3LHPS

Crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
116
structure length
116
Chain Sequence
GSISDIRKDAEVRMDKAVEAFKNKLDKFKAAVRKVFPTEERIKDWLKIVRGEAEQARVAVRNVGRDANDKAAALGKDKEINWFDISQSLWDVQKLTDAAIKKIEAALADMEAWLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fv 4E10 heavy chain
publication title Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 116
sequence length 116
chains with identical sequence T
ec nomenclature
pdb deposition date 2010-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 3lhpS00
4KAWX 3LF9A 4KC6A 1DD5A 4GFQA 4KB2A 5JSNB 4OYDB 1Y698 4L8IA 1WQGA 1WQFA 4KDDA 5MLC9 4KB4A 1WQHA 3LHPS 1GE9A 4JLRC 5JSBB 1EK8A 1ISEA 1EH1A 1IS1A
chains in the Genus database with same CATH superfamily
2E2IA 2JA5A 4NOMA 1A31A 1YNND 1R5ZA 2Y0SA 4KB2A 1K4SA 2R7ZA 1WQGA 1NH3A 2A69D 2YU9A 3K5OA 5MLC9 3K59A 4KB4A 5CQGA 4QCLA 2VUMA 1TWAA 3P9AA 2WB1A 4NOKA 3GTMA 1TWGA 4AN8A 3K58A 2CW0D 1SEUA 3K57A 2F4QA 1Q8IA 1SMYD 3GTGA 1Y1WA 3LF9A 1A36A 3H0GA 4QIWA 4Q5GA 1TGOA 4OYDB 1Y698 3K5MA 4C2MA 1WQFA 1YNJD 1RRJA 2A6ED 4Q5VA 2JA6A 2B9SB 1WQHA 4FXDA 2R93A 2B63A 2A6HD 4JLRC 2BE5D 1I3QA 1V9MA 4LMOA 3KYLA 1I6VD 1ZYRD 3K5LA 1EJ9A 2E2HA 3FKIA 4KAWX 3WVOA 4FGUA 1K4TA 1TWCA 4H3TA 4EJ3A 4D3YA 2PMZA 1K83A 1TWFA 4O26A 4KDDA 2A68D 1SFOA 4AYBA 1LPQA 3M4AA 1WCMA 3HKZA 2O5JD 3IAYA 4F3EA 1SC7A 1EK8A 3GTQA 1I50A 1IW7D 1T8IA 3GTLA 1EH1A 3GTKA 3DU6A 3MAQA 1R9TA 4FYDA 4KC6A 1A35A 1DD5A 4GFQA 1RR8C 5C9HA 5JSNB 1Y1VA 3GTPA 1HQMD 2R92A 4L8IA 1R49A 2NVYA 3GTOA 3SJRA 2JA7A 3CQZA 4IP8A 4IP9A 1MIUA 1TWHA 3K5NA 2NVXA 4NOLA 3LHPS 1GE9A 2R4GA 5JSBB 1TL8A 1ISEA 2WAQA 3GTJA 3DU5A 1IS1A 4AHCA 4D3ZA
chains in the Genus database with same CATH topology
2E2IA 2JA5A 4NOMA 1A31A 1YNND 1R5ZA 2Y0SA 4KB2A 1K4SA 2R7ZA 1WQGA 1NH3A 2A69D 2YU9A 3K5OA 5MLC9 3K59A 4KB4A 5CQGA 4QCLA 2VUMA 1TWAA 3P9AA 2WB1A 4NOKA 3GTMA 1TWGA 4AN8A 3K58A 2CW0D 1SEUA 3K57A 2F4QA 1Q8IA 1SMYD 3GTGA 1Y1WA 3LF9A 1A36A 3H0GA 4QIWA 4Q5GA 1TGOA 4OYDB 1Y698 3K5MA 4C2MA 1WQFA 1YNJD 1RRJA 2A6ED 4Q5VA 2JA6A 2B9SB 1WQHA 4FXDA 2R93A 2B63A 2A6HD 4JLRC 2BE5D 1I3QA 1V9MA 4LMOA 3KYLA 1I6VD 1ZYRD 3K5LA 1EJ9A 2E2HA 3FKIA 4KAWX 3WVOA 4FGUA 1K4TA 1TWCA 4H3TA 4EJ3A 4D3YA 2PMZA 1K83A 1TWFA 4O26A 4KDDA 2A68D 1SFOA 4AYBA 1LPQA 3M4AA 1WCMA 3HKZA 2O5JD 3IAYA 4F3EA 1SC7A 1EK8A 3GTQA 1I50A 1IW7D 1T8IA 3GTLA 1EH1A 3GTKA 3DU6A 3MAQA 1R9TA 4FYDA 4KC6A 1A35A 1DD5A 4GFQA 1RR8C 5C9HA 5JSNB 1Y1VA 3GTPA 1HQMD 2R92A 4L8IA 1R49A 2NVYA 3GTOA 3SJRA 2JA7A 3CQZA 4IP8A 4IP9A 1MIUA 1TWHA 3K5NA 2NVXA 4NOLA 3LHPS 1GE9A 2R4GA 5JSBB 1TL8A 1ISEA 2WAQA 3GTJA 3DU5A 1IS1A 4AHCA 4D3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAW X;  3LF9 A;  4KC6 A;  1DD5 A;  4GFQ A;  4KB2 A;  5JSN B;  4OYD B;  1Y69 8;  4L8I A;  1WQG A;  1WQF A;  4KDD A;  5MLC 9;  4KB4 A;  1WQH A;  3LHP S;  1GE9 A;  4JLR C;  5JSB B;  1EK8 A;  1ISE A;  1EH1 A;  1IS1 A; 
#chains in the Genus database with same CATH topology
 2E2I A;  2JA5 A;  4NOM A;  1A31 A;  1YNN D;  1R5Z A;  2Y0S A;  4KB2 A;  1K4S A;  2R7Z A;  1WQG A;  1NH3 A;  2A69 D;  2YU9 A;  3K5O A;  5MLC 9;  3K59 A;  4KB4 A;  5CQG A;  4QCL A;  2VUM A;  1TWA A;  3P9A A;  2WB1 A;  4NOK A;  3GTM A;  1TWG A;  4AN8 A;  3K58 A;  2CW0 D;  1SEU A;  3K57 A;  2F4Q A;  1Q8I A;  1SMY D;  3GTG A;  1Y1W A;  3LF9 A;  1A36 A;  3H0G A;  4QIW A;  4Q5G A;  1TGO A;  4OYD B;  1Y69 8;  3K5M A;  4C2M A;  1WQF A;  1YNJ D;  1RRJ A;  2A6E D;  4Q5V A;  2JA6 A;  2B9S B;  1WQH A;  4FXD A;  2R93 A;  2B63 A;  2A6H D;  4JLR C;  2BE5 D;  1I3Q A;  1V9M A;  4LMO A;  3KYL A;  1I6V D;  1ZYR D;  3K5L A;  1EJ9 A;  2E2H A;  3FKI A;  4KAW X;  3WVO A;  4FGU A;  1K4T A;  1TWC A;  4H3T A;  4EJ3 A;  4D3Y A;  2PMZ A;  1K83 A;  1TWF A;  4O26 A;  4KDD A;  2A68 D;  1SFO A;  4AYB A;  1LPQ A;  3M4A A;  1WCM A;  3HKZ A;  2O5J D;  3IAY A;  4F3E A;  1SC7 A;  1EK8 A;  3GTQ A;  1I50 A;  1IW7 D;  1T8I A;  3GTL A;  1EH1 A;  3GTK A;  3DU6 A;  3MAQ A;  1R9T A;  4FYD A;  4KC6 A;  1A35 A;  1DD5 A;  4GFQ A;  1RR8 C;  5C9H A;  5JSN B;  1Y1V A;  3GTP A;  1HQM D;  2R92 A;  4L8I A;  1R49 A;  2NVY A;  3GTO A;  3SJR A;  2JA7 A;  3CQZ A;  4IP8 A;  4IP9 A;  1MIU A;  1TWH A;  3K5N A;  2NVX A;  4NOL A;  3LHP S;  1GE9 A;  2R4G A;  5JSB B;  1TL8 A;  1ISE A;  2WAQ A;  3GTJ A;  3DU5 A;  1IS1 A;  4AHC A;  4D3Z A; 
#chains in the Genus database with same CATH homology
 2E2I A;  2JA5 A;  4NOM A;  1A31 A;  1YNN D;  1R5Z A;  2Y0S A;  4KB2 A;  1K4S A;  2R7Z A;  1WQG A;  1NH3 A;  2A69 D;  2YU9 A;  3K5O A;  5MLC 9;  3K59 A;  4KB4 A;  5CQG A;  4QCL A;  2VUM A;  1TWA A;  3P9A A;  2WB1 A;  4NOK A;  3GTM A;  1TWG A;  4AN8 A;  3K58 A;  2CW0 D;  1SEU A;  3K57 A;  2F4Q A;  1Q8I A;  1SMY D;  3GTG A;  1Y1W A;  3LF9 A;  1A36 A;  3H0G A;  4QIW A;  4Q5G A;  1TGO A;  4OYD B;  1Y69 8;  3K5M A;  4C2M A;  1WQF A;  1YNJ D;  1RRJ A;  2A6E D;  4Q5V A;  2JA6 A;  2B9S B;  1WQH A;  4FXD A;  2R93 A;  2B63 A;  2A6H D;  4JLR C;  2BE5 D;  1I3Q A;  1V9M A;  4LMO A;  3KYL A;  1I6V D;  1ZYR D;  3K5L A;  1EJ9 A;  2E2H A;  3FKI A;  4KAW X;  3WVO A;  4FGU A;  1K4T A;  1TWC A;  4H3T A;  4EJ3 A;  4D3Y A;  2PMZ A;  1K83 A;  1TWF A;  4O26 A;  4KDD A;  2A68 D;  1SFO A;  4AYB A;  1LPQ A;  3M4A A;  1WCM A;  3HKZ A;  2O5J D;  3IAY A;  4F3E A;  1SC7 A;  1EK8 A;  3GTQ A;  1I50 A;  1IW7 D;  1T8I A;  3GTL A;  1EH1 A;  3GTK A;  3DU6 A;  3MAQ A;  1R9T A;  4FYD A;  4KC6 A;  1A35 A;  1DD5 A;  4GFQ A;  1RR8 C;  5C9H A;  5JSN B;  1Y1V A;  3GTP A;  1HQM D;  2R92 A;  4L8I A;  1R49 A;  2NVY A;  3GTO A;  3SJR A;  2JA7 A;  3CQZ A;  4IP8 A;  4IP9 A;  1MIU A;  1TWH A;  3K5N A;  2NVX A;  4NOL A;  3LHP S;  1GE9 A;  2R4G A;  5JSB B;  1TL8 A;  1ISE A;  2WAQ A;  3GTJ A;  3DU5 A;  1IS1 A;  4AHC A;  4D3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...