3LHPS

Crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
116
structure length
116
Chain Sequence
GSISDIRKDAEVRMDKAVEAFKNKLDKFKAAVRKVFPTEERIKDWLKIVRGEAEQARVAVRNVGRDANDKAAALGKDKEINWFDISQSLWDVQKLTDAAIKKIEAALADMEAWLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fv 4E10 heavy chain
total genus 48
structure length 116
sequence length 116
chains with identical sequence T
ec nomenclature
pdb deposition date 2010-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 3lhpS00
1WQGA 4KC6A 5JSNB 3LF9A 1ISEA 4KB4A 1GE9A 1WQHA 1DD5A 1IS1A 5MLC9 1WQFA 1Y698 4GFQA 1EK8A 3LHPS 4JLRC 4KDDA 1EH1A 4KB2A 4OYDB 4L8IA 4KAWX 5JSBB
chains in the Genus database with same CATH superfamily
1R49A 5JSNB 4AN8A 3MAQA 3GTOA 3K5LA 3WVOA 3K5MA 4NOMA 4AYBA 2WAQA 3LF9A 1R9TA 3GTMA 1V9MA 1WQHA 2NVXA 4FGUA 3GTGA 5MLC9 4NOLA 1HQMD 1TWHA 1NH3A 1TWAA 4GFQA 1SC7A 4JLRC 1A31A 2WB1A 4OYDB 2R93A 1Y1VA 5JSBB 4QIWA 2NVYA 3DU5A 1A36A 3HKZA 2R4GA 3M4AA 1WCMA 3FKIA 4FYDA 1YNJD 3DU6A 4KB4A 1GE9A 2O5JD 5C9HA 4D3YA 3GTQA 2B9SB 2JA6A 1Y698 1TWFA 2A69D 1I50A 1EK8A 4QCLA 2BE5D 3GTKA 2JA7A 1YNND 3GTJA 1R5ZA 4AHCA 2CW0D 2R92A 1SFOA 1RRJA 2E2HA 1SEUA 1I6VD 4LMOA 4KAWX 1SMYD 1T8IA 3K5OA 3SJRA 4KC6A 4O26A 3IAYA 2R7ZA 4NOKA 2B63A 3K59A 3K57A 1Q8IA 1DD5A 1TL8A 2YU9A 3GTPA 4H3TA 2F4QA 1RR8C 2E2IA 3LHPS 4C2MA 1MIUA 4L8IA 2A6HD 1I3QA 1Y1WA 4EJ3A 4D3ZA 1WQGA 2A6ED 3H0GA 2A68D 1K83A 1EJ9A 1K4SA 1K4TA 1ISEA 3K58A 1ZYRD 5CQGA 1TWGA 2JA5A 4Q5GA 4IP8A 1IS1A 1WQFA 2PMZA 4F3EA 1LPQA 4FXDA 1TWCA 1IW7D 3CQZA 1TGOA 4KDDA 1EH1A 4Q5VA 3KYLA 3GTLA 4KB2A 4IP9A 1A35A 3K5NA 2VUMA 3P9AA 2Y0SA
chains in the Genus database with same CATH topology
1R49A 5JSNB 4AN8A 3MAQA 3GTOA 3K5LA 3WVOA 3K5MA 4NOMA 4AYBA 2WAQA 3LF9A 1R9TA 3GTMA 1V9MA 1WQHA 2NVXA 4FGUA 3GTGA 5MLC9 4NOLA 1HQMD 1TWHA 1NH3A 1TWAA 4GFQA 1SC7A 4JLRC 1A31A 2WB1A 4OYDB 2R93A 1Y1VA 5JSBB 4QIWA 2NVYA 3DU5A 1A36A 3HKZA 2R4GA 3M4AA 1WCMA 3FKIA 4FYDA 1YNJD 3DU6A 4KB4A 1GE9A 2O5JD 5C9HA 4D3YA 3GTQA 2B9SB 2JA6A 1Y698 1TWFA 2A69D 1I50A 1EK8A 4QCLA 2BE5D 3GTKA 2JA7A 1YNND 3GTJA 1R5ZA 4AHCA 2CW0D 2R92A 1SFOA 1RRJA 2E2HA 1SEUA 1I6VD 4LMOA 4KAWX 1SMYD 1T8IA 3K5OA 3SJRA 4KC6A 4O26A 3IAYA 2R7ZA 4NOKA 2B63A 3K59A 3K57A 1Q8IA 1DD5A 1TL8A 2YU9A 3GTPA 4H3TA 2F4QA 1RR8C 2E2IA 3LHPS 4C2MA 1MIUA 4L8IA 2A6HD 1I3QA 1Y1WA 4EJ3A 4D3ZA 1WQGA 2A6ED 3H0GA 2A68D 1K83A 1EJ9A 1K4SA 1K4TA 1ISEA 3K58A 1ZYRD 5CQGA 1TWGA 2JA5A 4Q5GA 4IP8A 1IS1A 1WQFA 2PMZA 4F3EA 1LPQA 4FXDA 1TWCA 1IW7D 3CQZA 1TGOA 4KDDA 1EH1A 4Q5VA 3KYLA 3GTLA 4KB2A 4IP9A 1A35A 3K5NA 2VUMA 3P9AA 2Y0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQG A;  4KC6 A;  5JSN B;  3LF9 A;  1ISE A;  4KB4 A;  1GE9 A;  1WQH A;  1DD5 A;  1IS1 A;  5MLC 9;  1WQF A;  1Y69 8;  4GFQ A;  1EK8 A;  3LHP S;  4JLR C;  4KDD A;  1EH1 A;  4KB2 A;  4OYD B;  4L8I A;  4KAW X;  5JSB B; 
#chains in the Genus database with same CATH topology
 1R49 A;  5JSN B;  4AN8 A;  3MAQ A;  3GTO A;  3K5L A;  3WVO A;  3K5M A;  4NOM A;  4AYB A;  2WAQ A;  3LF9 A;  1R9T A;  3GTM A;  1V9M A;  1WQH A;  2NVX A;  4FGU A;  3GTG A;  5MLC 9;  4NOL A;  1HQM D;  1TWH A;  1NH3 A;  1TWA A;  4GFQ A;  1SC7 A;  4JLR C;  1A31 A;  2WB1 A;  4OYD B;  2R93 A;  1Y1V A;  5JSB B;  4QIW A;  2NVY A;  3DU5 A;  1A36 A;  3HKZ A;  2R4G A;  3M4A A;  1WCM A;  3FKI A;  4FYD A;  1YNJ D;  3DU6 A;  4KB4 A;  1GE9 A;  2O5J D;  5C9H A;  4D3Y A;  3GTQ A;  2B9S B;  2JA6 A;  1Y69 8;  1TWF A;  2A69 D;  1I50 A;  1EK8 A;  4QCL A;  2BE5 D;  3GTK A;  2JA7 A;  1YNN D;  3GTJ A;  1R5Z A;  4AHC A;  2CW0 D;  2R92 A;  1SFO A;  1RRJ A;  2E2H A;  1SEU A;  1I6V D;  4LMO A;  4KAW X;  1SMY D;  1T8I A;  3K5O A;  3SJR A;  4KC6 A;  4O26 A;  3IAY A;  2R7Z A;  4NOK A;  2B63 A;  3K59 A;  3K57 A;  1Q8I A;  1DD5 A;  1TL8 A;  2YU9 A;  3GTP A;  4H3T A;  2F4Q A;  1RR8 C;  2E2I A;  3LHP S;  4C2M A;  1MIU A;  4L8I A;  2A6H D;  1I3Q A;  1Y1W A;  4EJ3 A;  4D3Z A;  1WQG A;  2A6E D;  3H0G A;  2A68 D;  1K83 A;  1EJ9 A;  1K4S A;  1K4T A;  1ISE A;  3K58 A;  1ZYR D;  5CQG A;  1TWG A;  2JA5 A;  4Q5G A;  4IP8 A;  1IS1 A;  1WQF A;  2PMZ A;  4F3E A;  1LPQ A;  4FXD A;  1TWC A;  1IW7 D;  3CQZ A;  1TGO A;  4KDD A;  1EH1 A;  4Q5V A;  3KYL A;  3GTL A;  4KB2 A;  4IP9 A;  1A35 A;  3K5N A;  2VUM A;  3P9A A;  2Y0S A; 
#chains in the Genus database with same CATH homology
 1R49 A;  5JSN B;  4AN8 A;  3MAQ A;  3GTO A;  3K5L A;  3WVO A;  3K5M A;  4NOM A;  4AYB A;  2WAQ A;  3LF9 A;  1R9T A;  3GTM A;  1V9M A;  1WQH A;  2NVX A;  4FGU A;  3GTG A;  5MLC 9;  4NOL A;  1HQM D;  1TWH A;  1NH3 A;  1TWA A;  4GFQ A;  1SC7 A;  4JLR C;  1A31 A;  2WB1 A;  4OYD B;  2R93 A;  1Y1V A;  5JSB B;  4QIW A;  2NVY A;  3DU5 A;  1A36 A;  3HKZ A;  2R4G A;  3M4A A;  1WCM A;  3FKI A;  4FYD A;  1YNJ D;  3DU6 A;  4KB4 A;  1GE9 A;  2O5J D;  5C9H A;  4D3Y A;  3GTQ A;  2B9S B;  2JA6 A;  1Y69 8;  1TWF A;  2A69 D;  1I50 A;  1EK8 A;  4QCL A;  2BE5 D;  3GTK A;  2JA7 A;  1YNN D;  3GTJ A;  1R5Z A;  4AHC A;  2CW0 D;  2R92 A;  1SFO A;  1RRJ A;  2E2H A;  1SEU A;  1I6V D;  4LMO A;  4KAW X;  1SMY D;  1T8I A;  3K5O A;  3SJR A;  4KC6 A;  4O26 A;  3IAY A;  2R7Z A;  4NOK A;  2B63 A;  3K59 A;  3K57 A;  1Q8I A;  1DD5 A;  1TL8 A;  2YU9 A;  3GTP A;  4H3T A;  2F4Q A;  1RR8 C;  2E2I A;  3LHP S;  4C2M A;  1MIU A;  4L8I A;  2A6H D;  1I3Q A;  1Y1W A;  4EJ3 A;  4D3Z A;  1WQG A;  2A6E D;  3H0G A;  2A68 D;  1K83 A;  1EJ9 A;  1K4S A;  1K4T A;  1ISE A;  3K58 A;  1ZYR D;  5CQG A;  1TWG A;  2JA5 A;  4Q5G A;  4IP8 A;  1IS1 A;  1WQF A;  2PMZ A;  4F3E A;  1LPQ A;  4FXD A;  1TWC A;  1IW7 D;  3CQZ A;  1TGO A;  4KDD A;  1EH1 A;  4Q5V A;  3KYL A;  3GTL A;  4KB2 A;  4IP9 A;  1A35 A;  3K5N A;  2VUM A;  3P9A A;  2Y0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...