVU A;  4Y52 K;  5JSB B;  3I4M C;  2EBB A;  4OIO A;  4C2M K;  1RR8 C;  3H3V L;  1WQG A;  5C3E C;  2JA6 C;  2KWA A;  1IQ0 A;  2WAQ L;  3GTL K;  3TFH A;  3K57 A;  2NVX K;  4GTA A;  2GAH C;  1INN A;  1SEU A;  5IP9 C;  1EK8 A;  4MEY A;  4BXX C;  2PA8 D;  1B4B A;  3GEH A;  1IW7 A;  3GTJ K;  1TWF C;  2R7Z K;  4C2M A;  3I4N C;  4OIN A;  1I3Q C;  5E68 A;  5EGH A;  5CQG A;  3GTL A;  3S1Q C;  2NVX A;  4KM9 A;  3K59 A;  4A3D C;  1EI6 A;  1VH2 A;  3T00 A;  4A3E K;  2FQT A;  3K5N A;  1DCH A;  2NVQ K;  4D3Y A;  2O5I A;  3S14 C;  1PJ7 A;  4P5B A;  2PPB A;  4GT9 A;  3HKZ L;  3DXJ A;  3S1N C;  2JA5 C;  1VLO A;  3GTJ A;  1YNN D;  4A3I K;  1XZQ B;  2R7Z A;  3Q3Q A;  2NVT K;  2BE5 D;  2ZFZ A;  4O2D A;  4YFK A;  1XXA A;  1GE9 A;  4RMF A;  4AYB D;  4QJV B;  2R93 K;  4LK0 A;  2WB1 L;  4XLP A;  1MIU A;  2XCO A;  3HOZ K;  5D4D A;  5IOQ A;  3TFJ A;  1BGW A;  3MAQ A;  4FGU A;  3I4M K;  1XXB A;  4IP8 A;  2V6U A;  3GTG K;  1HI9 A;  4BY7 C;  2W7V A;  3K7A C;  5C3E K;  2V6S A;  1TWH C;  2XCQ A;  2R93 A;  1XZQ A;  4OIR A;  1WCM C;  5IP9 K;  2XCR B;  3S1M C;  3T02 A;  1TWA C;  3SZY A;  4BXX K;  4QJV A;  3S17 K;  3GTO C;  4QIW A;  4JLR C;  2A69 A;  3GTG A;  2E2I C;  4MQ9 A;  1ISE A;  4KAT A;  1J98 A;  1EQR A;  5CJ9 A;  3S16 K;  3GTQ C;  4A3D K;  1WQH A;  4KN4 A;  4G7Z A;  3IAY A;  3AD7 C;  1Y1W C;  5C4X C;  4IP9 A;  1LPQ A;  3S14 K;  3HOU C;  3S1N K;  2JA5 K;  2CFA A;  3GSI A;  3S2H C;  1I50 C;  1BJT A;  4Q4Z A;  5TJ3 A;  1A36 A;  3L4K A;  3K5M A;  3FHZ A;  1B4A A;  5IP7 C;  5FLM C;  5IOS A;  4Q5V A;  2B63 K;  2JA5 A;  4G0W A;  3HOV C;  3OPF A;  3ORE A;  1SFO C;  5JSN B;  4QIW D;  4G0U A;  1Y1V A;  2A69 D;  1DCO A;  2PMZ L;  2GSO A;  4C45 A;  1IL2 A;  4KMD A;  3H0G K;  3HKZ A;  1PJ5 A;  2E2J C;  4JK1 A;  3G4C A;  4OYD B;  4KMU A;  3ADA C;  2B63 A;  2YU9 K;  2JA7 C;  3M3Y K;  1TWG C;  1USO A;  1VGX A;  4BY1 C;  1IS1 A;  5M3F K;  3M4O K;  4A3M C;  3H3V D;  4AH6 A;  5IYD C;  3PO3 C;  3S15 C;  1WSV A;  4Q5G A;  3GIR A;  3H0G A;  4LOW A;  3TTG A;  3P9A A;  2YU9 A;  4O26 A;  4F3E A;  1O25 A;  2Y3P A;  1BS2 A;  4A3L K;  4NOL A;  3AD8 C;  4KN7 A;  3GTK A;  3RZO K;  1YCL A;  4GFQ A;  2D6F C;  3HOX K;  5IP7 K;  1TWC K;  2GSN A;  2A6H A;  4YG2 A;  4FYD A;  3LPX A;  5JFE A;  1C0A A;  1BDF A;  1YNJ A;  1X31 C;  1AB4 A;  1J6V A;  3K58 A;  4BBS C;  4KB2 A;  2RGR A;  3PO2 C;  3EQL A;  1Q8I A;  4MEX A;  4BLA A;  4P5A A;  1TWC A;  4A3B C;  4ZH4 A;  4KB4 A;  1JOE A;  3WOD A;  3GTP C;  4WIL A;  4FM9 A;  4KMA A;  4BY1 K;  4C3I K;  4WJ3 M;  2R92 K;  3HOY C;  3S2D C;  1NH3 A;  4QCL A;  3S15 K;  3FKI C;  4C3H C;  4A3C C;  2F4Q A;  2FQO A;  3M4A A;  5FJ8 K;  1O2A A;  1ZXO A;  3CQZ C;  3ERE D;  1R9T C;  3K5L A;  4GTL A;  2CW0 A;  2E2H C;  1I6V A;  1G51 A;  2JA6 K;  1IW7 D;  1O27 A;  3BP8 C;  3A8K A;  3QX3 A;  1TGO A;  1YNJ D;  2R92 A;  2JA8 C;  1WIH A;  2PHC B;  5C4J C;  4XLN A;  4XSZ A;  1K83 C;  1TWF K;  1HQM A;  1O2F B;  3I4N K;  1VJE A;  1I3Q K;  2JA6 A;  4C3J C;  3S1Q K;  4BBS K;  1O2B A;  4AYB L;  4BKW A;  3PO2 K;  3BUE A;  4A3B K;  3GEE A;  1A31 A;  1ZBS A;  1K4T A;  1F7V A;  2WAQ A;  1TWF A;  1V9M A;  1Y69 8;  2A6E A;  2Y0S L;  4BBR C;  4KDD A;  1I3Q A;  1EH1 A;  4P9S A;  2CW0 D;  3HOY K;  4A3C K;  5C9H A;  4C3H K;  4PAA A;  1TL8 A;  2GSU A;  3L4J A;  2JH3 A;  4Y52 C;  1KQ4 A;  1R9T K;  4BY7 K;  2E2H K;  2V6T A;  5JVO A;  3K7A K;  4C2M C;  1TWH K;  4GTB A;  5IOT A;  1WCM K;  3LF9 A;  4KAR A;  5M5W K;  3S1M K;  1RU0 A;  1TWA K;  3AH5 A;  3TFI A;  5M3M K;  2GAG C;  3IPJ A;  4XSX A;  4LQY A;  3FOF A;  3GTO K;  4FXD A;  4GTF A;  4ILD A;  1R9T A;  3DU5 A;  4KM8 A;  2E2I K;  5C44 C;  3GTJ C;  2WB1 A;  2R7Z C;  4Q5S A;  1TWH A;  1XZP B;  2WAQ D;  3GTQ K;  4NOK A;  4GTC A;  1Y1W K;  1WCM A;  3HOW C;  4A3E C;  1V5V A;  5C4X K;  1R49 A;  1TWA A;  4KC6 A;  4A3F C;  3HOU K;  1WQF A;  1XXC A;  3GTO A;  1RRJ A;  3S2H K;  2NVY C;  1DCP A;  2E2I A;  1I50 K;  5IYC C;  4BBR K;  1T8I A;  2B9S B;  1WOR A;  2NVT C;  1USM A;  3GTQ A;  1A35 A;  3N3Y A;  4L8I A;  1Y1W A;  2R93 C;  1ZYR A;  5FLM K;  1L0W A;  3GTM C;  1ZQ1 C;  1EJ9 A;  3GEI A;  3HKZ D;  2BE5 A;  3HOV K;  1I50 A;  4X6A C;  1SFO K;  3GTG C;  4AYB A;  5IYB C;  4H3T A;  4A3J C;  2O5J A;  3T01 A;  3MML B;  3WVO A;  2WB1 D; 
#chains in the Genus database with same CATH homology
 4EJ3 A;  1K83 A;  1BJT A;  1TGO A;  3QX3 A;  4KAW X;  1YNJ D;  2R92 A;  2Y0S A;  5TJ3 A;  1A36 A;  3DU6 A;  2VUM A;  3L4K A;  4NOM A;  3K5M A;  1WIH A;  2PHC B;  3FHZ A;  5MLC 9;  5EGE A;  1B4A A;  5IOR A;  3K5O A;  1SC7 A;  1SFO A;  4C3I C;  3S0X A;  5IOS A;  4BLB A;  1F9N A;  4Q5V A;  3CAG A;  3SJR A;  2JA6 A;  2RH6 A;  5EGH A;  2JA5 A;  4G0W A;  4C3J C;  1ZVU A;  3OPF A;  5JSB B;  3KYL A;  3AQP A;  3ORE A;  1O2B A;  4BKW A;  3BUE A;  5JSN B;  4GTE A;  3VA7 A;  4G0U A;  1Y1V A;  2A69 D;  1ZYR D;  1WQG A;  1RR8 C;  3LAP A;  2A6H D;  1R5Z A;  2GSO A;  2KWA A;  1A31 A;  2JA7 A;  1ZBS A;  1TWG A;  3K57 A;  4KMD A;  3HKZ A;  2PMZ A;  1K4T A;  3AQO A;  2WAQ A;  2P5M A;  1TWF A;  4GTA A;  1SEU A;  1V9M A;  3G4C A;  1Y69 8;  1EK8 A;  4OYD B;  4KDD A;  1I3Q A;  2B63 A;  1EH1 A;  3FOE A;  4G0V A;  4J3N A;  2CW0 D;  1B4B A;  2O5J D;  1IS1 A;  4LR2 A;  5C9H A;  4C2M A;  1TL8 A;  5CQG A;  2NVY A;  3OEP A;  1K4S A;  4Q5G A;  3GTL A;  2GSU A;  3LHP S;  5CHP A;  3H0G A;  2NVX A;  2JH3 A;  3K59 A;  4KM9 A;  1KQ4 A;  3L4J A;  4KMH A;  3P9A A;  3K5N A;  3LAJ A;  5JVO A;  4C2M C;  1O28 A;  4D3Y A;  2YU9 A;  4O26 A;  4F3E A;  1O25 A;  2Y3P A;  4GTB A;  4GT9 A;  4P5B A;  5IOT A;  4NOL A;  2CFA B;  3GTM A;  4FZB A;  3GTJ A;  1YNN D;  3LF9 A;  3G4A A;  1O26 A;  3GTK A;  4GTD A;  4KAR A;  2R7Z A;  3Q3Q A;  2BE5 D;  4GFQ A;  2ZFZ A;  3AH5 A;  4AHC A;  1XXA A;  1GE9 A;  4LQY A;  3FOF A;  4FXD A;  2GSN A;  2R4G A;  4GTF A;  4ILD A;  1R9T A;  3DU5 A;  4KM8 A;  1MIU A;  1SMY D;  1I6V D;  2XCO A;  2WB1 A;  3NUH A;  5IOQ A;  4FYD A;  3LPX A;  5JFE A;  1TWH A;  2A68 D;  3MAQ A;  4FGU A;  1AB4 A;  1BGW A;  1DD5 A;  4NOK A;  1XXB A;  3K58 A;  4M1X A;  4GTC A;  4IP8 A;  1WCM A;  4KB2 A;  2RGR A;  3V4G A;  1R49 A;  3GTP A;  1TWA A;  4DDQ A;  4KC6 A;  1Q8I A;  4KAS A;  1WQF A;  3N0C A;  1XXC A;  3GTO A;  4P5A A;  1TWC A;  1RRJ A;  2XCQ A;  4BLA A;  4KB4 A;  1HQM D;  2R93 A;  2E2I A;  4AN8 A;  2XCR B;  1O24 A;  1T8I A;  2B9S B;  3FKI A;  1O29 A;  3N0B A;  3GTQ A;  1A35 A;  4LMO A;  4FM9 A;  3N3Y A;  4QIW A;  4L8I A;  4JLR C;  4KMA A;  1Y1W A;  3CQZ A;  3GTG A;  1ISE A;  2E2H A;  4KAT A;  1NH3 A;  4QCL A;  4C3H C;  2F4Q A;  4D3Z A;  1EJ9 A;  5CJ9 A;  3M4A A;  1WQH A;  1O2A A;  1ZXO A;  1I50 A;  3IAY A;  2A6E D;  4AYB A;  3ERE D;  3K5L A;  4IP9 A;  4GTL A;  4H3T A;  1LPQ A;  3MML B;  1IW7 D;  3WVO A;  2CFA A;  1O27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...