3LHPS

Crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
116
structure length
116
Chain Sequence
b'GSISDIRKDAEVRMDKAVEAFKNKLDKFKAAVRKVFPTEERIKDWLKIVRGEAEQARVAVRNVGRDANDKAAALGKDKEINWFDISQSLWDVQKLTDAAIKKIEAALADMEAWLTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fv 4E10 heavy chain
publication title Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 116
sequence length 116
chains with identical sequence T
ec nomenclature
pdb deposition date 2010-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 3lhpS00
4OYDB 5MLC9 4KDDA 1EK8A 4KC6A 3LF9A 1ISEA 4KAWX 4L8IA 1WQFA 4JLRC 4GFQA 1GE9A 3LHPS 4KB2A 1EH1A 1WQHA 4KB4A 1Y698 5JSBB 5JSNB 1WQGA 1DD5A 1IS1A
chains in the Genus database with same CATH superfamily
4C2MA 3GTOA 4H3TA 1HQMD 1T8IA 3WVOA 2A69D 4D3YA 3K5LA 1Q8IA 4O26A 1EJ9A 1I3QA 1R49A 3GTLA 2NVXA 3DU6A 2YU9A 3CQZA 3GTQA 3MAQA 3P9AA 3LHPS 2B9SB 1RR8C 2O5JD 1MIUA 2F4QA 1TGOA 1LPQA 4FXDA 1WQHA 3DU5A 2VUMA 5C9HA 1Y698 2R4GA 2B63A 4FYDA 3FKIA 1WCMA 4QIWA 1K4SA 1K83A 4OYDB 1I6VD 1V9MA 1ZYRD 5MLC9 2JA5A 3GTKA 1TWAA 2R92A 3GTJA 3K57A 1ISEA 2PMZA 4NOKA 3KYLA 4NOMA 4IP9A 1SC7A 4JLRC 1TWFA 3SJRA 4D3ZA 4F3EA 2WB1A 3IAYA 1TWGA 4AHCA 2R7ZA 4AN8A 1TWCA 2BE5D 1Y1VA 3K58A 1IS1A 4AYBA 3HKZA 4KDDA 1EK8A 4Q5GA 3K5OA 2E2IA 1YNND 1SEUA 1K4TA 4KAWX 2JA7A 1A36A 3GTMA 2WAQA 4EJ3A 2NVYA 4GFQA 3M4AA 1GE9A 4LMOA 1NH3A 3GTGA 1EH1A 1TL8A 1SMYD 4KB4A 2R93A 2A6HD 3H0GA 5JSBB 2CW0D 1DD5A 2Y0SA 4IP8A 1I50A 4Q5VA 1A35A 4NOLA 3K5NA 4KC6A 3LF9A 1TWHA 4L8IA 1WQFA 5CQGA 1R9TA 3K5MA 1A31A 2A6ED 3K59A 1IW7D 3GTPA 1RRJA 1SFOA 1Y1WA 4QCLA 2JA6A 1R5ZA 1YNJD 2A68D 4KB2A 4FGUA 2E2HA 5JSNB 1WQGA
chains in the Genus database with same CATH topology
4C2MA 3GTOA 4H3TA 1HQMD 1T8IA 3WVOA 2A69D 4D3YA 3K5LA 1Q8IA 4O26A 1EJ9A 1I3QA 1R49A 3GTLA 2NVXA 3DU6A 2YU9A 3CQZA 3GTQA 3MAQA 3P9AA 3LHPS 2B9SB 1RR8C 2O5JD 1MIUA 2F4QA 1TGOA 1LPQA 4FXDA 1WQHA 3DU5A 2VUMA 5C9HA 1Y698 2R4GA 2B63A 4FYDA 3FKIA 1WCMA 4QIWA 1K4SA 1K83A 4OYDB 1I6VD 1V9MA 1ZYRD 5MLC9 2JA5A 3GTKA 1TWAA 2R92A 3GTJA 3K57A 1ISEA 2PMZA 4NOKA 3KYLA 4NOMA 4IP9A 1SC7A 4JLRC 1TWFA 3SJRA 4D3ZA 4F3EA 2WB1A 3IAYA 1TWGA 4AHCA 2R7ZA 4AN8A 1TWCA 2BE5D 1Y1VA 3K58A 1IS1A 4AYBA 3HKZA 4KDDA 1EK8A 4Q5GA 3K5OA 2E2IA 1YNND 1SEUA 1K4TA 4KAWX 2JA7A 1A36A 3GTMA 2WAQA 4EJ3A 2NVYA 4GFQA 3M4AA 1GE9A 4LMOA 1NH3A 3GTGA 1EH1A 1TL8A 1SMYD 4KB4A 2R93A 2A6HD 3H0GA 5JSBB 2CW0D 1DD5A 2Y0SA 4IP8A 1I50A 4Q5VA 1A35A 4NOLA 3K5NA 4KC6A 3LF9A 1TWHA 4L8IA 1WQFA 5CQGA 1R9TA 3K5MA 1A31A 2A6ED 3K59A 1IW7D 3GTPA 1RRJA 1SFOA 1Y1WA 4QCLA 2JA6A 1R5ZA 1YNJD 2A68D 4KB2A 4FGUA 2E2HA 5JSNB 1WQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYD B;  5MLC 9;  4KDD A;  1EK8 A;  4KC6 A;  3LF9 A;  1ISE A;  4KAW X;  4L8I A;  1WQF A;  4JLR C;  4GFQ A;  1GE9 A;  3LHP S;  4KB2 A;  1EH1 A;  1WQH A;  4KB4 A;  1Y69 8;  5JSB B;  5JSN B;  1WQG A;  1DD5 A;  1IS1 A; 
#chains in the Genus database with same CATH topology
 4C2M A;  3GTO A;  4H3T A;  1HQM D;  1T8I A;  3WVO A;  2A69 D;  4D3Y A;  3K5L A;  1Q8I A;  4O26 A;  1EJ9 A;  1I3Q A;  1R49 A;  3GTL A;  2NVX A;  3DU6 A;  2YU9 A;  3CQZ A;  3GTQ A;  3MAQ A;  3P9A A;  3LHP S;  2B9S B;  1RR8 C;  2O5J D;  1MIU A;  2F4Q A;  1TGO A;  1LPQ A;  4FXD A;  1WQH A;  3DU5 A;  2VUM A;  5C9H A;  1Y69 8;  2R4G A;  2B63 A;  4FYD A;  3FKI A;  1WCM A;  4QIW A;  1K4S A;  1K83 A;  4OYD B;  1I6V D;  1V9M A;  1ZYR D;  5MLC 9;  2JA5 A;  3GTK A;  1TWA A;  2R92 A;  3GTJ A;  3K57 A;  1ISE A;  2PMZ A;  4NOK A;  3KYL A;  4NOM A;  4IP9 A;  1SC7 A;  4JLR C;  1TWF A;  3SJR A;  4D3Z A;  4F3E A;  2WB1 A;  3IAY A;  1TWG A;  4AHC A;  2R7Z A;  4AN8 A;  1TWC A;  2BE5 D;  1Y1V A;  3K58 A;  1IS1 A;  4AYB A;  3HKZ A;  4KDD A;  1EK8 A;  4Q5G A;  3K5O A;  2E2I A;  1YNN D;  1SEU A;  1K4T A;  4KAW X;  2JA7 A;  1A36 A;  3GTM A;  2WAQ A;  4EJ3 A;  2NVY A;  4GFQ A;  3M4A A;  1GE9 A;  4LMO A;  1NH3 A;  3GTG A;  1EH1 A;  1TL8 A;  1SMY D;  4KB4 A;  2R93 A;  2A6H D;  3H0G A;  5JSB B;  2CW0 D;  1DD5 A;  2Y0S A;  4IP8 A;  1I50 A;  4Q5V A;  1A35 A;  4NOL A;  3K5N A;  4KC6 A;  3LF9 A;  1TWH A;  4L8I A;  1WQF A;  5CQG A;  1R9T A;  3K5M A;  1A31 A;  2A6E D;  3K59 A;  1IW7 D;  3GTP A;  1RRJ A;  1SFO A;  1Y1W A;  4QCL A;  2JA6 A;  1R5Z A;  1YNJ D;  2A68 D;  4KB2 A;  4FGU A;  2E2H A;  5JSN B;  1WQG A; 
#chains in the Genus database with same CATH homology
 4C2M A;  3GTO A;  4H3T A;  1HQM D;  1T8I A;  3WVO A;  2A69 D;  4D3Y A;  3K5L A;  1Q8I A;  4O26 A;  1EJ9 A;  1I3Q A;  1R49 A;  3GTL A;  2NVX A;  3DU6 A;  2YU9 A;  3CQZ A;  3GTQ A;  3MAQ A;  3P9A A;  3LHP S;  2B9S B;  1RR8 C;  2O5J D;  1MIU A;  2F4Q A;  1TGO A;  1LPQ A;  4FXD A;  1WQH A;  3DU5 A;  2VUM A;  5C9H A;  1Y69 8;  2R4G A;  2B63 A;  4FYD A;  3FKI A;  1WCM A;  4QIW A;  1K4S A;  1K83 A;  4OYD B;  1I6V D;  1V9M A;  1ZYR D;  5MLC 9;  2JA5 A;  3GTK A;  1TWA A;  2R92 A;  3GTJ A;  3K57 A;  1ISE A;  2PMZ A;  4NOK A;  3KYL A;  4NOM A;  4IP9 A;  1SC7 A;  4JLR C;  1TWF A;  3SJR A;  4D3Z A;  4F3E A;  2WB1 A;  3IAY A;  1TWG A;  4AHC A;  2R7Z A;  4AN8 A;  1TWC A;  2BE5 D;  1Y1V A;  3K58 A;  1IS1 A;  4AYB A;  3HKZ A;  4KDD A;  1EK8 A;  4Q5G A;  3K5O A;  2E2I A;  1YNN D;  1SEU A;  1K4T A;  4KAW X;  2JA7 A;  1A36 A;  3GTM A;  2WAQ A;  4EJ3 A;  2NVY A;  4GFQ A;  3M4A A;  1GE9 A;  4LMO A;  1NH3 A;  3GTG A;  1EH1 A;  1TL8 A;  1SMY D;  4KB4 A;  2R93 A;  2A6H D;  3H0G A;  5JSB B;  2CW0 D;  1DD5 A;  2Y0S A;  4IP8 A;  1I50 A;  4Q5V A;  1A35 A;  4NOL A;  3K5N A;  4KC6 A;  3LF9 A;  1TWH A;  4L8I A;  1WQF A;  5CQG A;  1R9T A;  3K5M A;  1A31 A;  2A6E D;  3K59 A;  1IW7 D;  3GTP A;  1RRJ A;  1SFO A;  1Y1W A;  4QCL A;  2JA6 A;  1R5Z A;  1YNJ D;  2A68 D;  4KB2 A;  4FGU A;  2E2H A;  5JSN B;  1WQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...