1IS1A

Crystal structure of ribosome recycling factor from vibrio parahaemolyticus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
185
structure length
185
Chain Sequence
MINEIKKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEYYGAATPLNQVANVVAEDARTLAITVFDKELTQKVEKAIMMSDLGLNPMSAGTIIRVPLPPLTEERRKDLVKIVRGEAEGGRVAVRNIRRDANNDLKALLKDKEISEDEDRKAQEEIQKLTDVAVKKIDEVLAAKEKELMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and binding mode of a ribosome recycling factor (RRF) from mesophilic bacterium
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Translation
molecule keywords RIBOSOME RECYCLING FACTOR
total genus 68
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1is1A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1is1A02
1Y698 3LF9A 3L4JA 1IS1A 5JSBB 4GFQA 3OREA 1GE9A 5JSNB 3CAGA 4DDQA 2RGRA 4KDDA 4FM9A 2XCRB 1B4AA 4KB4A 1EK8A 1WQHA 1WIHA 1F9NA 1B4BA 3OEPA 3BUEA 3LHPS 4OYDB 3LPXA 4J3NA 4KAWX 4KC6A 2XCOA 3MMLB 3VA7A 3LAJA 4KB2A 3QX3A 1BGWA 3V4GA 1EH1A 3FHZA 4JLRC 5CJ9A 5JVOA 2KWAA 4G0UA 1ISEA 1WQFA 1ZVUA 3FOFA 4L8IA 2Y3PA 3LAPA 2P5MA 2ZFZA 3NUHA 2XCQA 1DD5A 1XXBA 1AB4A 2PHCB 3ERED 1WQGA 1BJTA 1XXAA 3OPFA 3FOEA 5MLC9 3L4KA 4G0WA 1XXCA 4G0VA
chains in the Genus database with same CATH superfamily
1Y698 2R92C 5C4JK 4AYBL 4BLAA 3S15K 1GE9A 5JSNB 1HQMA 1EFWA 1J98A 3S1RC 4KN4A 1YNJA 2PMZA 1SMYA 4YFXA 1USOA 5C4XC 4A3MC 3G4CA 3VA7A 4LK0A 3HOXC 4KMAA 4C3IC 2B9SB 4QJVA 3M4OK 5FLMK 3BP8C 4JK1A 1O2FB 1J6WA 4GZYA 1I3QK 1USMA 4BBRK 3WODA 3IPJA 2E2HA 4C2MK 4PABA 3I4NK 5JSBB 4MQ9A 4ILDA 2RGRA 4AYBD 2NVQC 3DXJA 4A3BK 4A3GC 4Q5VA 3TFIA 1V5VA 3K58A 1R9TC 1I3QA 3M4OC 2R7ZA 1XPPA 3AD8C 4QJVB 2WB1D 1PJ5A 3DU6A 2GSUA 4D3YA 3AD7C 2WB1A 4WJ3M 4A3JK 2Y3PA 1UV7A 4BY7C 3S1NK 4P5AA 3WVOA 3EQLA 3FKIC 4OIQA 5MLC9 1XXCA 5IYBK 4NOKA 5IP9C 4GFQA 1NH3A 4NOLA 4DDQA 1JOEA 2ZUEA 4KATA 1WCMA 2E2HK 2A69D 2JA6A 3MMLB 3SJRA 3LAJA 4BBSC 4EJ3A 4G7ZA 3K5OA 3HXAA 4LR2A 1R49A 4KMDA 5C44C 1ZVUA 1C0AA 1WSVA 1IQ0A 1WORA 4PAAA 1XXBA 4Y52K 3ERED 5TMFA 4KM8A 1INNA 2GSOA 2JA5A 5IP7K 3T00A 4X6AK 3JSTA 4BBRC 4Y7NK 1A35A 2JA7A 5IYCK 3S15C 5FJ8K 1VRQC 4KARA 1R5ZA 4LJZA 4P5BA 1WOSA 1BGWA 4AHCA 1SC7A 4OIPA 3S1QC 3DU5A 4A3CC 4C2MA 3HOWC 5IP9K 1BS2A 2XCQA 5TJ3A 2NVTC 5EGEA 3GTLK 2A6EA 3RZDK 2R93C 4KN7A 4X6AC 4D3ZA 4P9SA 5IYDC 3K7AC 3RZOK 3A8JA 1K4SA 3GTOA 4KMHA 1RRJA 1F9NA 3H3VL 4WJ4A 5C44K 4LOWA 1IBAA 4FYDA 4BXXK 1EJ9A 1SFOC 1TWFK 3T02A 2V6SA 2ZFZA 4A3EC 3H0GA 1BJTA 1RU0A 3HKZA 4ZH4A 3GIRA 1X31C 4G0VA 3GTOC 1O29A 1Y1VC 1WSRA 2JA8C 3FKIK 4O2DA 3HOUC 1TWHA 1O28A 2FQTA 5M3FK 1R9TA 3OEPA 4GTBA 3I4NC 2XCOA 3M3YK 4KB2A 4G7HA 3S2DK 3N0BA 1VH2A 5IYCC 1ZYRA 3PO2K 1ISEA 2JA5C 2VUMC 3HOYK 1TWGA 3AQPA 1A36A 4AN8A 4A3BC 4A3GK 1O25A 1TGOA 3GTPA 4LQYA 2PA8D 4G0WA 3SZYA 1TWHC 1Q8IA 3P9AA 3GSIA 1TWCC 3HKZL 1ZXOA 3GTGK 4OYDB 1IW7D 2NVYA 3GTKC 3GTMA 4MEYA 2PMZD 1SMYD 3GTQK 2R93A 3S1QK 2WAQL 4A3IK 3QX3A 4A93C 3V4GA 1T8IA 4GT9A 4FXDA 2WB1L 3N0CA 5JVOA 4OIRA 2YU9K 3Q3QA 4L8IA 3LAPA 2GAGC 2VUMA 4A3KK 1F7UA 1K83K 4GTAA 1I50A 2EBBA 3GTPC 3LF9A 2JA7C 4AH6A 3OREA 4O26A 1Y1WA 3M3YC 1L0WA 1B4AA 4KB4A 2R7ZC 2E2JC 4Y52C 4GTDA 4A93K 2P8TA 3GEHA 5IORA 3I4MC 1DCOA 1HQMD 5CHPA 4JLRC 3HKZD 3GTJK 2A68A 1YNJD 1WCMC 3FOFA 5JFEA 2R4GA 2O5IA 3NUHA 3M4AA 2B63A 3K59A 5C9HA 1YCLA 4XSXA 1EQRA 1O2BA 5M5XK 3TFJA 2O5JA 4QIWD 3PO3K 3GTKK 4GTFA 2CW0D 1TWAK 4FM9A 1ZYRD 3TTGA 5CQGA 3S17C 5M3MK 1BDFA 3S2DC 3LHPS 5D4DA 2YU9C 3CQZA 4IP8A 1HI9A 4GTLA 4XSZA 2E2IK 2D6FC 1TWCA 3K7AK 3S1RK 4KM9A 2B63C 4AYBA 3GTKA 2NVXK 3GTMC 4H3TA 2NVYC 2P5MA 3PO2C 1A31A 2WAQA 2BE5A 4BY1K 3OPFA 1Y1VA 1YX2A 1IW7A 2V6UA 5L46A 2F4QA 4Q5GA 2R92A 3CQZC 3ADAC 2Y0SL 3HOUK 4WILA 1PJ7A 1Y1VK 3I4MK 4J3NA 4KAWX 4KC6A 4BLBA 4NOMA 1TWGC 3HOVC 4BY7K 1PJ6A 4A3LK 4G7OA 3GEEA 4M1XA 4KASA 1I6VD 2PHCB 2ZUFA 2E2IA 3SZZA 4OIOA 1VGXA 3G4AA 2RH6A 2R92K 4A3CK 4A3FC 1XZQB 1SFOA 1EK8A 3S16K 3BUEA 1K4TA 4A3EK 2Y0SD 3AH5A 4A3LC 3S14C 5IYDK 1XZQA 4MEXA 5M5YK 2Y0SA 1SFOK 1I6HC 3GTJA 3GTGC 1O26A 4QIWA 1I50C 1TWCK 5FLMC 1XZPA 5IP7C 2CFAB 3CQZK 3GEIA 1WQGA 3AD9C 4C3HK 3N3YA 1XZPB 4C2MC 3L4JA 1IS1A 1TWAA 4KDDA 4Q4ZA 1WQHA 1K83C 4NOIA 3TFHA 2PMZL 2B63K 2BE5D 1ZBSA 2WAQD 4LLGA 4IP9A 3MAQA 4C45A 5EGHA 2E2HC 2JA6C 1ZQ1C 1J6XA 3IAYA 1SEUA 5IOTA 3GTJC 3RZDC 2R93K 1DD5A 3GTQA 2JA8K 5IOSA 1O2AA 2NVXA 4LMOA 4C3JC 5E68A 2PPBA 3BP3A 1JVIA 4GTEA 1IL2A 4YG2A 3S17K 3HOVK 1I50K 1LPQA 2A6ED 1G51A 2CFAA 2VUMK 1I6HK 3PO3C 2A6HD 5C3EK 1EH1A 3FHZA 4OINA 1IE0A 4A3DK 5TMCA 3GDZA 4C3HC 3S2HC 3S14K 3K57A 1TWFC 3S1MC 3S0XA 4C3JK 5M5WK 3GTGA 4BKWA 4GTCA 4A3FK 4QIWL 1R9TK 2NVTK 4KMUA 2FQOA 2NVXC 3CAGA 2XCRB 2NVQK 4A3KC 1WIHA 1B4BA 4F3EA 4A3JC 4C3IK 3H0GK 1TL8A 1YNND 2JA7K 1TWGK 1TWFA 1WOOA 3A8IA 1Y1WK 5IYBC 4XLPA 2KWAA 1YNNA 4G0UA 3T01A 1TWAC 2JA5K 3HOYC 1J6VA 1F7VA 3HOWK 3KYLA 1K83A 1EI6A 5C4XK 3K5MA 1TWHK 2YU9A 3HOZC 4QCLA 3GTQC 2JH3A 4A3IC 2O5JD 4Q5SA 3GTMK 2NVYK 1VJEA 3A8KA 2GAHC 5C4JC 4FGUA 2PA8L 1Y1WC 3GTLA 4BBSK 4XLNA 2W7VA 3HOZK 4YFNA 3HOXK 2V6TA 3S16C 4A3MK 3K5NA 4BY1C 5IOQA 5C3EC 4RMFA 1I3QC 3GTPK 3FOEA 4Y7NC 3L4KA 4BXXC 4FZBA 1VLOA 3K5LA 3GTOK 1RR8C 3S1NC 2A68D 2GSNA 2A6HA 3H0GC 3S1MK 1MIUA 2E2JK 2E2IC 2R7ZK 4XCHA 3H3VD 5HL8A 4LK1A 3LPXA 4A3DC 1DCHA 1V9MA 2CW0A 3GTLC 1O24A 5CJ9A 3FKIA 3AQOA 1WQFA 1O27A 1KQ4A 1DCPA 1JQWA 3RZOC 2A69A 1AB4A 2JA6K 4YFKA 3S2HK 1WOPA 1XXAA 1I6VA 1F93A 1WCMK
chains in the Genus database with same CATH topology
1Y698 2NVXA 4LMOA 4C3JC 4BLAA 4GTFA 2CW0D 5JSNB 1GE9A 1K4SA 1ZYRD 3GTOA 4FM9A 4KMHA 4GTEA 5CQGA 1RRJA 1F9NA 2PMZA 3LHPS 3CQZA 4IP8A 4GTLA 1LPQA 3G4CA 4FYDA 3VA7A 2A6ED 1EJ9A 2CFAA 4KMAA 4C3IC 2A6HD 1TWCA 1EH1A 3FHZA 2B9SB 4KM9A 4AYBA 4C3HC 3GTKA 3K57A 4H3TA 2P5MA 2ZFZA 1A31A 2WAQA 3H0GA 3S0XA 2E2HA 1BJTA 3GTGA 1Y1VA 3OPFA 4GTCA 4BKWA 3HKZA 4G0VA 1O29A 2F4QA 4Q5GA 5JSBB 2R92A 3CAGA 4ILDA 2RGRA 1TWHA 1O28A 2XCRB 1R9TA 1WIHA 1B4BA 4F3EA 3OEPA 4Q5VA 4GTBA 4J3NA 4KAWX 4KC6A 2XCOA 4BLBA 4NOMA 3K58A 1TL8A 1I3QA 1YNND 4KB2A 2R7ZA 3N0BA 3L4JA 1TWFA 2KWAA 4G0UA 1ISEA 3DU6A 2GSUA 1TWGA 4D3YA 3AQPA 2WB1A 1A36A 4AN8A 2Y3PA 4M1XA 4KASA 1O25A 1I6VD 1TGOA 3KYLA 3GTPA 2E2IA 2PHCB 4P5AA 1K83A 4LQYA 3WVOA 4G0WA 5MLC9 1XXCA 3G4AA 3K5MA 2RH6A 2YU9A 4NOKA 4QCLA 4GFQA 1NH3A 1Q8IA 4NOLA 4DDQA 2JH3A 3P9AA 2O5JD 1SFOA 4KATA 1EK8A 1WCMA 1ZXOA 3BUEA 1K4TA 4OYDB 1IW7D 2NVYA 3AH5A 4FGUA 2A69D 3GTLA 3GTMA 2JA6A 3SJRA 1SMYD 3MMLB 2R93A 3LAJA 3QX3A 2Y0SA 4EJ3A 3K5OA 3V4GA 5JVOA 1T8IA 4GT9A 1R49A 3GTJA 4FXDA 1O26A 3N0CA 4KMDA 4LR2A 4QIWA 1ZVUA 3K5NA 3Q3QA 4L8IA 3LAPA 2VUMA 2CFAB 1XXBA 4GTAA 5IOQA 1I50A 3ERED 1WQGA 3FOEA 3L4KA 4FZBA 3N3YA 4KM8A 3LF9A 3K5LA 1RR8C 2JA5A 1IS1A 2A68D 2GSOA 1TWAA 4C2MC 2GSNA 4O26A 1Y1WA 3OREA 4KDDA 1MIUA 1B4AA 4KB4A 1WQHA 1A35A 2JA7A 4GTDA 3LPXA 4KARA 2BE5D 1ZBSA 5IORA 1R5ZA 4IP9A 3MAQA 5EGHA 4P5BA 1V9MA 1HQMD 1BGWA 4AHCA 5CHPA 4JLRC 1SC7A 1O24A 5CJ9A 3FKIA 3AQOA 1WQFA 3DU5A 1YNJD 1SEUA 3IAYA 1O27A 5IOTA 1KQ4A 3FOFA 5JFEA 2R4GA 4C2MA 3NUHA 3M4AA 2B63A 2XCQA 5TJ3A 1DD5A 3GTQA 1AB4A 3K59A 5EGEA 5C9HA 1XXAA 4D3ZA 1O2BA 5IOSA 1O2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y69 8;  3LF9 A;  3L4J A;  1IS1 A;  5JSB B;  4GFQ A;  3ORE A;  1GE9 A;  5JSN B;  3CAG A;  4DDQ A;  2RGR A;  4KDD A;  4FM9 A;  2XCR B;  1B4A A;  4KB4 A;  1EK8 A;  1WQH A;  1WIH A;  1F9N A;  1B4B A;  3OEP A;  3BUE A;  3LHP S;  4OYD B;  3LPX A;  4J3N A;  4KAW X;  4KC6 A;  2XCO A;  3MML B;  3VA7 A;  3LAJ A;  4KB2 A;  3QX3 A;  1BGW A;  3V4G A;  1EH1 A;  3FHZ A;  4JLR C;  5CJ9 A;  5JVO A;  2KWA A;  4G0U A;  1ISE A;  1WQF A;  1ZVU A;  3FOF A;  4L8I A;  2Y3P A;  3LAP A;  2P5M A;  2ZFZ A;  3NUH A;  2XCQ A;  1DD5 A;  1XXB A;  1AB4 A;  2PHC B;  3ERE D;  1WQG A;  1BJT A;  1XXA A;  3OPF A;  3FOE A;  5MLC 9;  3L4K A;  4G0W A;  1XXC A;  4G0V A; 
#chains in the Genus database with same CATH topology
 1Y69 8;  2R92 C;  5C4J K;  4AYB L;  4BLA A;  3S15 K;  1GE9 A;  5JSN B;  1HQM A;  1EFW A;  1J98 A;  3S1R C;  4KN4 A;  1YNJ A;  2PMZ A;  1SMY A;  4YFX A;  1USO A;  5C4X C;  4A3M C;  3G4C A;  3VA7 A;  4LK0 A;  3HOX C;  4KMA A;  4C3I C;  2B9S B;  4QJV A;  3M4O K;  5FLM K;  3BP8 C;  4JK1 A;  1O2F B;  1J6W A;  4GZY A;  1I3Q K;  1USM A;  4BBR K;  3WOD A;  3IPJ A;  2E2H A;  4C2M K;  4PAB A;  3I4N K;  5JSB B;  4MQ9 A;  4ILD A;  2RGR A;  4AYB D;  2NVQ C;  3DXJ A;  4A3B K;  4A3G C;  4Q5V A;  3TFI A;  1V5V A;  3K58 A;  1R9T C;  1I3Q A;  3M4O C;  2R7Z A;  1XPP A;  3AD8 C;  4QJV B;  2WB1 D;  1PJ5 A;  3DU6 A;  2GSU A;  4D3Y A;  3AD7 C;  2WB1 A;  4WJ3 M;  4A3J K;  2Y3P A;  1UV7 A;  4BY7 C;  3S1N K;  4P5A A;  3WVO A;  3EQL A;  3FKI C;  4OIQ A;  5MLC 9;  1XXC A;  5IYB K;  4NOK A;  5IP9 C;  4GFQ A;  1NH3 A;  4NOL A;  4DDQ A;  1JOE A;  2ZUE A;  4KAT A;  1WCM A;  2E2H K;  2A69 D;  2JA6 A;  3MML B;  3SJR A;  3LAJ A;  4BBS C;  4EJ3 A;  4G7Z A;  3K5O A;  3HXA A;  4LR2 A;  1R49 A;  4KMD A;  5C44 C;  1ZVU A;  1C0A A;  1WSV A;  1IQ0 A;  1WOR A;  4PAA A;  1XXB A;  4Y52 K;  3ERE D;  5TMF A;  4KM8 A;  1INN A;  2GSO A;  2JA5 A;  5IP7 K;  3T00 A;  4X6A K;  3JST A;  4BBR C;  4Y7N K;  1A35 A;  2JA7 A;  5IYC K;  3S15 C;  5FJ8 K;  1VRQ C;  4KAR A;  1R5Z A;  4LJZ A;  4P5B A;  1WOS A;  1BGW A;  4AHC A;  1SC7 A;  4OIP A;  3S1Q C;  3DU5 A;  4A3C C;  4C2M A;  3HOW C;  5IP9 K;  1BS2 A;  2XCQ A;  5TJ3 A;  2NVT C;  5EGE A;  3GTL K;  2A6E A;  3RZD K;  2R93 C;  4KN7 A;  4X6A C;  4D3Z A;  4P9S A;  5IYD C;  3K7A C;  3RZO K;  3A8J A;  1K4S A;  3GTO A;  4KMH A;  1RRJ A;  1F9N A;  3H3V L;  4WJ4 A;  5C44 K;  4LOW A;  1IBA A;  4FYD A;  4BXX K;  1EJ9 A;  1SFO C;  1TWF K;  3T02 A;  2V6S A;  2ZFZ A;  4A3E C;  3H0G A;  1BJT A;  1RU0 A;  3HKZ A;  4ZH4 A;  3GIR A;  1X31 C;  4G0V A;  3GTO C;  1O29 A;  1Y1V C;  1WSR A;  2JA8 C;  3FKI K;  4O2D A;  3HOU C;  1TWH A;  1O28 A;  2FQT A;  5M3F K;  1R9T A;  3OEP A;  4GTB A;  3I4N C;  2XCO A;  3M3Y K;  4KB2 A;  4G7H A;  3S2D K;  3N0B A;  1VH2 A;  5IYC C;  1ZYR A;  3PO2 K;  1ISE A;  2JA5 C;  2VUM C;  3HOY K;  1TWG A;  3AQP A;  1A36 A;  4AN8 A;  4A3B C;  4A3G K;  1O25 A;  1TGO A;  3GTP A;  4LQY A;  2PA8 D;  4G0W A;  3SZY A;  1TWH C;  1Q8I A;  3P9A A;  3GSI A;  1TWC C;  3HKZ L;  1ZXO A;  3GTG K;  4OYD B;  1IW7 D;  2NVY A;  3GTK C;  3GTM A;  4MEY A;  2PMZ D;  1SMY D;  3GTQ K;  2R93 A;  3S1Q K;  2WAQ L;  4A3I K;  3QX3 A;  4A93 C;  3V4G A;  1T8I A;  4GT9 A;  4FXD A;  2WB1 L;  3N0C A;  5JVO A;  4OIR A;  2YU9 K;  3Q3Q A;  4L8I A;  3LAP A;  2GAG C;  2VUM A;  4A3K K;  1F7U A;  1K83 K;  4GTA A;  1I50 A;  2EBB A;  3GTP C;  3LF9 A;  2JA7 C;  4AH6 A;  3ORE A;  4O26 A;  1Y1W A;  3M3Y C;  1L0W A;  1B4A A;  4KB4 A;  2R7Z C;  2E2J C;  4Y52 C;  4GTD A;  4A93 K;  2P8T A;  3GEH A;  5IOR A;  3I4M C;  1DCO A;  1HQM D;  5CHP A;  4JLR C;  3HKZ D;  3GTJ K;  2A68 A;  1YNJ D;  1WCM C;  3FOF A;  5JFE A;  2R4G A;  2O5I A;  3NUH A;  3M4A A;  2B63 A;  3K59 A;  5C9H A;  1YCL A;  4XSX A;  1EQR A;  1O2B A;  5M5X K;  3TFJ A;  2O5J A;  4QIW D;  3PO3 K;  3GTK K;  4GTF A;  2CW0 D;  1TWA K;  4FM9 A;  1ZYR D;  3TTG A;  5CQG A;  3S17 C;  5M3M K;  1BDF A;  3S2D C;  3LHP S;  5D4D A;  2YU9 C;  3CQZ A;  4IP8 A;  1HI9 A;  4GTL A;  4XSZ A;  2E2I K;  2D6F C;  1TWC A;  3K7A K;  3S1R K;  4KM9 A;  2B63 C;  4AYB A;  3GTK A;  2NVX K;  3GTM C;  4H3T A;  2NVY C;  2P5M A;  3PO2 C;  1A31 A;  2WAQ A;  2BE5 A;  4BY1 K;  3OPF A;  1Y1V A;  1YX2 A;  1IW7 A;  2V6U A;  5L46 A;  2F4Q A;  4Q5G A;  2R92 A;  3CQZ C;  3ADA C;  2Y0S L;  3HOU K;  4WIL A;  1PJ7 A;  1Y1V K;  3I4M K;  4J3N A;  4KAW X;  4KC6 A;  4BLB A;  4NOM A;  1TWG C;  3HOV C;  4BY7 K;  1PJ6 A;  4A3L K;  4G7O A;  3GEE A;  4M1X A;  4KAS A;  1I6V D;  2PHC B;  2ZUF A;  2E2I A;  3SZZ A;  4OIO A;  1VGX A;  3G4A A;  2RH6 A;  2R92 K;  4A3C K;  4A3F C;  1XZQ B;  1SFO A;  1EK8 A;  3S16 K;  3BUE A;  1K4T A;  4A3E K;  2Y0S D;  3AH5 A;  4A3L C;  3S14 C;  5IYD K;  1XZQ A;  4MEX A;  5M5Y K;  2Y0S A;  1SFO K;  1I6H C;  3GTJ A;  3GTG C;  1O26 A;  4QIW A;  1I50 C;  1TWC K;  5FLM C;  1XZP A;  5IP7 C;  2CFA B;  3CQZ K;  3GEI A;  1WQG A;  3AD9 C;  4C3H K;  3N3Y A;  1XZP B;  4C2M C;  3L4J A;  1IS1 A;  1TWA A;  4KDD A;  4Q4Z A;  1WQH A;  1K83 C;  4NOI A;  3TFH A;  2PMZ L;  2B63 K;  2BE5 D;  1ZBS A;  2WAQ D;  4LLG A;  4IP9 A;  3MAQ A;  4C45 A;  5EGH A;  2E2H C;  2JA6 C;  1ZQ1 C;  1J6X A;  3IAY A;  1SEU A;  5IOT A;  3GTJ C;  3RZD C;  2R93 K;  1DD5 A;  3GTQ A;  2JA8 K;  5IOS A;  1O2A A;  2NVX A;  4LMO A;  4C3J C;  5E68 A;  2PPB A;  3BP3 A;  1JVI A;  4GTE A;  1IL2 A;  4YG2 A;  3S17 K;  3HOV K;  1I50 K;  1LPQ A;  2A6E D;  1G51 A;  2CFA A;  2VUM K;  1I6H K;  3PO3 C;  2A6H D;  5C3E K;  1EH1 A;  3FHZ A;  4OIN A;  1IE0 A;  4A3D K;  5TMC A;  3GDZ A;  4C3H C;  3S2H C;  3S14 K;  3K57 A;  1TWF C;  3S1M C;  3S0X A;  4C3J K;  5M5W K;  3GTG A;  4BKW A;  4GTC A;  4A3F K;  4QIW L;  1R9T K;  2NVT K;  4KMU A;  2FQO A;  2NVX C;  3CAG A;  2XCR B;  2NVQ K;  4A3K C;  1WIH A;  1B4B A;  4F3E A;  4A3J C;  4C3I K;  3H0G K;  1TL8 A;  1YNN D;  2JA7 K;  1TWG K;  1TWF A;  1WOO A;  3A8I A;  1Y1W K;  5IYB C;  4XLP A;  2KWA A;  1YNN A;  4G0U A;  3T01 A;  1TWA C;  2JA5 K;  3HOY C;  1J6V A;  1F7V A;  3HOW K;  3KYL A;  1K83 A;  1EI6 A;  5C4X K;  3K5M A;  1TWH K;  2YU9 A;  3HOZ C;  4QCL A;  3GTQ C;  2JH3 A;  4A3I C;  2O5J D;  4Q5S A;  3GTM K;  2NVY K;  1VJE A;  3A8K A;  2GAH C;  5C4J C;  4FGU A;  2PA8 L;  1Y1W C;  3GTL A;  4BBS K;  4XLN A;  2W7V A;  3HOZ K;  4YFN A;  3HOX K;  2V6T A;  3S16 C;  4A3M K;  3K5N A;  4BY1 C;  5IOQ A;  5C3E C;  4RMF A;  1I3Q C;  3GTP K;  3FOE A;  4Y7N C;  3L4K A;  4BXX C;  4FZB A;  1VLO A;  3K5L A;  3GTO K;  1RR8 C;  3S1N C;  2A68 D;  2GSN A;  2A6H A;  3H0G C;  3S1M K;  1MIU A;  2E2J K;  2E2I C;  2R7Z K;  4XCH A;  3H3V D;  5HL8 A;  4LK1 A;  3LPX A;  4A3D C;  1DCH A;  1V9M A;  2CW0 A;  3GTL C;  1O24 A;  5CJ9 A;  3FKI A;  3AQO A;  1WQF A;  1O27 A;  1KQ4 A;  1DCP A;  1JQW A;  3RZO C;  2A69 A;  1AB4 A;  2JA6 K;  4YFK A;  3S2H K;  1WOP A;  1XXA A;  1I6V A;  1F93 A;  1WCM K; 
#chains in the Genus database with same CATH homology
 1Y69 8;  2NVX A;  4LMO A;  4C3J C;  4BLA A;  4GTF A;  2CW0 D;  5JSN B;  1GE9 A;  1K4S A;  1ZYR D;  3GTO A;  4FM9 A;  4KMH A;  4GTE A;  5CQG A;  1RRJ A;  1F9N A;  2PMZ A;  3LHP S;  3CQZ A;  4IP8 A;  4GTL A;  1LPQ A;  3G4C A;  4FYD A;  3VA7 A;  2A6E D;  1EJ9 A;  2CFA A;  4KMA A;  4C3I C;  2A6H D;  1TWC A;  1EH1 A;  3FHZ A;  2B9S B;  4KM9 A;  4AYB A;  4C3H C;  3GTK A;  3K57 A;  4H3T A;  2P5M A;  2ZFZ A;  1A31 A;  2WAQ A;  3H0G A;  3S0X A;  2E2H A;  1BJT A;  3GTG A;  1Y1V A;  3OPF A;  4GTC A;  4BKW A;  3HKZ A;  4G0V A;  1O29 A;  2F4Q A;  4Q5G A;  5JSB B;  2R92 A;  3CAG A;  4ILD A;  2RGR A;  1TWH A;  1O28 A;  2XCR B;  1R9T A;  1WIH A;  1B4B A;  4F3E A;  3OEP A;  4Q5V A;  4GTB A;  4J3N A;  4KAW X;  4KC6 A;  2XCO A;  4BLB A;  4NOM A;  3K58 A;  1TL8 A;  1I3Q A;  1YNN D;  4KB2 A;  2R7Z A;  3N0B A;  3L4J A;  1TWF A;  2KWA A;  4G0U A;  1ISE A;  3DU6 A;  2GSU A;  1TWG A;  4D3Y A;  3AQP A;  2WB1 A;  1A36 A;  4AN8 A;  2Y3P A;  4M1X A;  4KAS A;  1O25 A;  1I6V D;  1TGO A;  3KYL A;  3GTP A;  2E2I A;  2PHC B;  4P5A A;  1K83 A;  4LQY A;  3WVO A;  4G0W A;  5MLC 9;  1XXC A;  3G4A A;  3K5M A;  2RH6 A;  2YU9 A;  4NOK A;  4QCL A;  4GFQ A;  1NH3 A;  1Q8I A;  4NOL A;  4DDQ A;  2JH3 A;  3P9A A;  2O5J D;  1SFO A;  4KAT A;  1EK8 A;  1WCM A;  1ZXO A;  3BUE A;  1K4T A;  4OYD B;  1IW7 D;  2NVY A;  3AH5 A;  4FGU A;  2A69 D;  3GTL A;  3GTM A;  2JA6 A;  3SJR A;  1SMY D;  3MML B;  2R93 A;  3LAJ A;  3QX3 A;  2Y0S A;  4EJ3 A;  3K5O A;  3V4G A;  5JVO A;  1T8I A;  4GT9 A;  1R49 A;  3GTJ A;  4FXD A;  1O26 A;  3N0C A;  4KMD A;  4LR2 A;  4QIW A;  1ZVU A;  3K5N A;  3Q3Q A;  4L8I A;  3LAP A;  2VUM A;  2CFA B;  1XXB A;  4GTA A;  5IOQ A;  1I50 A;  3ERE D;  1WQG A;  3FOE A;  3L4K A;  4FZB A;  3N3Y A;  4KM8 A;  3LF9 A;  3K5L A;  1RR8 C;  2JA5 A;  1IS1 A;  2A68 D;  2GSO A;  1TWA A;  4C2M C;  2GSN A;  4O26 A;  1Y1W A;  3ORE A;  4KDD A;  1MIU A;  1B4A A;  4KB4 A;  1WQH A;  1A35 A;  2JA7 A;  4GTD A;  3LPX A;  4KAR A;  2BE5 D;  1ZBS A;  5IOR A;  1R5Z A;  4IP9 A;  3MAQ A;  5EGH A;  4P5B A;  1V9M A;  1HQM D;  1BGW A;  4AHC A;  5CHP A;  4JLR C;  1SC7 A;  1O24 A;  5CJ9 A;  3FKI A;  3AQO A;  1WQF A;  3DU5 A;  1YNJ D;  1SEU A;  3IAY A;  1O27 A;  5IOT A;  1KQ4 A;  3FOF A;  5JFE A;  2R4G A;  4C2M A;  3NUH A;  3M4A A;  2B63 A;  2XCQ A;  5TJ3 A;  1DD5 A;  3GTQ A;  1AB4 A;  3K59 A;  5EGE A;  5C9H A;  1XXA A;  4D3Z A;  1O2B A;  5IOS A;  1O2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...