1IS1A

Crystal structure of ribosome recycling factor from vibrio parahaemolyticus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
185
structure length
185
Chain Sequence
b'MINEIKKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEYYGAATPLNQVANVVAEDARTLAITVFDKELTQKVEKAIMMSDLGLNPMSAGTIIRVPLPPLTEERRKDLVKIVRGEAEGGRVAVRNIRRDANNDLKALLKDKEISEDEDRKAQEEIQKLTDVAVKKIDEVLAAKEKELMEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME RECYCLING FACTOR
publication title Structure and binding mode of a ribosome recycling factor (RRF) from mesophilic bacterium
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Translation
total genus 68
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1is1A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1is1A02
1EH1A 4DDQA 3LPXA 4L8IA 5JVOA 4G0UA 2KWAA 1WQGA 1XXAA 2XCOA 4GFQA 1Y698 3BUEA 3OREA 3V4GA 3VA7A 4KDDA 3FOEA 1EK8A 4KB4A 1WQHA 3MMLB 4KB2A 3NUHA 3LAJA 1AB4A 2XCQA 5JSBB 3FHZA 4G0VA 1WQFA 1BJTA 1WIHA 2RGRA 1XXBA 1GE9A 3ERED 1B4AA 3L4KA 1F9NA 4KC6A 1BGWA 2Y3PA 4KAWX 5CJ9A 4FM9A 3LHPS 1ZVUA 1IS1A 1XXCA 3LAPA 4JLRC 4J3NA 1DD5A 4OYDB 1ISEA 5JSNB 3L4JA 3QX3A 3CAGA 2ZFZA 1B4BA 2P5MA 2PHCB 4G0WA 3OPFA 3FOFA 5MLC9 3LF9A 2XCRB 3OEPA
chains in the Genus database with same CATH superfamily
3HOUK 4GZYA 5IYBC 1O2FB 1DCPA 2A69A 3GTMC 4GT9A 4KB4A 2CFAA 2GSNA 2B63C 1BJTA 5C44K 4GTAA 4Y52C 2VUMC 1JVIA 1XZPA 3S15K 4P5AA 1I6HC 1NH3A 2Y0SL 3HOYK 2JH3A 3GTKK 4OYDB 4YFXA 3S0XA 5EGHA 4NOKA 4D3ZA 4BXXK 3FOFA 3S17K 3S1RC 4D3YA 3PO2C 2NVYC 3G4AA 3SZZA 3S15C 4A3KC 2E2IK 4KDDA 3ADAC 5M3FK 2E2HK 2VUMA 2A6HD 3RZOK 4A93K 3K5OA 2WB1D 2RH6A 3Q3QA 2A68D 4OIOA 1I3QC 2PMZL 2V6SA 3HOZC 4GTDA 3HXAA 4OIPA 4A3DC 4A3FK 4F3EA 4BLAA 3LAPA 4J3NA 3AD9C 4OIRA 2NVYA 2E2IC 2PA8L 1ZYRA 3CAGA 4C2MC 4KM9A 3G4CA 4G0WA 1F7UA 3M3YK 3RZDK 2WAQA 4FYDA 1J6WA 2GAHC 3LPXA 2CFAB 5E68A 4GTBA 1TL8A 3I4NK 1YCLA 4GFQA 2Y0SD 1WOSA 1XZPB 3A8KA 1DCHA 2PPBA 3GTPK 3GTKA 1IW7A 3S1NK 3EQLA 4GTCA 4NOIA 5TMCA 4A3EK 2E2IA 5IOTA 1EI6A 3KYLA 1JOEA 4Y7NC 3OEPA 2PMZD 1WOOA 1JQWA 2GSUA 1TGOA 3M4AA 2ZUEA 3BUEA 3VA7A 1USMA 1WSRA 3CQZK 3MMLB 4KB2A 4KASA 4C3IK 1TWFK 3HOXK 1ZXOA 5IOQA 5IYDK 4Q5VA 1GE9A 4RMFA 1BGWA 4GTLA 2NVXC 3LHPS 4C3HK 1TWAC 1SMYD 2O5JD 1C0AA 1J6XA 1ZQ1C 3K7AC 4MQ9A 5M5XK 1MIUA 1BS2A 2A68A 2FQTA 3N0BA 4LOWA 4KMAA 1TWFC 4LK1A 2FQOA 5IOSA 4BBSC 3MAQA 1VH2A 4EJ3A 4LLGA 1RR8C 3GSIA 1WIHA 3N0CA 1IQ0A 3FKIC 2NVXA 5IYBK 1INNA 4O2DA 1TWAA 1R9TC 3GTMK 3K5MA 2Y0SA 4Q5SA 2B63K 3CQZA 1DD5A 1ISEA 4Y52K 1ZBSA 2VUMK 1TWFA 1I50C 1SEUA 2ZFZA 4P5BA 1G51A 2WB1L 3GIRA 4LR2A 1Y1VC 3HOVC 5MLC9 1YNND 1I6VD 3AH5A 4X6AC 4LQYA 5JVOA 3GTLC 3S2HC 4NOLA 1J98A 1K83C 2P8TA 1WQHA 4KMUA 3NUHA 1LPQA 4A3CC 3FKIA 3S1RK 3PO2K 1WQFA 2NVYK 1XXBA 2PMZA 3S1MK 4QJVA 4AYBD 4A3LC 4A3KK 4P9SA 5CJ9A 4PABA 1I50A 2A6ED 2O5IA 5JSNB 1Y1VA 4GTFA 1I3QK 3HOZK 5L46A 5JFEA 4A3DK 3K59A 4YFNA 3GTLA 3GDZA 2CW0D 4DDQA 5IP7K 2V6UA 4QCLA 1K83A 3GTMA 3S1MC 1O2AA 1VLOA 5IP9C 1SMYA 1A35A 2B63A 4C2MK 2JA8C 2NVQC 3A8IA 2B9SB 2D6FC 5C3EC 4KC6A 1O26A 2Y3PA 5IP7C 3GTJC 4C3JC 3SJRA 4KN7A 4H3TA 3OPFA 1A31A 4L8IA 4NOMA 1XZQB 2JA6K 2GAGC 3FOEA 1YNJA 4QJVB 2R93C 4Y7NK 1I3QA 4PAAA 5C9HA 2E2JC 3BP8C 1I6VA 1YNNA 4KMHA 2R4GA 3T02A 3GTJA 5IORA 4Q5GA 1WOPA 5C4JC 1T8IA 3QX3A 4C2MA 2JA6C 3DU6A 5IYCK 1DCOA 3S2DC 4A3IC 4WILA 2XCRB 4LK0A 4A3JK 4IP8A 2NVXK 2NVTC 2BE5D 1TWAK 1R5ZA 2R93A 5CQGA 3K7AK 3S14C 1WSVA 3SZYA 4BBRC 2XCQA 2R7ZK 3TFJA 1IE0A 4BLBA 4IP9A 1UV7A 5IYCC 4MEXA 4BBSK 4A3JC 2JA6A 2A69D 1K4SA 4BY1K 3S1QC 4JLRC 3PO3C 1F93A 2A6HA 3FKIK 5HL8A 2WB1A 4GTEA 3HKZL 3GTOC 1R9TK 4MEYA 5M5YK 3DU5A 4AH6A 2R7ZC 4AYBL 3S16K 2ZUFA 3WODA 1I50K 3HOVK 5D4DA 3GTGC 4BY1C 1Y1VK 4X6AK 1TWGC 3GTQC 3GTLK 4ILDA 3S2HK 1SFOC 1WCMC 4A3MC 1RRJA 1K83K 1IL2A 3S16C 5FJ8K 4A3CK 4XLPA 2R92C 3HOWC 3GTOA 4XLNA 4G7HA 1SC7A 2R7ZA 3T01A 1A36A 2JA5C 2V6TA 4A3LK 3LF9A 5FLMC 1EH1A 3H0GK 1KQ4A 5CHPA 5TJ3A 1F7VA 3JSTA 1L0WA 4G0UA 2KWAA 1WQGA 1RU0A 1TWHC 2W7VA 3GTGA 3V4GA 4KATA 4A3GK 5C4XC 1XZQA 1EFWA 4FGUA 2JA7C 3H3VD 1R49A 3AQPA 1VJEA 1WCMA 3N3YA 4BY7C 1Q8IA 3HKZD 1R9TA 1O27A 3L4KA 1Y1WC 1BDFA 4O26A 5IP9K 4FM9A 1ZVUA 2GSOA 3H0GC 2JA8K 1XXCA 2JA5A 5EGEA 4JK1A 2NVQK 1IW7D 3K57A 4OINA 1TWCC 4A3GC 3I4MC 3DXJA 5C3EK 2XCOA 1TWHA 1WORA 1J6VA 3GTJK 4C3JK 1XXAA 1O24A 2JA7A 2O5JA 1Y1WA 3TFIA 4QIWD 1EJ9A 3ERED 3K5NA 1IBAA 3H0GA 4KAWX 2R93K 3HOUC 3IPJA 1IS1A 1TWCA 3M4OK 2E2JK 4OIQA 3TFHA 4A3BK 2F4QA 3GEHA 5C44C 1HQMD 5C4JK 3OREA 1EK8A 3K58A 1XPPA 1EQRA 3HOYC 3S2DK 4A3IK 3GTKC 3M4OC 2NVTK 4A3BC 4XSXA 4BKWA 4BXXC 3S17C 3T00A 3S14K 4BBRK 1O25A 1I6HK 3L4JA 4M1XA 2E2HC 1B4BA 2P5MA 3RZOC 1X31C 4A93C 1VRQC 4KN4A 1HI9A 3HKZA 4FZBA 3GEEA 4AYBA 3S1QK 4LMOA 1PJ7A 4AN8A 1V5VA 3PO3K 1YX2A 4A3FC 2A6EA 3LAJA 3GTOK 4G0VA 4G7ZA 3A8JA 2RGRA 4XSZA 3K5LA 2CW0A 3M3YC 3RZDC 4G7OA 1F9NA 4ZH4A 3GTGK 1O2BA 2E2HA 3I4NC 4FXDA 1TWGK 3GTQK 4KARA 3GTPC 3H3VL 2PHCB 4AHCA 4QIWA 2WAQL 1SFOK 1WCMK 3S1NC 4A3MK 2R92K 3HOWK 4A3EC 4KM8A 2JA5K 3WVOA 2YU9K 2PA8D 5FLMK 4KMDA 1TWHK 5M3MK 1HQMA 1USOA 4WJ4A 5C4XK 3GTPA 2JA7K 1PJ6A 1V9MA 3AD8C 3TTGA 3AD7C 4BY7K 3CQZC 4C3IC 3HOXC 1Y1WK 4YFKA 4QIWL 3FHZA 2YU9C 4WJ3M 1O28A 5IYDC 3P9AA 1Y698 3IAYA 1TWCK 3AQOA 2EBBA 4C3HC 3I4MK 1TWGA 5JSBB 3GTQA 1ZYRD 4YG2A 1K4TA 1VGXA 1O29A 2WAQD 1SFOA 5TMFA 1B4AA 4C45A 5M5WK 2BE5A 4LJZA 1PJ5A 2R92A 1YNJD 2YU9A 3BP3A 4Q4ZA 3GEIA 1AB4A 4XCHA
chains in the Genus database with same CATH topology
4IP8A 2BE5D 1HQMD 1R5ZA 2R93A 5CQGA 3OREA 5IOSA 1EK8A 3K58A 3MAQA 4KB4A 4GT9A 2CFAA 2GSNA 4EJ3A 2XCQA 1RR8C 1WIHA 1BJTA 4GTAA 3N0CA 4BLBA 4P5AA 2NVXA 4BKWA 4IP9A 1NH3A 1TWAA 2JA6A 2A69D 1K4SA 3K5MA 2Y0SA 1O25A 4JLRC 2JH3A 3CQZA 1DD5A 4OYDB 1ISEA 3L4JA 1ZBSA 4M1XA 3S0XA 1TWFA 5EGHA 4NOKA 4D3ZA 1SEUA 1B4BA 2P5MA 2ZFZA 4P5BA 2WB1A 4GTEA 4LR2A 5MLC9 1YNND 4D3YA 1I6VD 3HKZA 3AH5A 3G4AA 3DU5A 4LQYA 4FZBA 5JVOA 4AYBA 4LMOA 4AN8A 4NOLA 4KDDA 1WQHA 2VUMA 2A6HD 3NUHA 3LAJA 3K5OA 1LPQA 3FKIA 4G0VA 1WQFA 2RH6A 3Q3QA 2A68D 2RGRA 1XXBA 2PMZA 3K5LA 4ILDA 4GTDA 4G0WA 1F9NA 1RRJA 5CJ9A 4F3EA 4BLAA 1I50A 2A6ED 1O2BA 2E2HA 3LAPA 4J3NA 5JSNB 1Y1VA 3GTOA 4FXDA 4GTFA 2NVYA 1SC7A 2R7ZA 3CAGA 1A36A 4KARA 2PHCB 3G4CA 4KM9A 3K59A 4C2MC 5JFEA 4AHCA 4QIWA 3GTLA 3LF9A 2WAQA 2CW0D 1EH1A 4FYDA 4DDQA 3LPXA 2CFAB 1KQ4A 4GTBA 4QCLA 5CHPA 1TL8A 5TJ3A 4G0UA 1K83A 2KWAA 1WQGA 3GTMA 4GFQA 1O2AA 3GTGA 3V4GA 4KATA 1A35A 2B63A 4KM8A 3GTKA 3WVOA 4FGUA 1R49A 2B9SB 3AQPA 1WCMA 3N3YA 4KMDA 1Q8IA 1R9TA 1O27A 4GTCA 3L4KA 4KC6A 4O26A 1O26A 2Y3PA 4FM9A 1ZVUA 2GSOA 2E2IA 4C3JC 1XXCA 3GTPA 2JA5A 5IOTA 5EGEA 3FOFA 1V9MA 3SJRA 1IW7D 3K57A 3KYLA 4H3TA 4C3IC 3OPFA 1A31A 2XCOA 3FHZA 3OEPA 1TWHA 1O28A 4L8IA 4NOMA 2GSUA 1TGOA 3M4AA 1XXAA 3P9AA 1Y698 3BUEA 3FOEA 3VA7A 1O24A 3IAYA 2JA7A 3AQOA 4KB2A 3MMLB 4KASA 4C3HC 1TWGA 5JSBB 1I3QA 5C9HA 3GTQA 1ZYRD 1Y1WA 1ZXOA 1K4TA 1O29A 1EJ9A 5IOQA 4Q5VA 1SFOA 1GE9A 2R4GA 3K5NA 1B4AA 3GTJA 3H0GA 4KMHA 3ERED 1BGWA 5IORA 4GTLA 4KAWX 4Q5GA 2R92A 1YNJD 3LHPS 1IS1A 1TWCA 1SMYD 2O5JD 1T8IA 3QX3A 4C2MA 3DU6A 2YU9A 2F4QA 1MIUA 3N0BA 4KMAA 1AB4A 2XCRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH1 A;  4DDQ A;  3LPX A;  4L8I A;  5JVO A;  4G0U A;  2KWA A;  1WQG A;  1XXA A;  2XCO A;  4GFQ A;  1Y69 8;  3BUE A;  3ORE A;  3V4G A;  3VA7 A;  4KDD A;  3FOE A;  1EK8 A;  4KB4 A;  1WQH A;  3MML B;  4KB2 A;  3NUH A;  3LAJ A;  1AB4 A;  2XCQ A;  5JSB B;  3FHZ A;  4G0V A;  1WQF A;  1BJT A;  1WIH A;  2RGR A;  1XXB A;  1GE9 A;  3ERE D;  1B4A A;  3L4K A;  1F9N A;  4KC6 A;  1BGW A;  2Y3P A;  4KAW X;  5CJ9 A;  4FM9 A;  3LHP S;  1ZVU A;  1IS1 A;  1XXC A;  3LAP A;  4JLR C;  4J3N A;  1DD5 A;  4OYD B;  1ISE A;  5JSN B;  3L4J A;  3QX3 A;  3CAG A;  2ZFZ A;  1B4B A;  2P5M A;  2PHC B;  4G0W A;  3OPF A;  3FOF A;  5MLC 9;  3LF9 A;  2XCR B;  3OEP A; 
#chains in the Genus database with same CATH topology
 3HOU K;  4GZY A;  5IYB C;  1O2F B;  1DCP A;  2A69 A;  3GTM C;  4GT9 A;  4KB4 A;  2CFA A;  2GSN A;  2B63 C;  1BJT A;  5C44 K;  4GTA A;  4Y52 C;  2VUM C;  1JVI A;  1XZP A;  3S15 K;  4P5A A;  1I6H C;  1NH3 A;  2Y0S L;  3HOY K;  2JH3 A;  3GTK K;  4OYD B;  4YFX A;  3S0X A;  5EGH A;  4NOK A;  4D3Z A;  4BXX K;  3FOF A;  3S17 K;  3S1R C;  4D3Y A;  3PO2 C;  2NVY C;  3G4A A;  3SZZ A;  3S15 C;  4A3K C;  2E2I K;  4KDD A;  3ADA C;  5M3F K;  2E2H K;  2VUM A;  2A6H D;  3RZO K;  4A93 K;  3K5O A;  2WB1 D;  2RH6 A;  3Q3Q A;  2A68 D;  4OIO A;  1I3Q C;  2PMZ L;  2V6S A;  3HOZ C;  4GTD A;  3HXA A;  4OIP A;  4A3D C;  4A3F K;  4F3E A;  4BLA A;  3LAP A;  4J3N A;  3AD9 C;  4OIR A;  2NVY A;  2E2I C;  2PA8 L;  1ZYR A;  3CAG A;  4C2M C;  4KM9 A;  3G4C A;  4G0W A;  1F7U A;  3M3Y K;  3RZD K;  2WAQ A;  4FYD A;  1J6W A;  2GAH C;  3LPX A;  2CFA B;  5E68 A;  4GTB A;  1TL8 A;  3I4N K;  1YCL A;  4GFQ A;  2Y0S D;  1WOS A;  1XZP B;  3A8K A;  1DCH A;  2PPB A;  3GTP K;  3GTK A;  1IW7 A;  3S1N K;  3EQL A;  4GTC A;  4NOI A;  5TMC A;  4A3E K;  2E2I A;  5IOT A;  1EI6 A;  3KYL A;  1JOE A;  4Y7N C;  3OEP A;  2PMZ D;  1WOO A;  1JQW A;  2GSU A;  1TGO A;  3M4A A;  2ZUE A;  3BUE A;  3VA7 A;  1USM A;  1WSR A;  3CQZ K;  3MML B;  4KB2 A;  4KAS A;  4C3I K;  1TWF K;  3HOX K;  1ZXO A;  5IOQ A;  5IYD K;  4Q5V A;  1GE9 A;  4RMF A;  1BGW A;  4GTL A;  2NVX C;  3LHP S;  4C3H K;  1TWA C;  1SMY D;  2O5J D;  1C0A A;  1J6X A;  1ZQ1 C;  3K7A C;  4MQ9 A;  5M5X K;  1MIU A;  1BS2 A;  2A68 A;  2FQT A;  3N0B A;  4LOW A;  4KMA A;  1TWF C;  4LK1 A;  2FQO A;  5IOS A;  4BBS C;  3MAQ A;  1VH2 A;  4EJ3 A;  4LLG A;  1RR8 C;  3GSI A;  1WIH A;  3N0C A;  1IQ0 A;  3FKI C;  2NVX A;  5IYB K;  1INN A;  4O2D A;  1TWA A;  1R9T C;  3GTM K;  3K5M A;  2Y0S A;  4Q5S A;  2B63 K;  3CQZ A;  1DD5 A;  1ISE A;  4Y52 K;  1ZBS A;  2VUM K;  1TWF A;  1I50 C;  1SEU A;  2ZFZ A;  4P5B A;  1G51 A;  2WB1 L;  3GIR A;  4LR2 A;  1Y1V C;  3HOV C;  5MLC 9;  1YNN D;  1I6V D;  3AH5 A;  4X6A C;  4LQY A;  5JVO A;  3GTL C;  3S2H C;  4NOL A;  1J98 A;  1K83 C;  2P8T A;  1WQH A;  4KMU A;  3NUH A;  1LPQ A;  4A3C C;  3FKI A;  3S1R K;  3PO2 K;  1WQF A;  2NVY K;  1XXB A;  2PMZ A;  3S1M K;  4QJV A;  4AYB D;  4A3L C;  4A3K K;  4P9S A;  5CJ9 A;  4PAB A;  1I50 A;  2A6E D;  2O5I A;  5JSN B;  1Y1V A;  4GTF A;  1I3Q K;  3HOZ K;  5L46 A;  5JFE A;  4A3D K;  3K59 A;  4YFN A;  3GTL A;  3GDZ A;  2CW0 D;  4DDQ A;  5IP7 K;  2V6U A;  4QCL A;  1K83 A;  3GTM A;  3S1M C;  1O2A A;  1VLO A;  5IP9 C;  1SMY A;  1A35 A;  2B63 A;  4C2M K;  2JA8 C;  2NVQ C;  3A8I A;  2B9S B;  2D6F C;  5C3E C;  4KC6 A;  1O26 A;  2Y3P A;  5IP7 C;  3GTJ C;  4C3J C;  3SJR A;  4KN7 A;  4H3T A;  3OPF A;  1A31 A;  4L8I A;  4NOM A;  1XZQ B;  2JA6 K;  2GAG C;  3FOE A;  1YNJ A;  4QJV B;  2R93 C;  4Y7N K;  1I3Q A;  4PAA A;  5C9H A;  2E2J C;  3BP8 C;  1I6V A;  1YNN A;  4KMH A;  2R4G A;  3T02 A;  3GTJ A;  5IOR A;  4Q5G A;  1WOP A;  5C4J C;  1T8I A;  3QX3 A;  4C2M A;  2JA6 C;  3DU6 A;  5IYC K;  1DCO A;  3S2D C;  4A3I C;  4WIL A;  2XCR B;  4LK0 A;  4A3J K;  4IP8 A;  2NVX K;  2NVT C;  2BE5 D;  1TWA K;  1R5Z A;  2R93 A;  5CQG A;  3K7A K;  3S14 C;  1WSV A;  3SZY A;  4BBR C;  2XCQ A;  2R7Z K;  3TFJ A;  1IE0 A;  4BLB A;  4IP9 A;  1UV7 A;  5IYC C;  4MEX A;  4BBS K;  4A3J C;  2JA6 A;  2A69 D;  1K4S A;  4BY1 K;  3S1Q C;  4JLR C;  3PO3 C;  1F93 A;  2A6H A;  3FKI K;  5HL8 A;  2WB1 A;  4GTE A;  3HKZ L;  3GTO C;  1R9T K;  4MEY A;  5M5Y K;  3DU5 A;  4AH6 A;  2R7Z C;  4AYB L;  3S16 K;  2ZUF A;  3WOD A;  1I50 K;  3HOV K;  5D4D A;  3GTG C;  4BY1 C;  1Y1V K;  4X6A K;  1TWG C;  3GTQ C;  3GTL K;  4ILD A;  3S2H K;  1SFO C;  1WCM C;  4A3M C;  1RRJ A;  1K83 K;  1IL2 A;  3S16 C;  5FJ8 K;  4A3C K;  4XLP A;  2R92 C;  3HOW C;  3GTO A;  4XLN A;  4G7H A;  1SC7 A;  2R7Z A;  3T01 A;  1A36 A;  2JA5 C;  2V6T A;  4A3L K;  3LF9 A;  5FLM C;  1EH1 A;  3H0G K;  1KQ4 A;  5CHP A;  5TJ3 A;  1F7V A;  3JST A;  1L0W A;  4G0U A;  2KWA A;  1WQG A;  1RU0 A;  1TWH C;  2W7V A;  3GTG A;  3V4G A;  4KAT A;  4A3G K;  5C4X C;  1XZQ A;  1EFW A;  4FGU A;  2JA7 C;  3H3V D;  1R49 A;  3AQP A;  1VJE A;  1WCM A;  3N3Y A;  4BY7 C;  1Q8I A;  3HKZ D;  1R9T A;  1O27 A;  3L4K A;  1Y1W C;  1BDF A;  4O26 A;  5IP9 K;  4FM9 A;  1ZVU A;  2GSO A;  3H0G C;  2JA8 K;  1XXC A;  2JA5 A;  5EGE A;  4JK1 A;  2NVQ K;  1IW7 D;  3K57 A;  4OIN A;  1TWC C;  4A3G C;  3I4M C;  3DXJ A;  5C3E K;  2XCO A;  1TWH A;  1WOR A;  1J6V A;  3GTJ K;  4C3J K;  1XXA A;  1O24 A;  2JA7 A;  2O5J A;  1Y1W A;  3TFI A;  4QIW D;  1EJ9 A;  3ERE D;  3K5N A;  1IBA A;  3H0G A;  4KAW X;  2R93 K;  3HOU C;  3IPJ A;  1IS1 A;  1TWC A;  3M4O K;  2E2J K;  4OIQ A;  3TFH A;  4A3B K;  2F4Q A;  3GEH A;  5C44 C;  1HQM D;  5C4J K;  3ORE A;  1EK8 A;  3K58 A;  1XPP A;  1EQR A;  3HOY C;  3S2D K;  4A3I K;  3GTK C;  3M4O C;  2NVT K;  4A3B C;  4XSX A;  4BKW A;  4BXX C;  3S17 C;  3T00 A;  3S14 K;  4BBR K;  1O25 A;  1I6H K;  3L4J A;  4M1X A;  2E2H C;  1B4B A;  2P5M A;  3RZO C;  1X31 C;  4A93 C;  1VRQ C;  4KN4 A;  1HI9 A;  3HKZ A;  4FZB A;  3GEE A;  4AYB A;  3S1Q K;  4LMO A;  1PJ7 A;  4AN8 A;  1V5V A;  3PO3 K;  1YX2 A;  4A3F C;  2A6E A;  3LAJ A;  3GTO K;  4G0V A;  4G7Z A;  3A8J A;  2RGR A;  4XSZ A;  3K5L A;  2CW0 A;  3M3Y C;  3RZD C;  4G7O A;  1F9N A;  4ZH4 A;  3GTG K;  1O2B A;  2E2H A;  3I4N C;  4FXD A;  1TWG K;  3GTQ K;  4KAR A;  3GTP C;  3H3V L;  2PHC B;  4AHC A;  4QIW A;  2WAQ L;  1SFO K;  1WCM K;  3S1N C;  4A3M K;  2R92 K;  3HOW K;  4A3E C;  4KM8 A;  2JA5 K;  3WVO A;  2YU9 K;  2PA8 D;  5FLM K;  4KMD A;  1TWH K;  5M3M K;  1HQM A;  1USO A;  4WJ4 A;  5C4X K;  3GTP A;  2JA7 K;  1PJ6 A;  1V9M A;  3AD8 C;  3TTG A;  3AD7 C;  4BY7 K;  3CQZ C;  4C3I C;  3HOX C;  1Y1W K;  4YFK A;  4QIW L;  3FHZ A;  2YU9 C;  4WJ3 M;  1O28 A;  5IYD C;  3P9A A;  1Y69 8;  3IAY A;  1TWC K;  3AQO A;  2EBB A;  4C3H C;  3I4M K;  1TWG A;  5JSB B;  3GTQ A;  1ZYR D;  4YG2 A;  1K4T A;  1VGX A;  1O29 A;  2WAQ D;  1SFO A;  5TMF A;  1B4A A;  4C45 A;  5M5W K;  2BE5 A;  4LJZ A;  1PJ5 A;  2R92 A;  1YNJ D;  2YU9 A;  3BP3 A;  4Q4Z A;  3GEI A;  1AB4 A;  4XCH A; 
#chains in the Genus database with same CATH homology
 4IP8 A;  2BE5 D;  1HQM D;  1R5Z A;  2R93 A;  5CQG A;  3ORE A;  5IOS A;  1EK8 A;  3K58 A;  3MAQ A;  4KB4 A;  4GT9 A;  2CFA A;  2GSN A;  4EJ3 A;  2XCQ A;  1RR8 C;  1WIH A;  1BJT A;  4GTA A;  3N0C A;  4BLB A;  4P5A A;  2NVX A;  4BKW A;  4IP9 A;  1NH3 A;  1TWA A;  2JA6 A;  2A69 D;  1K4S A;  3K5M A;  2Y0S A;  1O25 A;  4JLR C;  2JH3 A;  3CQZ A;  1DD5 A;  4OYD B;  1ISE A;  3L4J A;  1ZBS A;  4M1X A;  3S0X A;  1TWF A;  5EGH A;  4NOK A;  4D3Z A;  1SEU A;  1B4B A;  2P5M A;  2ZFZ A;  4P5B A;  2WB1 A;  4GTE A;  4LR2 A;  5MLC 9;  1YNN D;  4D3Y A;  1I6V D;  3HKZ A;  3AH5 A;  3G4A A;  3DU5 A;  4LQY A;  4FZB A;  5JVO A;  4AYB A;  4LMO A;  4AN8 A;  4NOL A;  4KDD A;  1WQH A;  2VUM A;  2A6H D;  3NUH A;  3LAJ A;  3K5O A;  1LPQ A;  3FKI A;  4G0V A;  1WQF A;  2RH6 A;  3Q3Q A;  2A68 D;  2RGR A;  1XXB A;  2PMZ A;  3K5L A;  4ILD A;  4GTD A;  4G0W A;  1F9N A;  1RRJ A;  5CJ9 A;  4F3E A;  4BLA A;  1I50 A;  2A6E D;  1O2B A;  2E2H A;  3LAP A;  4J3N A;  5JSN B;  1Y1V A;  3GTO A;  4FXD A;  4GTF A;  2NVY A;  1SC7 A;  2R7Z A;  3CAG A;  1A36 A;  4KAR A;  2PHC B;  3G4C A;  4KM9 A;  3K59 A;  4C2M C;  5JFE A;  4AHC A;  4QIW A;  3GTL A;  3LF9 A;  2WAQ A;  2CW0 D;  1EH1 A;  4FYD A;  4DDQ A;  3LPX A;  2CFA B;  1KQ4 A;  4GTB A;  4QCL A;  5CHP A;  1TL8 A;  5TJ3 A;  4G0U A;  1K83 A;  2KWA A;  1WQG A;  3GTM A;  4GFQ A;  1O2A A;  3GTG A;  3V4G A;  4KAT A;  1A35 A;  2B63 A;  4KM8 A;  3GTK A;  3WVO A;  4FGU A;  1R49 A;  2B9S B;  3AQP A;  1WCM A;  3N3Y A;  4KMD A;  1Q8I A;  1R9T A;  1O27 A;  4GTC A;  3L4K A;  4KC6 A;  4O26 A;  1O26 A;  2Y3P A;  4FM9 A;  1ZVU A;  2GSO A;  2E2I A;  4C3J C;  1XXC A;  3GTP A;  2JA5 A;  5IOT A;  5EGE A;  3FOF A;  1V9M A;  3SJR A;  1IW7 D;  3K57 A;  3KYL A;  4H3T A;  4C3I C;  3OPF A;  1A31 A;  2XCO A;  3FHZ A;  3OEP A;  1TWH A;  1O28 A;  4L8I A;  4NOM A;  2GSU A;  1TGO A;  3M4A A;  1XXA A;  3P9A A;  1Y69 8;  3BUE A;  3FOE A;  3VA7 A;  1O24 A;  3IAY A;  2JA7 A;  3AQO A;  4KB2 A;  3MML B;  4KAS A;  4C3H C;  1TWG A;  5JSB B;  1I3Q A;  5C9H A;  3GTQ A;  1ZYR D;  1Y1W A;  1ZXO A;  1K4T A;  1O29 A;  1EJ9 A;  5IOQ A;  4Q5V A;  1SFO A;  1GE9 A;  2R4G A;  3K5N A;  1B4A A;  3GTJ A;  3H0G A;  4KMH A;  3ERE D;  1BGW A;  5IOR A;  4GTL A;  4KAW X;  4Q5G A;  2R92 A;  1YNJ D;  3LHP S;  1IS1 A;  1TWC A;  1SMY D;  2O5J D;  1T8I A;  3QX3 A;  4C2M A;  3DU6 A;  2YU9 A;  2F4Q A;  1MIU A;  3N0B A;  4KMA A;  1AB4 A;  2XCR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...