1IS1A

Crystal structure of ribosome recycling factor from vibrio parahaemolyticus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
185
structure length
185
Chain Sequence
MINEIKKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEYYGAATPLNQVANVVAEDARTLAITVFDKELTQKVEKAIMMSDLGLNPMSAGTIIRVPLPPLTEERRKDLVKIVRGEAEGGRVAVRNIRRDANNDLKALLKDKEISEDEDRKAQEEIQKLTDVAVKKIDEVLAAKEKELMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords RIBOSOME RECYCLING FACTOR
publication title Structure and binding mode of a ribosome recycling factor (RRF) from mesophilic bacterium
pubmed doi rcsb
source organism Vibrio parahaemolyticus
total genus 68
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1is1A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1is1A02
4GFQA 1WQHA 4L8IA 3OEPA 2XCQA 4J3NA 3ERED 3LAJA 4KC6A 1ZVUA 3NUHA 3OREA 4KB2A 1ISEA 4FM9A 3L4KA 3MMLB 4KAWX 5CJ9A 4KB4A 2XCRB 1XXCA 1Y698 3L4JA 5JSBB 3VA7A 3QX3A 1GE9A 4DDQA 4G0WA 4JLRC 1XXBA 5JVOA 1DD5A 2RGRA 1IS1A 2Y3PA 1EH1A 1AB4A 3BUEA 3V4GA 3FOEA 1BJTA 3LAPA 3OPFA 3FOFA 3LHPS 1WQFA 1F9NA 5JSNB 2XCOA 2P5MA 1XXAA 1B4AA 4OYDB 1WQGA 1WIHA 3CAGA 3LF9A 4KDDA 4G0UA 1BGWA 2KWAA 1B4BA 3FHZA 3LPXA 2ZFZA 4G0VA 1EK8A 2PHCB 5MLC9
chains in the Genus database with same CATH superfamily
1WQHA 3T01A 2E2IA 5C3EC 2JA5C 3AD8C 2GSUA 4QCLA 2PA8L 3AD9C 2XCQA 3N0CA 1TWGA 4C3JK 5C4JK 3RZDK 3M4OC 5EGHA 1K83A 4A93C 5TMCA 4BLBA 3Q3QA 4KB4A 2JA7K 2JA8C 4A3LC 3CQZK 5IOQA 4KMUA 1DCOA 1R9TK 4C2MC 3CQZA 1TWCK 2WAQA 3GTQA 4A3BK 3FKIK 2VUMC 4ZH4A 5C3EK 3FKIA 4H3TA 2A69D 4QIWD 2FQOA 3M4OK 3HOUK 1R5ZA 4XSXA 5IOTA 1IW7D 3ERED 4A93K 4OIRA 3S2DC 1V9MA 1WOPA 3PO3C 2WB1L 2BE5D 2JA8K 4A3LK 1TWAC 5IORA 1XXCA 3S17C 1IW7A 2V6SA 2WAQL 1WSVA 4C2MK 4JLRC 3GTGC 1PJ5A 1PJ7A 5FJ8K 5M5YK 4C2MA 2VUMK 3WVOA 1WCMC 1XXAA 3S1RC 1WQGA 3AQPA 3BP8C 5C44C 1INNA 3GEIA 1SC7A 4O26A 2B9SB 2P8TA 3S2DK 3KYLA 1KQ4A 3PO3K 1WSRA 1SMYA 1TWAK 3K5NA 3S17K 4FYDA 3GTGK 2JH3A 3T00A 3GSIA 1XXBA 5JVOA 5IYDK 3PO2K 1K4TA 3K58A 3GTGA 1BJTA 1USOA 3S1RK 4A3KC 3HOWC 5C44K 2D6FC 2NVQC 5JSNB 3A8JA 1I50K 1O29A 3GTMA 3HOXC 4OIOA 1ZXOA 2R7ZA 3AD7C 1I50A 1VLOA 1XZPB 4WJ4A 3H0GA 4F3EA 1J98A 3LAJA 3AH5A 3GIRA 4C3IC 4BBSC 1HQMD 4RMFA 1TL8A 3HOWK 2RGRA 3V4GA 2NVQK 3HKZL 4KASA 1SEUA 4NOIA 5M3FK 3LHPS 5M5WK 3HOXK 3GEEA 5L46A 4KATA 3S15C 1WOSA 5IYBK 2E2IC 4MQ9A 1I3QA 3AQOA 2R92C 3S1MC 1TWGC 4C3IK 5IOSA 2PA8D 4BBSK 4WJ3M 2O5JD 2A6HD 1USMA 5C4JC 1O2FB 2RH6A 3GTPA 1O25A 2O5JA 1I6VA 1AB4A 3FOEA 2V6TA 3FOFA 3GTQC 4KM9A 3RZOC 1TWHA 3DXJA 4GTBA 4BKWA 4LK0A 1VRQC 2E2IK 1MIUA 2R92K 3S1MK 1VJEA 4KM8A 3GTLA 1EQRA 4YG2A 3OEPA 1L0WA 2R92A 3OREA 4P5AA 1EJ9A 3L4KA 2WB1D 4BY7C 3HOUC 5TMFA 2WAQD 2ZUEA 2WB1A 1IS1A 1BS2A 3GTQK 4G7ZA 3TFIA 3RZOK 3LAPA 5HL8A 3M4AA 3IAYA 3GTKC 1SFOA 4IP9A 1TWFC 3GTOA 1F7UA 1EK8A 5MLC9 2A68A 4GTCA 4A3DC 4OINA 3HOZC 4OIPA 1JVIA 4BY7K 2E2JC 3NUHA 1VGXA 1WORA 4GZYA 4A3EK 5IP9C 2GAHC 3QX3A 4DDQA 4NOMA 4IP8A 4G7HA 2W7VA 4XLNA 2CFAA 3M3YC 4LOWA 5IYDC 3PO2C 1WQFA 3DU5A 4A3MC 2NVYC 4Y7NC 3GTKK 1WIHA 3GTMC 1TWFK 2R7ZC 4A3DK 1I50C 1O28A 3GTKA 3HOZK 1SMYD 1X31C 1ZBSA 1TWFA 2E2JK 3H0GC 1YCLA 2R93K 3S14C 1BDFA 3K5LA 4Q4ZA 5IP9K 4KAWX 1A31A 2R93A 4KARA 3S16K 1YX2A 3M3YK 1IQ0A 4A3MK 2NVYK 4Y7NK 3HKZD 3GTMK 1RU0A 4XLPA 2XCOA 2P5MA 1O27A 2R7ZK 1IBAA 2NVYA 1J6XA 1XPPA 3HKZA 3H0GK 2ZFZA 1IE0A 3S14K 4Q5SA 1I3QC 1O2AA 4L8IA 1VH2A 2GSOA 2ZUFA 2B63A 5IYBC 4GT9A 1IL2A 3TFJA 1TGOA 4LJZA 4JK1A 3L4JA 1K4SA 3GTPC 4LR2A 3SZYA 4KN4A 1LPQA 1V5VA 5CQGA 4XSZA 1TWHC 2YU9A 2GSNA 3LF9A 1I3QK 4C3HC 3FHZA 3GTLC 4G0VA 1JOEA 1RR8C 4AN8A 3BP3A 4KB2A 2F4QA 3GTPK 3GDZA 2NVXK 1I6VD 1I6HC 4A3CC 1DCPA 4AYBL 5IYCC 2NVXA 4KMDA 4M1XA 1HI9A 2Y0SL 1TWHK 1Y1VC 3K57A 2R4GA 1YNJD 4C3HK 3GTLK 1Y1WC 1SFOC 4NOKA 2CFAB 2EBBA 1EFWA 3SJRA 4PAAA 1B4BA 1WOOA 3WODA 4OIQA 3GTOC 3S2HK 1YNJA 1R49A 4J3NA 4Y52C 4GTDA 4FM9A 1I6HK 4A3CK 5TJ3A 3K5OA 5IYCK 4LMOA 3K7AC 2PMZA 3GEHA 3HXAA 1Y1VK 3BUEA 4A3EC 3MAQA 4A3FC 4AH6A 1Y1WK 1SFOK 1ZYRA 4OYDB 1Y1VA 3GTOK 2A68D 4GTEA 2KWAA 1Y1WA 4QJVA 1O24A 4BY1C 4YFKA 4Y52K 5EGEA 4NOLA 2FQTA 2PMZL 2R93C 2XCRB 3K7AK 2CW0D 3VA7A 3HOVC 1XZQA 4A3FK 2JA7A 4X6AK 1T8IA 2Y3PA 4G7OA 3S16C 3IPJA 1R9TA 2CW0A 5FLMC 3H3VL 4BXXC 1F9NA 4GTFA 4P9SA 4ILDA 1TWCA 3N3YA 1PJ6A 2O5IA 1BGWA 4BY1K 1F93A 2JA5K 4YFXA 4GTAA 3I4MC 1ZVUA 1DCHA 3G4CA 5M3MK 2JA5A 2B63C 3P9AA 1O26A 4A3IC 2A69A 4QIWA 4AHCA 1Q8IA 3HOYC 1ISEA 1C0AA 2E2HC 3A8IA 3HOVK 1EI6A 3N0BA 1Y698 2BE5A 5FLMK 4BXXK 4LLGA 3OPFA 1RRJA 2YU9C 3ADAC 5CHPA 4EJ3A 2VUMA 3TFHA 1J6WA 3I4MK 4O2DA 3S1NC 4QIWL 5E68A 5C4XC 2PHCB 4KMHA 5C9HA 5M5XK 2GAGC 2B63K 4A3IK 3HOYK 4KC6A 3TTGA 2E2HK 4KMAA 1JQWA 3K59A 4A3GC 2JA6C 3I4NC 5CJ9A 1TWAA 4PABA 2E2HA 4AYBD 1WCMK 2NVXC 5D4DA 2YU9K 4WILA 4A3JC 2NVTC 2Y0SD 3DU6A 3EQLA 1WCMA 5IP7C 4AYBA 3A8KA 3S1NK 1ZQ1C 5C4XK 2Y0SA 4YFNA 1NH3A 3T02A 3SZZA 3GTJC 2PPBA 4A3GK 2JA6K 3I4NK 4C45A 3S2HC 4QJVB 1YNND 2A6ED 2JA6A 4D3YA 1UV7A 1GE9A 4A3KK 4G0WA 1YNNA 4A3JK 2NVTK 4MEXA 1EH1A 1HQMA 2A6EA 4XCHA 4BBRC 5IP7K 1XZQB 3JSTA 1G51A 4P5BA 4BLAA 3S1QC 3S0XA 3CAGA 1F7VA 1O2BA 3GTJK 4KN7A 4GFQA 1A36A 4MEYA 4FXDA 4LQYA 1J6VA 3GTJA 1K83C 3RZDC 3MMLB 4C3JC 2PMZD 4FGUA 1A35A 4Q5GA 3G4AA 2V6UA 5JSBB 4BBRK 2A6HA 2JA7C 1DD5A 3CQZC 5JFEA 1ZYRD 1R9TC 4Q5VA 3S1QK 3K5MA 4D3ZA 4GTLA 3H3VD 4X6AC 4LK1A 1XZPA 3S15K 1B4AA 1TWCC 4KDDA 4A3BC 4FZBA 3FKIC 1TWGK 3LPXA 4G0UA 1K83K
chains in the Genus database with same CATH topology
1O2AA 1WQHA 4L8IA 2E2IA 1I3QA 3AQOA 3G4CA 2GSOA 2JA5A 4QCLA 2GSUA 2XCQA 3N0CA 3P9AA 1TWGA 2B63A 1O26A 5IOSA 4GT9A 4QIWA 4AHCA 1Q8IA 1K83A 1ISEA 1TGOA 2O5JD 5EGHA 2A6HD 4BLBA 3Q3QA 4KB4A 3N0BA 1Y698 3L4JA 2RH6A 5IOQA 1K4SA 4LR2A 3GTPA 1O25A 4C2MC 1AB4A 3FOEA 1LPQA 3CQZA 3OPFA 3FOFA 2WAQA 5CQGA 3GTQA 1RRJA 4KM9A 5CHPA 2YU9A 1TWHA 4EJ3A 2VUMA 2GSNA 3LF9A 4GTBA 4BKWA 1MIUA 4C3HC 3FHZA 4G0VA 3FKIA 4H3TA 2A69D 3GTLA 5C9HA 2PHCB 4KM8A 4KMHA 3OEPA 1R5ZA 1RR8C 5IOTA 1IW7D 3ERED 4AN8A 4KC6A 1V9MA 2R92A 4KMAA 3OREA 3K59A 2BE5D 4KB2A 4P5AA 1EJ9A 3L4KA 5IORA 2F4QA 5CJ9A 1TWAA 1XXCA 1I6VD 2E2HA 4JLRC 2WB1A 1IS1A 2NVXA 4KMDA 4M1XA 3LAPA 4C2MA 3DU6A 3WVOA 3K57A 1WCMA 1XXAA 2R4GA 4AYBA 1WQGA 3AQPA 3M4AA 1YNJD 3IAYA 4NOKA 2CFAB 1SFOA 2Y0SA 4IP9A 3SJRA 1B4BA 1SC7A 3GTOA 4O26A 2B9SB 1NH3A 1EK8A 5MLC9 4GTCA 3KYLA 1R49A 1KQ4A 4J3NA 3K5NA 3NUHA 1YNND 4GTDA 4FM9A 4FYDA 5TJ3A 2A6ED 3K5OA 2JA6A 2JH3A 4LMOA 4D3YA 3QX3A 1GE9A 4DDQA 4G0WA 1XXBA 2PMZA 5JVOA 4NOMA 4IP8A 1K4TA 3K58A 1EH1A 3GTGA 3BUEA 3MAQA 1BJTA 2CFAA 1WQFA 3DU5A 5JSNB 4OYDB 1WIHA 1Y1VA 1O29A 4P5BA 3GTMA 4BLAA 2A68D 3CAGA 4GTEA 3S0XA 2KWAA 1ZXOA 2R7ZA 1O2BA 1O28A 3GTKA 1Y1WA 1I50A 1SMYD 1O24A 1ZBSA 1TWFA 4GFQA 1A36A 4FXDA 4LQYA 3H0GA 4F3EA 5EGEA 3GTJA 3LAJA 3K5LA 4NOLA 3AH5A 4C3IC 3MMLB 4C3JC 4FGUA 4KAWX 1A31A 1A35A 4Q5GA 2R93A 3G4AA 2XCRB 1HQMD 4KARA 2CW0D 5JSBB 3VA7A 1DD5A 1TL8A 2JA7A 5JFEA 1T8IA 2Y3PA 2RGRA 1ZYRD 3V4GA 4KASA 1SEUA 4Q5VA 1R9TA 3LHPS 3K5MA 4D3ZA 1F9NA 4GTLA 2XCOA 2P5MA 4GTFA 1O27A 1B4AA 4ILDA 1TWCA 3N3YA 2NVYA 4KDDA 1BGWA 4FZBA 3HKZA 4KATA 3LPXA 4GTAA 2ZFZA 1ZVUA 4G0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GFQ A;  1WQH A;  4L8I A;  3OEP A;  2XCQ A;  4J3N A;  3ERE D;  3LAJ A;  4KC6 A;  1ZVU A;  3NUH A;  3ORE A;  4KB2 A;  1ISE A;  4FM9 A;  3L4K A;  3MML B;  4KAW X;  5CJ9 A;  4KB4 A;  2XCR B;  1XXC A;  1Y69 8;  3L4J A;  5JSB B;  3VA7 A;  3QX3 A;  1GE9 A;  4DDQ A;  4G0W A;  4JLR C;  1XXB A;  5JVO A;  1DD5 A;  2RGR A;  1IS1 A;  2Y3P A;  1EH1 A;  1AB4 A;  3BUE A;  3V4G A;  3FOE A;  1BJT A;  3LAP A;  3OPF A;  3FOF A;  3LHP S;  1WQF A;  1F9N A;  5JSN B;  2XCO A;  2P5M A;  1XXA A;  1B4A A;  4OYD B;  1WQG A;  1WIH A;  3CAG A;  3LF9 A;  4KDD A;  4G0U A;  1BGW A;  2KWA A;  1B4B A;  3FHZ A;  3LPX A;  2ZFZ A;  4G0V A;  1EK8 A;  2PHC B;  5MLC 9; 
#chains in the Genus database with same CATH topology
 1WQH A;  3T01 A;  2E2I A;  5C3E C;  2JA5 C;  3AD8 C;  2GSU A;  4QCL A;  2PA8 L;  3AD9 C;  2XCQ A;  3N0C A;  1TWG A;  4C3J K;  5C4J K;  3RZD K;  3M4O C;  5EGH A;  1K83 A;  4A93 C;  5TMC A;  4BLB A;  3Q3Q A;  4KB4 A;  2JA7 K;  2JA8 C;  4A3L C;  3CQZ K;  5IOQ A;  4KMU A;  1DCO A;  1R9T K;  4C2M C;  3CQZ A;  1TWC K;  2WAQ A;  3GTQ A;  4A3B K;  3FKI K;  2VUM C;  4ZH4 A;  5C3E K;  3FKI A;  4H3T A;  2A69 D;  4QIW D;  2FQO A;  3M4O K;  3HOU K;  1R5Z A;  4XSX A;  5IOT A;  1IW7 D;  3ERE D;  4A93 K;  4OIR A;  3S2D C;  1V9M A;  1WOP A;  3PO3 C;  2WB1 L;  2BE5 D;  2JA8 K;  4A3L K;  1TWA C;  5IOR A;  1XXC A;  3S17 C;  1IW7 A;  2V6S A;  2WAQ L;  1WSV A;  4C2M K;  4JLR C;  3GTG C;  1PJ5 A;  1PJ7 A;  5FJ8 K;  5M5Y K;  4C2M A;  2VUM K;  3WVO A;  1WCM C;  1XXA A;  3S1R C;  1WQG A;  3AQP A;  3BP8 C;  5C44 C;  1INN A;  3GEI A;  1SC7 A;  4O26 A;  2B9S B;  2P8T A;  3S2D K;  3KYL A;  1KQ4 A;  3PO3 K;  1WSR A;  1SMY A;  1TWA K;  3K5N A;  3S17 K;  4FYD A;  3GTG K;  2JH3 A;  3T00 A;  3GSI A;  1XXB A;  5JVO A;  5IYD K;  3PO2 K;  1K4T A;  3K58 A;  3GTG A;  1BJT A;  1USO A;  3S1R K;  4A3K C;  3HOW C;  5C44 K;  2D6F C;  2NVQ C;  5JSN B;  3A8J A;  1I50 K;  1O29 A;  3GTM A;  3HOX C;  4OIO A;  1ZXO A;  2R7Z A;  3AD7 C;  1I50 A;  1VLO A;  1XZP B;  4WJ4 A;  3H0G A;  4F3E A;  1J98 A;  3LAJ A;  3AH5 A;  3GIR A;  4C3I C;  4BBS C;  1HQM D;  4RMF A;  1TL8 A;  3HOW K;  2RGR A;  3V4G A;  2NVQ K;  3HKZ L;  4KAS A;  1SEU A;  4NOI A;  5M3F K;  3LHP S;  5M5W K;  3HOX K;  3GEE A;  5L46 A;  4KAT A;  3S15 C;  1WOS A;  5IYB K;  2E2I C;  4MQ9 A;  1I3Q A;  3AQO A;  2R92 C;  3S1M C;  1TWG C;  4C3I K;  5IOS A;  2PA8 D;  4BBS K;  4WJ3 M;  2O5J D;  2A6H D;  1USM A;  5C4J C;  1O2F B;  2RH6 A;  3GTP A;  1O25 A;  2O5J A;  1I6V A;  1AB4 A;  3FOE A;  2V6T A;  3FOF A;  3GTQ C;  4KM9 A;  3RZO C;  1TWH A;  3DXJ A;  4GTB A;  4BKW A;  4LK0 A;  1VRQ C;  2E2I K;  1MIU A;  2R92 K;  3S1M K;  1VJE A;  4KM8 A;  3GTL A;  1EQR A;  4YG2 A;  3OEP A;  1L0W A;  2R92 A;  3ORE A;  4P5A A;  1EJ9 A;  3L4K A;  2WB1 D;  4BY7 C;  3HOU C;  5TMF A;  2WAQ D;  2ZUE A;  2WB1 A;  1IS1 A;  1BS2 A;  3GTQ K;  4G7Z A;  3TFI A;  3RZO K;  3LAP A;  5HL8 A;  3M4A A;  3IAY A;  3GTK C;  1SFO A;  4IP9 A;  1TWF C;  3GTO A;  1F7U A;  1EK8 A;  5MLC 9;  2A68 A;  4GTC A;  4A3D C;  4OIN A;  3HOZ C;  4OIP A;  1JVI A;  4BY7 K;  2E2J C;  3NUH A;  1VGX A;  1WOR A;  4GZY A;  4A3E K;  5IP9 C;  2GAH C;  3QX3 A;  4DDQ A;  4NOM A;  4IP8 A;  4G7H A;  2W7V A;  4XLN A;  2CFA A;  3M3Y C;  4LOW A;  5IYD C;  3PO2 C;  1WQF A;  3DU5 A;  4A3M C;  2NVY C;  4Y7N C;  3GTK K;  1WIH A;  3GTM C;  1TWF K;  2R7Z C;  4A3D K;  1I50 C;  1O28 A;  3GTK A;  3HOZ K;  1SMY D;  1X31 C;  1ZBS A;  1TWF A;  2E2J K;  3H0G C;  1YCL A;  2R93 K;  3S14 C;  1BDF A;  3K5L A;  4Q4Z A;  5IP9 K;  4KAW X;  1A31 A;  2R93 A;  4KAR A;  3S16 K;  1YX2 A;  3M3Y K;  1IQ0 A;  4A3M K;  2NVY K;  4Y7N K;  3HKZ D;  3GTM K;  1RU0 A;  4XLP A;  2XCO A;  2P5M A;  1O27 A;  2R7Z K;  1IBA A;  2NVY A;  1J6X A;  1XPP A;  3HKZ A;  3H0G K;  2ZFZ A;  1IE0 A;  3S14 K;  4Q5S A;  1I3Q C;  1O2A A;  4L8I A;  1VH2 A;  2GSO A;  2ZUF A;  2B63 A;  5IYB C;  4GT9 A;  1IL2 A;  3TFJ A;  1TGO A;  4LJZ A;  4JK1 A;  3L4J A;  1K4S A;  3GTP C;  4LR2 A;  3SZY A;  4KN4 A;  1LPQ A;  1V5V A;  5CQG A;  4XSZ A;  1TWH C;  2YU9 A;  2GSN A;  3LF9 A;  1I3Q K;  4C3H C;  3FHZ A;  3GTL C;  4G0V A;  1JOE A;  1RR8 C;  4AN8 A;  3BP3 A;  4KB2 A;  2F4Q A;  3GTP K;  3GDZ A;  2NVX K;  1I6V D;  1I6H C;  4A3C C;  1DCP A;  4AYB L;  5IYC C;  2NVX A;  4KMD A;  4M1X A;  1HI9 A;  2Y0S L;  1TWH K;  1Y1V C;  3K57 A;  2R4G A;  1YNJ D;  4C3H K;  3GTL K;  1Y1W C;  1SFO C;  4NOK A;  2CFA B;  2EBB A;  1EFW A;  3SJR A;  4PAA A;  1B4B A;  1WOO A;  3WOD A;  4OIQ A;  3GTO C;  3S2H K;  1YNJ A;  1R49 A;  4J3N A;  4Y52 C;  4GTD A;  4FM9 A;  1I6H K;  4A3C K;  5TJ3 A;  3K5O A;  5IYC K;  4LMO A;  3K7A C;  2PMZ A;  3GEH A;  3HXA A;  1Y1V K;  3BUE A;  4A3E C;  3MAQ A;  4A3F C;  4AH6 A;  1Y1W K;  1SFO K;  1ZYR A;  4OYD B;  1Y1V A;  3GTO K;  2A68 D;  4GTE A;  2KWA A;  1Y1W A;  4QJV A;  1O24 A;  4BY1 C;  4YFK A;  4Y52 K;  5EGE A;  4NOL A;  2FQT A;  2PMZ L;  2R93 C;  2XCR B;  3K7A K;  2CW0 D;  3VA7 A;  3HOV C;  1XZQ A;  4A3F K;  2JA7 A;  4X6A K;  1T8I A;  2Y3P A;  4G7O A;  3S16 C;  3IPJ A;  1R9T A;  2CW0 A;  5FLM C;  3H3V L;  4BXX C;  1F9N A;  4GTF A;  4P9S A;  4ILD A;  1TWC A;  3N3Y A;  1PJ6 A;  2O5I A;  1BGW A;  4BY1 K;  1F93 A;  2JA5 K;  4YFX A;  4GTA A;  3I4M C;  1ZVU A;  1DCH A;  3G4C A;  5M3M K;  2JA5 A;  2B63 C;  3P9A A;  1O26 A;  4A3I C;  2A69 A;  4QIW A;  4AHC A;  1Q8I A;  3HOY C;  1ISE A;  1C0A A;  2E2H C;  3A8I A;  3HOV K;  1EI6 A;  3N0B A;  1Y69 8;  2BE5 A;  5FLM K;  4BXX K;  4LLG A;  3OPF A;  1RRJ A;  2YU9 C;  3ADA C;  5CHP A;  4EJ3 A;  2VUM A;  3TFH A;  1J6W A;  3I4M K;  4O2D A;  3S1N C;  4QIW L;  5E68 A;  5C4X C;  2PHC B;  4KMH A;  5C9H A;  5M5X K;  2GAG C;  2B63 K;  4A3I K;  3HOY K;  4KC6 A;  3TTG A;  2E2H K;  4KMA A;  1JQW A;  3K59 A;  4A3G C;  2JA6 C;  3I4N C;  5CJ9 A;  1TWA A;  4PAB A;  2E2H A;  4AYB D;  1WCM K;  2NVX C;  5D4D A;  2YU9 K;  4WIL A;  4A3J C;  2NVT C;  2Y0S D;  3DU6 A;  3EQL A;  1WCM A;  5IP7 C;  4AYB A;  3A8K A;  3S1N K;  1ZQ1 C;  5C4X K;  2Y0S A;  4YFN A;  1NH3 A;  3T02 A;  3SZZ A;  3GTJ C;  2PPB A;  4A3G K;  2JA6 K;  3I4N K;  4C45 A;  3S2H C;  4QJV B;  1YNN D;  2A6E D;  2JA6 A;  4D3Y A;  1UV7 A;  1GE9 A;  4A3K K;  4G0W A;  1YNN A;  4A3J K;  2NVT K;  4MEX A;  1EH1 A;  1HQM A;  2A6E A;  4XCH A;  4BBR C;  5IP7 K;  1XZQ B;  3JST A;  1G51 A;  4P5B A;  4BLA A;  3S1Q C;  3S0X A;  3CAG A;  1F7V A;  1O2B A;  3GTJ K;  4KN7 A;  4GFQ A;  1A36 A;  4MEY A;  4FXD A;  4LQY A;  1J6V A;  3GTJ A;  1K83 C;  3RZD C;  3MML B;  4C3J C;  2PMZ D;  4FGU A;  1A35 A;  4Q5G A;  3G4A A;  2V6U A;  5JSB B;  4BBR K;  2A6H A;  2JA7 C;  1DD5 A;  3CQZ C;  5JFE A;  1ZYR D;  1R9T C;  4Q5V A;  3S1Q K;  3K5M A;  4D3Z A;  4GTL A;  3H3V D;  4X6A C;  4LK1 A;  1XZP A;  3S15 K;  1B4A A;  1TWC C;  4KDD A;  4A3B C;  4FZB A;  3FKI C;  1TWG K;  3LPX A;  4G0U A;  1K83 K; 
#chains in the Genus database with same CATH homology
 1O2A A;  1WQH A;  4L8I A;  2E2I A;  1I3Q A;  3AQO A;  3G4C A;  2GSO A;  2JA5 A;  4QCL A;  2GSU A;  2XCQ A;  3N0C A;  3P9A A;  1TWG A;  2B63 A;  1O26 A;  5IOS A;  4GT9 A;  4QIW A;  4AHC A;  1Q8I A;  1K83 A;  1ISE A;  1TGO A;  2O5J D;  5EGH A;  2A6H D;  4BLB A;  3Q3Q A;  4KB4 A;  3N0B A;  1Y69 8;  3L4J A;  2RH6 A;  5IOQ A;  1K4S A;  4LR2 A;  3GTP A;  1O25 A;  4C2M C;  1AB4 A;  3FOE A;  1LPQ A;  3CQZ A;  3OPF A;  3FOF A;  2WAQ A;  5CQG A;  3GTQ A;  1RRJ A;  4KM9 A;  5CHP A;  2YU9 A;  1TWH A;  4EJ3 A;  2VUM A;  2GSN A;  3LF9 A;  4GTB A;  4BKW A;  1MIU A;  4C3H C;  3FHZ A;  4G0V A;  3FKI A;  4H3T A;  2A69 D;  3GTL A;  5C9H A;  2PHC B;  4KM8 A;  4KMH A;  3OEP A;  1R5Z A;  1RR8 C;  5IOT A;  1IW7 D;  3ERE D;  4AN8 A;  4KC6 A;  1V9M A;  2R92 A;  4KMA A;  3ORE A;  3K59 A;  2BE5 D;  4KB2 A;  4P5A A;  1EJ9 A;  3L4K A;  5IOR A;  2F4Q A;  5CJ9 A;  1TWA A;  1XXC A;  1I6V D;  2E2H A;  4JLR C;  2WB1 A;  1IS1 A;  2NVX A;  4KMD A;  4M1X A;  3LAP A;  4C2M A;  3DU6 A;  3WVO A;  3K57 A;  1WCM A;  1XXA A;  2R4G A;  4AYB A;  1WQG A;  3AQP A;  3M4A A;  1YNJ D;  3IAY A;  4NOK A;  2CFA B;  1SFO A;  2Y0S A;  4IP9 A;  3SJR A;  1B4B A;  1SC7 A;  3GTO A;  4O26 A;  2B9S B;  1NH3 A;  1EK8 A;  5MLC 9;  4GTC A;  3KYL A;  1R49 A;  1KQ4 A;  4J3N A;  3K5N A;  3NUH A;  1YNN D;  4GTD A;  4FM9 A;  4FYD A;  5TJ3 A;  2A6E D;  3K5O A;  2JA6 A;  2JH3 A;  4LMO A;  4D3Y A;  3QX3 A;  1GE9 A;  4DDQ A;  4G0W A;  1XXB A;  2PMZ A;  5JVO A;  4NOM A;  4IP8 A;  1K4T A;  3K58 A;  1EH1 A;  3GTG A;  3BUE A;  3MAQ A;  1BJT A;  2CFA A;  1WQF A;  3DU5 A;  5JSN B;  4OYD B;  1WIH A;  1Y1V A;  1O29 A;  4P5B A;  3GTM A;  4BLA A;  2A68 D;  3CAG A;  4GTE A;  3S0X A;  2KWA A;  1ZXO A;  2R7Z A;  1O2B A;  1O28 A;  3GTK A;  1Y1W A;  1I50 A;  1SMY D;  1O24 A;  1ZBS A;  1TWF A;  4GFQ A;  1A36 A;  4FXD A;  4LQY A;  3H0G A;  4F3E A;  5EGE A;  3GTJ A;  3LAJ A;  3K5L A;  4NOL A;  3AH5 A;  4C3I C;  3MML B;  4C3J C;  4FGU A;  4KAW X;  1A31 A;  1A35 A;  4Q5G A;  2R93 A;  3G4A A;  2XCR B;  1HQM D;  4KAR A;  2CW0 D;  5JSB B;  3VA7 A;  1DD5 A;  1TL8 A;  2JA7 A;  5JFE A;  1T8I A;  2Y3P A;  2RGR A;  1ZYR D;  3V4G A;  4KAS A;  1SEU A;  4Q5V A;  1R9T A;  3LHP S;  3K5M A;  4D3Z A;  1F9N A;  4GTL A;  2XCO A;  2P5M A;  4GTF A;  1O27 A;  1B4A A;  4ILD A;  1TWC A;  3N3Y A;  2NVY A;  4KDD A;  1BGW A;  4FZB A;  3HKZ A;  4KAT A;  3LPX A;  4GTA A;  2ZFZ A;  1ZVU A;  4G0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...