1IS1A

Crystal structure of ribosome recycling factor from vibrio parahaemolyticus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
185
structure length
185
Chain Sequence
MINEIKKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEYYGAATPLNQVANVVAEDARTLAITVFDKELTQKVEKAIMMSDLGLNPMSAGTIIRVPLPPLTEERRKDLVKIVRGEAEGGRVAVRNIRRDANNDLKALLKDKEISEDEDRKAQEEIQKLTDVAVKKIDEVLAAKEKELMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and binding mode of a ribosome recycling factor (RRF) from mesophilic bacterium
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Translation
molecule keywords RIBOSOME RECYCLING FACTOR
total genus 68
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1is1A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1is1A02
1BGWA 1B4AA 1XXAA 4G0VA 4DDQA 4G0UA 3V4GA 1ISEA 1WQGA 1XXBA 3OPFA 5CJ9A 1WQFA 1XXCA 5JVOA 4GFQA 1B4BA 5JSNB 1BJTA 4KAWX 3LAPA 3LPXA 1WQHA 3OREA 5JSBB 2XCRB 3FOEA 3BUEA 3L4JA 3QX3A 4KB2A 2P5MA 2KWAA 2ZFZA 3LAJA 3FHZA 4G0WA 4JLRC 3LHPS 2XCOA 4L8IA 4KB4A 3FOFA 3L4KA 1GE9A 3NUHA 1AB4A 4FM9A 2RGRA 1EK8A 4J3NA 4KC6A 2Y3PA 5MLC9 4KDDA 3CAGA 4OYDB 1Y698 1F9NA 1WIHA 3VA7A 1ZVUA 3LF9A 3OEPA 3ERED 2PHCB 1DD5A 1IS1A 3MMLB 2XCQA 1EH1A
chains in the Genus database with same CATH superfamily
2YU9C 1TGOA 3IAYA 1K83K 2YU9A 1YCLA 4G7ZA 2R92C 2JA8C 4A3LK 3TFHA 1WQFA 1J6VA 4C3HK 3MAQA 3P9AA 3S1RK 3BUEA 1VJEA 3TTGA 1IW7A 1IE0A 3AQPA 4XLNA 2NVTC 4OIRA 1A31A 1TWGC 2Y0SA 1EFWA 2E2HC 2RGRA 3HKZA 4NOLA 5HL8A 3S1NC 5IYDK 3HXAA 2VUMK 4Q4ZA 3GTJK 1DD5A 2WB1L 1SEUA 3DXJA 4LMOA 2GAHC 4ZH4A 1SFOC 3M4OC 2JA6A 5C9HA 3GDZA 3FKIC 4NOIA 2A6ED 3HOVK 1L0WA 3FKIA 2XCRB 1HI9A 1YNNA 4JK1A 4RMFA 1MIUA 4KMDA 1V5VA 1UV7A 4P5AA 1TWHA 3NUHA 4KC6A 2Y3PA 4BXXK 1SMYA 2A69A 4Y52C 5TMCA 1O27A 3PO2K 3S1QK 2CFAB 3LF9A 5JFEA 4BY7C 4GT9A 2B63A 4GTFA 2WAQD 4Y7NK 3HOVC 2YU9K 3K59A 4A3IC 3TFIA 1TWHC 2NVQK 1IBAA 5D4DA 4BKWA 1XPPA 2KWAA 5CQGA 4C3JC 4FM9A 1Y1VC 3S14C 3K7AK 4OINA 3G4CA 5IYDC 3S1NK 4BY7K 4GTBA 3WODA 4A3CK 3K5MA 3N0BA 2R4GA 1SC7A 1C0AA 3OEPA 4A93C 1VRQC 3ADAC 4WILA 1TWAA 4XSXA 2GSNA 3MMLB 1SFOA 2D6FC 5IYBK 4BLAA 4G0UA 5JVOA 4KARA 1NH3A 2E2HA 3RZDC 1F7UA 1VGXA 3OREA 1Q8IA 3FKIK 4BBSK 3QX3A 1O24A 5M5WK 5C3EK 2R7ZC 4JLRC 3KYLA 3HOYK 5EGEA 4GZYA 2ZUFA 4D3ZA 3EQLA 1KQ4A 3G4AA 5IYBC 3PO3C 1A35A 4KMAA 2Y0SD 3K5LA 1I6VA 1F7VA 5M5YK 4A3DC 1ZYRD 1I3QK 1ZXOA 2PHCB 1XZPB 3GTPC 3S16C 2GSUA 1B4AA 3CQZK 1XXAA 1ZBSA 4AYBL 4P5BA 5FJ8K 2JH3A 2A6HD 3LAPA 1B4BA 1YNJD 5EGHA 5FLMK 1R9TK 1VH2A 3Q3QA 4A3LC 4KB2A 2P5MA 1K83C 1ZYRA 4KB4A 3K57A 3HOWC 1TWFC 1JQWA 3GTLA 4IP9A 4A3BC 3AQOA 4BBRC 5FLMC 1I6HC 4A3EC 3CQZC 3SJRA 2R92A 3S2DC 3GEHA 3IPJA 4A3CC 4A3MC 3AD7C 4C2MA 4C3IK 3LHPS 1R5ZA 3GTLC 1TWCK 2E2IC 1GE9A 4YG2A 1AB4A 5IP7K 4AYBA 4PAAA 4BY1K 3S15C 3DU5A 5TMFA 4G7HA 1O2FB 4GTDA 4AYBD 1TWAK 2B63C 3HOUC 1BS2A 2R7ZK 1XZPA 1J98A 3GEEA 5IP9C 3S1MC 4C45A 4D3YA 1TWGK 2WAQA 4Q5VA 5TJ3A 2PMZD 1WSRA 2RH6A 1RU0A 1IL2A 4LJZA 2XCOA 3FOFA 1PJ6A 2PMZA 3HOZC 3K7AC 4A3DK 2BE5D 2R7ZA 4KATA 3GTKC 1RR8C 1WCMK 3GTGA 4MQ9A 4A3GK 3M4OK 3JSTA 2NVXA 1R49A 1INNA 3S2HC 4XSZA 2BE5A 1DCOA 4H3TA 4GFQA 1SMYD 5JSNB 4A3FK 5IORA 3HOYC 2WB1A 3L4JA 4QJVB 4G0WA 2E2JC 2A68D 3WVOA 4KN4A 2PA8L 4BBSC 4L8IA 1TL8A 3L4KA 1WCMC 1Y1VA 4BY1C 1I6VD 4AN8A 3K58A 4KMHA 1J6XA 4KMUA 4QCLA 4C3IC 3GTLK 1O2AA 3RZOK 1IW7D 2FQOA 1V9MA 1Y1VK 3S14K 4DDQA 1EH1A 4YFXA 2JA5C 1BGWA 1USOA 1EJ9A 3GTPK 4LOWA 3S2DK 1F93A 1WOOA 3A8IA 3S17C 1JOEA 3AH5A 5CHPA 1TWAC 1SFOK 3GTMA 2B63K 3HOUK 3H0GA 4OIOA 4QIWA 3GTQC 3CQZA 4KM8A 5M3MK 2CW0A 3I4NK 3T01A 3GTPA 1WORA 3TFJA 1YNJA 1WIHA 3RZDK 4MEXA 1A36A 1O25A 3RZOC 4X6AC 4P9SA 3S1QC 2WB1D 1WOPA 1TWCC 2E2IK 3PO2C 2JA6K 3I4MK 3HKZL 2JA8K 5C4JC 4A3MK 4G7OA 1WOSA 5CJ9A 4A3FC 1BJTA 1I3QA 3GTMC 3A8JA 3S2HK 1RRJA 2JA7A 2A68A 3GIRA 4BLBA 1EK8A 2FQTA 3GTOC 2R93C 1ZQ1C 1I50C 4NOMA 1R9TC 2CFAA 1F9NA 2VUMC 5IOTA 2WAQL 1K4TA 4FYDA 2PPBA 4GTEA 1I50A 3S16K 1X31C 4AHCA 3K5NA 4C2MK 1ISEA 1XXBA 2A6EA 3S1RC 4Y52K 3GTQA 3FHZA 2R92K 3GTJA 2GSOA 4O26A 3BP3A 4YFKA 3HOXC 1TWCA 3H3VL 3HKZD 3ERED 5M3FK 3AD8C 4F3EA 1PJ7A 2F4QA 4LR2A 1EI6A 1TWHK 2GAGC 5IYCC 2NVXK 4A3GC 3M3YC 3OPFA 3AD9C 1O26A 1HQMD 2V6SA 5JSBB 2NVYK 4A3KC 1TWFA 4KASA 3LAJA 3M4AA 1PJ5A 4ILDA 1EQRA 3GTOA 1USMA 5C4JK 2W7VA 4A93K 1IQ0A 2NVXC 1DCPA 2O5IA 4QIWL 4YFNA 4A3KK 1IS1A 1O2BA 2JA5A 3SZYA 4A3BK 4AH6A 4Y7NC 3GTKA 2A6HA 1HQMA 3GSIA 3HOWK 3V4GA 2ZUEA 2NVYA 3H0GK 3LPXA 1XZQA 1R9TA 5E68A 1K4SA 3BP8C 5IP7C 4LK0A 3DU6A 4J3NA 3SZZA 4WJ4A 3A8KA 5C4XC 4WJ3M 3PO3K 1ZVUA 4KM9A 3GTGC 4OIPA 1I3QC 1LPQA 3H0GC 2PMZL 2EBBA 4LQYA 4KN7A 4C2MC 5IOQA 5C44K 2Y0SL 5M5XK 3T02A 3N0CA 4OIQA 1XXCA 4GTLA 4EJ3A 5L46A 4NOKA 2CW0D 3FOEA 1O28A 1VLOA 1WSVA 3HOXK 1T8IA 1TWFK 2ZFZA 4FXDA 1XZQB 2V6TA 2V6UA 3GTMK 3GEIA 1I50K 2R93K 1O29A 4XCHA 3K5OA 5C44C 3GTGK 2B9SB 1WCMA 2A69D 4KDDA 3CAGA 1Y1WC 4Q5GA 3HOZK 2NVYC 3H3VD 2P8TA 2PA8D 2NVTK 3GTKK 2JA7K 3M3YK 4LLGA 4G0VA 3I4MC 3I4NC 4MEYA 4GTAA 1G51A 4C3HC 4KAWX 1Y1WK 1WQHA 4M1XA 4X6AK 3GTQK 1DCHA 4XLPA 2E2IA 3S0XA 3S1MK 5IP9K 4A3IK 4PABA 5MLC9 4A3JK 4Q5SA 4OYDB 3VA7A 4FZBA 3S15K 4BXXC 2O5JA 1Y1WA 2VUMA 4GTCA 2XCQA 2JA6C 1YNND 2R93A 4QIWD 2O5JD 3S17K 1WQGA 4LK1A 2JA7C 2JA5K 4QJVA 5C4XK 4FGUA 5IYCK 1TWGA 1BDFA 1YX2A 5IOSA 1I6HK 1K83A 4BBRK 4C3JK 3GTOK 3N3YA 1JVIA 3T00A 4A3EK 3GTJC 4A3JC 2NVQC 1Y698 4O2DA 5C3EC 2E2JK 1J6WA 4IP8A 2E2HK
chains in the Genus database with same CATH topology
1TGOA 3IAYA 2GSUA 1BGWA 2YU9A 1EJ9A 3GTKA 1B4AA 1XXAA 1ZBSA 4P5BA 4DDQA 3V4GA 2JH3A 3AH5A 5CHPA 1WQFA 2A6HD 3LAPA 3GTMA 2NVYA 1YNJD 3MAQA 3P9AA 1B4BA 3LPXA 3H0GA 5EGHA 3Q3QA 3BUEA 4KB2A 2P5MA 4QIWA 3AQPA 3CQZA 1R9TA 1K4SA 4KB4A 4KM8A 1A31A 2Y0SA 2RGRA 3HKZA 3DU6A 4J3NA 4NOLA 3K57A 3GTPA 3GTLA 4IP9A 1WIHA 1ZVUA 4KM9A 1A36A 1DD5A 1O25A 3AQOA 1SEUA 4LMOA 1LPQA 4LQYA 2JA6A 4C2MC 5C9HA 5IOQA 3SJRA 2R92A 5CJ9A 3N0CA 1XXCA 2A6ED 4GTLA 4EJ3A 1BJTA 4NOKA 3FKIA 1I3QA 2CW0D 3FOEA 1O28A 2XCRB 1T8IA 2ZFZA 1MIUA 4C2MA 4FXDA 3LHPS 1R5ZA 1RRJA 2JA7A 4KMDA 4P5AA 1TWHA 1GE9A 3NUHA 1AB4A 4BLBA 1EK8A 4AYBA 3K5OA 1O29A 4KC6A 1WCMA 2B9SB 2Y3PA 2A69D 3DU5A 4KDDA 4NOMA 1O27A 3CAGA 1O2BA 2CFAA 1F9NA 4GTDA 2CFAB 3LF9A 5JFEA 4GT9A 4Q5GA 5IOTA 2B63A 1K4TA 4FYDA 4GTFA 4GTEA 1I50A 4AHCA 4G0VA 3K5NA 4D3YA 1ISEA 3K59A 1XXBA 4GTAA 4C3HC 4KAWX 1WQHA 4M1XA 2WAQA 4Q5VA 5TJ3A 4BKWA 3GTQA 2KWAA 2RH6A 3FHZA 5CQGA 3GTJA 2GSOA 4O26A 2XCOA 4C3JC 3FOFA 2E2IA 3S0XA 4FM9A 2PMZA 3G4CA 4GTBA 1TWCA 2BE5D 5MLC9 2R4GA 3K5MA 2R7ZA 3N0BA 4KATA 4OYDB 1SC7A 1RR8C 4FZBA 3VA7A 1Y1WA 3OEPA 2VUMA 3ERED 1TWAA 3GTGA 2GSNA 4GTCA 3MMLB 4F3EA 1SFOA 2XCQA 1YNND 2F4QA 2R93A 4LR2A 2O5JD 2NVXA 1R49A 4BLAA 4G0UA 5JVOA 1WQGA 3OPFA 4KARA 1NH3A 4H3TA 4GFQA 2E2HA 1SMYD 5JSNB 1O26A 3OREA 1HQMD 1Q8IA 2WB1A 5JSBB 5IORA 3L4JA 4FGUA 1TWFA 1O24A 4KASA 3LAJA 3QX3A 4G0WA 2A68D 3WVOA 3M4AA 4JLRC 4ILDA 1TWGA 4L8IA 3KYLA 5IOSA 1TL8A 1K83A 5EGEA 3L4KA 3GTOA 3N3YA 1Y1VA 4D3ZA 1I6VD 4AN8A 1KQ4A 3K58A 3G4AA 4KMHA 1A35A 4KMAA 3K5LA 4QCLA 1Y698 4C3IC 1ZYRD 1O2AA 1ZXOA 2PHCB 1IW7D 1V9MA 1IS1A 4IP8A 2JA5A 1EH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGW A;  1B4A A;  1XXA A;  4G0V A;  4DDQ A;  4G0U A;  3V4G A;  1ISE A;  1WQG A;  1XXB A;  3OPF A;  5CJ9 A;  1WQF A;  1XXC A;  5JVO A;  4GFQ A;  1B4B A;  5JSN B;  1BJT A;  4KAW X;  3LAP A;  3LPX A;  1WQH A;  3ORE A;  5JSB B;  2XCR B;  3FOE A;  3BUE A;  3L4J A;  3QX3 A;  4KB2 A;  2P5M A;  2KWA A;  2ZFZ A;  3LAJ A;  3FHZ A;  4G0W A;  4JLR C;  3LHP S;  2XCO A;  4L8I A;  4KB4 A;  3FOF A;  3L4K A;  1GE9 A;  3NUH A;  1AB4 A;  4FM9 A;  2RGR A;  1EK8 A;  4J3N A;  4KC6 A;  2Y3P A;  5MLC 9;  4KDD A;  3CAG A;  4OYD B;  1Y69 8;  1F9N A;  1WIH A;  3VA7 A;  1ZVU A;  3LF9 A;  3OEP A;  3ERE D;  2PHC B;  1DD5 A;  1IS1 A;  3MML B;  2XCQ A;  1EH1 A; 
#chains in the Genus database with same CATH topology
 2YU9 C;  1TGO A;  3IAY A;  1K83 K;  2YU9 A;  1YCL A;  4G7Z A;  2R92 C;  2JA8 C;  4A3L K;  3TFH A;  1WQF A;  1J6V A;  4C3H K;  3MAQ A;  3P9A A;  3S1R K;  3BUE A;  1VJE A;  3TTG A;  1IW7 A;  1IE0 A;  3AQP A;  4XLN A;  2NVT C;  4OIR A;  1A31 A;  1TWG C;  2Y0S A;  1EFW A;  2E2H C;  2RGR A;  3HKZ A;  4NOL A;  5HL8 A;  3S1N C;  5IYD K;  3HXA A;  2VUM K;  4Q4Z A;  3GTJ K;  1DD5 A;  2WB1 L;  1SEU A;  3DXJ A;  4LMO A;  2GAH C;  4ZH4 A;  1SFO C;  3M4O C;  2JA6 A;  5C9H A;  3GDZ A;  3FKI C;  4NOI A;  2A6E D;  3HOV K;  1L0W A;  3FKI A;  2XCR B;  1HI9 A;  1YNN A;  4JK1 A;  4RMF A;  1MIU A;  4KMD A;  1V5V A;  1UV7 A;  4P5A A;  1TWH A;  3NUH A;  4KC6 A;  2Y3P A;  4BXX K;  1SMY A;  2A69 A;  4Y52 C;  5TMC A;  1O27 A;  3PO2 K;  3S1Q K;  2CFA B;  3LF9 A;  5JFE A;  4BY7 C;  4GT9 A;  2B63 A;  4GTF A;  2WAQ D;  4Y7N K;  3HOV C;  2YU9 K;  3K59 A;  4A3I C;  3TFI A;  1TWH C;  2NVQ K;  1IBA A;  5D4D A;  4BKW A;  1XPP A;  2KWA A;  5CQG A;  4C3J C;  4FM9 A;  1Y1V C;  3S14 C;  3K7A K;  4OIN A;  3G4C A;  5IYD C;  3S1N K;  4BY7 K;  4GTB A;  3WOD A;  4A3C K;  3K5M A;  3N0B A;  2R4G A;  1SC7 A;  1C0A A;  3OEP A;  4A93 C;  1VRQ C;  3ADA C;  4WIL A;  1TWA A;  4XSX A;  2GSN A;  3MML B;  1SFO A;  2D6F C;  5IYB K;  4BLA A;  4G0U A;  5JVO A;  4KAR A;  1NH3 A;  2E2H A;  3RZD C;  1F7U A;  1VGX A;  3ORE A;  1Q8I A;  3FKI K;  4BBS K;  3QX3 A;  1O24 A;  5M5W K;  5C3E K;  2R7Z C;  4JLR C;  3KYL A;  3HOY K;  5EGE A;  4GZY A;  2ZUF A;  4D3Z A;  3EQL A;  1KQ4 A;  3G4A A;  5IYB C;  3PO3 C;  1A35 A;  4KMA A;  2Y0S D;  3K5L A;  1I6V A;  1F7V A;  5M5Y K;  4A3D C;  1ZYR D;  1I3Q K;  1ZXO A;  2PHC B;  1XZP B;  3GTP C;  3S16 C;  2GSU A;  1B4A A;  3CQZ K;  1XXA A;  1ZBS A;  4AYB L;  4P5B A;  5FJ8 K;  2JH3 A;  2A6H D;  3LAP A;  1B4B A;  1YNJ D;  5EGH A;  5FLM K;  1R9T K;  1VH2 A;  3Q3Q A;  4A3L C;  4KB2 A;  2P5M A;  1K83 C;  1ZYR A;  4KB4 A;  3K57 A;  3HOW C;  1TWF C;  1JQW A;  3GTL A;  4IP9 A;  4A3B C;  3AQO A;  4BBR C;  5FLM C;  1I6H C;  4A3E C;  3CQZ C;  3SJR A;  2R92 A;  3S2D C;  3GEH A;  3IPJ A;  4A3C C;  4A3M C;  3AD7 C;  4C2M A;  4C3I K;  3LHP S;  1R5Z A;  3GTL C;  1TWC K;  2E2I C;  1GE9 A;  4YG2 A;  1AB4 A;  5IP7 K;  4AYB A;  4PAA A;  4BY1 K;  3S15 C;  3DU5 A;  5TMF A;  4G7H A;  1O2F B;  4GTD A;  4AYB D;  1TWA K;  2B63 C;  3HOU C;  1BS2 A;  2R7Z K;  1XZP A;  1J98 A;  3GEE A;  5IP9 C;  3S1M C;  4C45 A;  4D3Y A;  1TWG K;  2WAQ A;  4Q5V A;  5TJ3 A;  2PMZ D;  1WSR A;  2RH6 A;  1RU0 A;  1IL2 A;  4LJZ A;  2XCO A;  3FOF A;  1PJ6 A;  2PMZ A;  3HOZ C;  3K7A C;  4A3D K;  2BE5 D;  2R7Z A;  4KAT A;  3GTK C;  1RR8 C;  1WCM K;  3GTG A;  4MQ9 A;  4A3G K;  3M4O K;  3JST A;  2NVX A;  1R49 A;  1INN A;  3S2H C;  4XSZ A;  2BE5 A;  1DCO A;  4H3T A;  4GFQ A;  1SMY D;  5JSN B;  4A3F K;  5IOR A;  3HOY C;  2WB1 A;  3L4J A;  4QJV B;  4G0W A;  2E2J C;  2A68 D;  3WVO A;  4KN4 A;  2PA8 L;  4BBS C;  4L8I A;  1TL8 A;  3L4K A;  1WCM C;  1Y1V A;  4BY1 C;  1I6V D;  4AN8 A;  3K58 A;  4KMH A;  1J6X A;  4KMU A;  4QCL A;  4C3I C;  3GTL K;  1O2A A;  3RZO K;  1IW7 D;  2FQO A;  1V9M A;  1Y1V K;  3S14 K;  4DDQ A;  1EH1 A;  4YFX A;  2JA5 C;  1BGW A;  1USO A;  1EJ9 A;  3GTP K;  4LOW A;  3S2D K;  1F93 A;  1WOO A;  3A8I A;  3S17 C;  1JOE A;  3AH5 A;  5CHP A;  1TWA C;  1SFO K;  3GTM A;  2B63 K;  3HOU K;  3H0G A;  4OIO A;  4QIW A;  3GTQ C;  3CQZ A;  4KM8 A;  5M3M K;  2CW0 A;  3I4N K;  3T01 A;  3GTP A;  1WOR A;  3TFJ A;  1YNJ A;  1WIH A;  3RZD K;  4MEX A;  1A36 A;  1O25 A;  3RZO C;  4X6A C;  4P9S A;  3S1Q C;  2WB1 D;  1WOP A;  1TWC C;  2E2I K;  3PO2 C;  2JA6 K;  3I4M K;  3HKZ L;  2JA8 K;  5C4J C;  4A3M K;  4G7O A;  1WOS A;  5CJ9 A;  4A3F C;  1BJT A;  1I3Q A;  3GTM C;  3A8J A;  3S2H K;  1RRJ A;  2JA7 A;  2A68 A;  3GIR A;  4BLB A;  1EK8 A;  2FQT A;  3GTO C;  2R93 C;  1ZQ1 C;  1I50 C;  4NOM A;  1R9T C;  2CFA A;  1F9N A;  2VUM C;  5IOT A;  2WAQ L;  1K4T A;  4FYD A;  2PPB A;  4GTE A;  1I50 A;  3S16 K;  1X31 C;  4AHC A;  3K5N A;  4C2M K;  1ISE A;  1XXB A;  2A6E A;  3S1R C;  4Y52 K;  3GTQ A;  3FHZ A;  2R92 K;  3GTJ A;  2GSO A;  4O26 A;  3BP3 A;  4YFK A;  3HOX C;  1TWC A;  3H3V L;  3HKZ D;  3ERE D;  5M3F K;  3AD8 C;  4F3E A;  1PJ7 A;  2F4Q A;  4LR2 A;  1EI6 A;  1TWH K;  2GAG C;  5IYC C;  2NVX K;  4A3G C;  3M3Y C;  3OPF A;  3AD9 C;  1O26 A;  1HQM D;  2V6S A;  5JSB B;  2NVY K;  4A3K C;  1TWF A;  4KAS A;  3LAJ A;  3M4A A;  1PJ5 A;  4ILD A;  1EQR A;  3GTO A;  1USM A;  5C4J K;  2W7V A;  4A93 K;  1IQ0 A;  2NVX C;  1DCP A;  2O5I A;  4QIW L;  4YFN A;  4A3K K;  1IS1 A;  1O2B A;  2JA5 A;  3SZY A;  4A3B K;  4AH6 A;  4Y7N C;  3GTK A;  2A6H A;  1HQM A;  3GSI A;  3HOW K;  3V4G A;  2ZUE A;  2NVY A;  3H0G K;  3LPX A;  1XZQ A;  1R9T A;  5E68 A;  1K4S A;  3BP8 C;  5IP7 C;  4LK0 A;  3DU6 A;  4J3N A;  3SZZ A;  4WJ4 A;  3A8K A;  5C4X C;  4WJ3 M;  3PO3 K;  1ZVU A;  4KM9 A;  3GTG C;  4OIP A;  1I3Q C;  1LPQ A;  3H0G C;  2PMZ L;  2EBB A;  4LQY A;  4KN7 A;  4C2M C;  5IOQ A;  5C44 K;  2Y0S L;  5M5X K;  3T02 A;  3N0C A;  4OIQ A;  1XXC A;  4GTL A;  4EJ3 A;  5L46 A;  4NOK A;  2CW0 D;  3FOE A;  1O28 A;  1VLO A;  1WSV A;  3HOX K;  1T8I A;  1TWF K;  2ZFZ A;  4FXD A;  1XZQ B;  2V6T A;  2V6U A;  3GTM K;  3GEI A;  1I50 K;  2R93 K;  1O29 A;  4XCH A;  3K5O A;  5C44 C;  3GTG K;  2B9S B;  1WCM A;  2A69 D;  4KDD A;  3CAG A;  1Y1W C;  4Q5G A;  3HOZ K;  2NVY C;  3H3V D;  2P8T A;  2PA8 D;  2NVT K;  3GTK K;  2JA7 K;  3M3Y K;  4LLG A;  4G0V A;  3I4M C;  3I4N C;  4MEY A;  4GTA A;  1G51 A;  4C3H C;  4KAW X;  1Y1W K;  1WQH A;  4M1X A;  4X6A K;  3GTQ K;  1DCH A;  4XLP A;  2E2I A;  3S0X A;  3S1M K;  5IP9 K;  4A3I K;  4PAB A;  5MLC 9;  4A3J K;  4Q5S A;  4OYD B;  3VA7 A;  4FZB A;  3S15 K;  4BXX C;  2O5J A;  1Y1W A;  2VUM A;  4GTC A;  2XCQ A;  2JA6 C;  1YNN D;  2R93 A;  4QIW D;  2O5J D;  3S17 K;  1WQG A;  4LK1 A;  2JA7 C;  2JA5 K;  4QJV A;  5C4X K;  4FGU A;  5IYC K;  1TWG A;  1BDF A;  1YX2 A;  5IOS A;  1I6H K;  1K83 A;  4BBR K;  4C3J K;  3GTO K;  3N3Y A;  1JVI A;  3T00 A;  4A3E K;  3GTJ C;  4A3J C;  2NVQ C;  1Y69 8;  4O2D A;  5C3E C;  2E2J K;  1J6W A;  4IP8 A;  2E2H K; 
#chains in the Genus database with same CATH homology
 1TGO A;  3IAY A;  2GSU A;  1BGW A;  2YU9 A;  1EJ9 A;  3GTK A;  1B4A A;  1XXA A;  1ZBS A;  4P5B A;  4DDQ A;  3V4G A;  2JH3 A;  3AH5 A;  5CHP A;  1WQF A;  2A6H D;  3LAP A;  3GTM A;  2NVY A;  1YNJ D;  3MAQ A;  3P9A A;  1B4B A;  3LPX A;  3H0G A;  5EGH A;  3Q3Q A;  3BUE A;  4KB2 A;  2P5M A;  4QIW A;  3AQP A;  3CQZ A;  1R9T A;  1K4S A;  4KB4 A;  4KM8 A;  1A31 A;  2Y0S A;  2RGR A;  3HKZ A;  3DU6 A;  4J3N A;  4NOL A;  3K57 A;  3GTP A;  3GTL A;  4IP9 A;  1WIH A;  1ZVU A;  4KM9 A;  1A36 A;  1DD5 A;  1O25 A;  3AQO A;  1SEU A;  4LMO A;  1LPQ A;  4LQY A;  2JA6 A;  4C2M C;  5C9H A;  5IOQ A;  3SJR A;  2R92 A;  5CJ9 A;  3N0C A;  1XXC A;  2A6E D;  4GTL A;  4EJ3 A;  1BJT A;  4NOK A;  3FKI A;  1I3Q A;  2CW0 D;  3FOE A;  1O28 A;  2XCR B;  1T8I A;  2ZFZ A;  1MIU A;  4C2M A;  4FXD A;  3LHP S;  1R5Z A;  1RRJ A;  2JA7 A;  4KMD A;  4P5A A;  1TWH A;  1GE9 A;  3NUH A;  1AB4 A;  4BLB A;  1EK8 A;  4AYB A;  3K5O A;  1O29 A;  4KC6 A;  1WCM A;  2B9S B;  2Y3P A;  2A69 D;  3DU5 A;  4KDD A;  4NOM A;  1O27 A;  3CAG A;  1O2B A;  2CFA A;  1F9N A;  4GTD A;  2CFA B;  3LF9 A;  5JFE A;  4GT9 A;  4Q5G A;  5IOT A;  2B63 A;  1K4T A;  4FYD A;  4GTF A;  4GTE A;  1I50 A;  4AHC A;  4G0V A;  3K5N A;  4D3Y A;  1ISE A;  3K59 A;  1XXB A;  4GTA A;  4C3H C;  4KAW X;  1WQH A;  4M1X A;  2WAQ A;  4Q5V A;  5TJ3 A;  4BKW A;  3GTQ A;  2KWA A;  2RH6 A;  3FHZ A;  5CQG A;  3GTJ A;  2GSO A;  4O26 A;  2XCO A;  4C3J C;  3FOF A;  2E2I A;  3S0X A;  4FM9 A;  2PMZ A;  3G4C A;  4GTB A;  1TWC A;  2BE5 D;  5MLC 9;  2R4G A;  3K5M A;  2R7Z A;  3N0B A;  4KAT A;  4OYD B;  1SC7 A;  1RR8 C;  4FZB A;  3VA7 A;  1Y1W A;  3OEP A;  2VUM A;  3ERE D;  1TWA A;  3GTG A;  2GSN A;  4GTC A;  3MML B;  4F3E A;  1SFO A;  2XCQ A;  1YNN D;  2F4Q A;  2R93 A;  4LR2 A;  2O5J D;  2NVX A;  1R49 A;  4BLA A;  4G0U A;  5JVO A;  1WQG A;  3OPF A;  4KAR A;  1NH3 A;  4H3T A;  4GFQ A;  2E2H A;  1SMY D;  5JSN B;  1O26 A;  3ORE A;  1HQM D;  1Q8I A;  2WB1 A;  5JSB B;  5IOR A;  3L4J A;  4FGU A;  1TWF A;  1O24 A;  4KAS A;  3LAJ A;  3QX3 A;  4G0W A;  2A68 D;  3WVO A;  3M4A A;  4JLR C;  4ILD A;  1TWG A;  4L8I A;  3KYL A;  5IOS A;  1TL8 A;  1K83 A;  5EGE A;  3L4K A;  3GTO A;  3N3Y A;  1Y1V A;  4D3Z A;  1I6V D;  4AN8 A;  1KQ4 A;  3K58 A;  3G4A A;  4KMH A;  1A35 A;  4KMA A;  3K5L A;  4QCL A;  1Y69 8;  4C3I C;  1ZYR D;  1O2A A;  1ZXO A;  2PHC B;  1IW7 D;  1V9M A;  1IS1 A;  4IP8 A;  2JA5 A;  1EH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...