5MLC9

Cryo-em structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
183
structure length
107
Chain Sequence
SLIETNTKQRMEKTIETIRSNFNSVRLTSDRRKELAKVVSKLAEEGKVAVRNIRRDALKSYEKLEKEKKLSEDNVKDLSADLQKLTDEYMKKVESIYKQKEQELMKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA, chloroplastic
total genus 34
structure length 107
sequence length 183
ec nomenclature
pdb deposition date 2016-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
9 PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 5mlc900
4KB4A 4KAWX 4L8IA 4KB2A 1IS1A 1ISEA 4OYDB 5MLC9 1DD5A 4GFQA 1GE9A 4JLRC 3LHPS 1WQGA 1WQHA 1EH1A 5JSBB 4KC6A 1WQFA 3LF9A 4KDDA 5JSNB 1EK8A 1Y698
chains in the Genus database with same CATH superfamily
1MIUA 4FXDA 4Q5VA 1SFOA 1A36A 2JA5A 1SC7A 1YNND 3GTOA 1NH3A 4AHCA 3GTMA 1IS1A 1ISEA 3DU6A 4IP9A 5CQGA 4NOMA 3KYLA 1DD5A 3GTQA 4JLRC 3LHPS 2E2IA 4FYDA 3GTJA 2R4GA 1I50A 1Q8IA 4KDDA 3K58A 1SMYD 1T8IA 2O5JD 3MAQA 4NOKA 4KB4A 2A69D 3GTLA 4KAWX 4H3TA 1V9MA 4L8IA 1ZYRD 3M4AA 1IW7D 5C9HA 3K57A 4AN8A 1R9TA 1I6VD 3H0GA 2YU9A 1A31A 1TWGA 5MLC9 1GE9A 2JA6A 1TWHA 4LMOA 1I3QA 2CW0D 3SJRA 2NVYA 3K5OA 1LPQA 4KC6A 3LF9A 4F3EA 1TGOA 2JA7A 1Y698 2F4QA 4AYBA 3IAYA 3K5NA 2R92A 4D3YA 1A35A 1WCMA 1TWAA 2WB1A 3K5LA 2B9SB 1R5ZA 4EJ3A 1EJ9A 4GFQA 1YNJD 2E2HA 3GTPA 1HQMD 2Y0SA 4C2MA 2WAQA 1WQGA 4QIWA 1WQHA 2A68D 5JSBB 3K59A 3DU5A 1EK8A 2BE5D 4O26A 1Y1VA 1K4SA 1RRJA 2A6HD 1Y1WA 3K5MA 4FGUA 3GTGA 4KB2A 1SEUA 2NVXA 2VUMA 4D3ZA 1TWCA 4OYDB 3P9AA 2R7ZA 1TWFA 1K83A 4QCLA 1RR8C 2R93A 4Q5GA 2PMZA 4IP8A 3HKZA 3GTKA 2A6ED 1R49A 1EH1A 3CQZA 1K4TA 1WQFA 2B63A 1TL8A 5JSNB 3WVOA 4NOLA 3FKIA
chains in the Genus database with same CATH topology
1MIUA 4FXDA 4Q5VA 1SFOA 1A36A 2JA5A 1SC7A 1YNND 3GTOA 1NH3A 4AHCA 3GTMA 1IS1A 1ISEA 3DU6A 4IP9A 5CQGA 4NOMA 3KYLA 1DD5A 3GTQA 4JLRC 3LHPS 2E2IA 4FYDA 3GTJA 2R4GA 1I50A 1Q8IA 4KDDA 3K58A 1SMYD 1T8IA 2O5JD 3MAQA 4NOKA 4KB4A 2A69D 3GTLA 4KAWX 4H3TA 1V9MA 4L8IA 1ZYRD 3M4AA 1IW7D 5C9HA 3K57A 4AN8A 1R9TA 1I6VD 3H0GA 2YU9A 1A31A 1TWGA 5MLC9 1GE9A 2JA6A 1TWHA 4LMOA 1I3QA 2CW0D 3SJRA 2NVYA 3K5OA 1LPQA 4KC6A 3LF9A 4F3EA 1TGOA 2JA7A 1Y698 2F4QA 4AYBA 3IAYA 3K5NA 2R92A 4D3YA 1A35A 1WCMA 1TWAA 2WB1A 3K5LA 2B9SB 1R5ZA 4EJ3A 1EJ9A 4GFQA 1YNJD 2E2HA 3GTPA 1HQMD 2Y0SA 4C2MA 2WAQA 1WQGA 4QIWA 1WQHA 2A68D 5JSBB 3K59A 3DU5A 1EK8A 2BE5D 4O26A 1Y1VA 1K4SA 1RRJA 2A6HD 1Y1WA 3K5MA 4FGUA 3GTGA 4KB2A 1SEUA 2NVXA 2VUMA 4D3ZA 1TWCA 4OYDB 3P9AA 2R7ZA 1TWFA 1K83A 4QCLA 1RR8C 2R93A 4Q5GA 2PMZA 4IP8A 3HKZA 3GTKA 2A6ED 1R49A 1EH1A 3CQZA 1K4TA 1WQFA 2B63A 1TL8A 5JSNB 3WVOA 4NOLA 3FKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KB4 A;  4KAW X;  4L8I A;  4KB2 A;  1IS1 A;  1ISE A;  4OYD B;  5MLC 9;  1DD5 A;  4GFQ A;  1GE9 A;  4JLR C;  3LHP S;  1WQG A;  1WQH A;  1EH1 A;  5JSB B;  4KC6 A;  1WQF A;  3LF9 A;  4KDD A;  5JSN B;  1EK8 A;  1Y69 8; 
#chains in the Genus database with same CATH topology
 1MIU A;  4FXD A;  4Q5V A;  1SFO A;  1A36 A;  2JA5 A;  1SC7 A;  1YNN D;  3GTO A;  1NH3 A;  4AHC A;  3GTM A;  1IS1 A;  1ISE A;  3DU6 A;  4IP9 A;  5CQG A;  4NOM A;  3KYL A;  1DD5 A;  3GTQ A;  4JLR C;  3LHP S;  2E2I A;  4FYD A;  3GTJ A;  2R4G A;  1I50 A;  1Q8I A;  4KDD A;  3K58 A;  1SMY D;  1T8I A;  2O5J D;  3MAQ A;  4NOK A;  4KB4 A;  2A69 D;  3GTL A;  4KAW X;  4H3T A;  1V9M A;  4L8I A;  1ZYR D;  3M4A A;  1IW7 D;  5C9H A;  3K57 A;  4AN8 A;  1R9T A;  1I6V D;  3H0G A;  2YU9 A;  1A31 A;  1TWG A;  5MLC 9;  1GE9 A;  2JA6 A;  1TWH A;  4LMO A;  1I3Q A;  2CW0 D;  3SJR A;  2NVY A;  3K5O A;  1LPQ A;  4KC6 A;  3LF9 A;  4F3E A;  1TGO A;  2JA7 A;  1Y69 8;  2F4Q A;  4AYB A;  3IAY A;  3K5N A;  2R92 A;  4D3Y A;  1A35 A;  1WCM A;  1TWA A;  2WB1 A;  3K5L A;  2B9S B;  1R5Z A;  4EJ3 A;  1EJ9 A;  4GFQ A;  1YNJ D;  2E2H A;  3GTP A;  1HQM D;  2Y0S A;  4C2M A;  2WAQ A;  1WQG A;  4QIW A;  1WQH A;  2A68 D;  5JSB B;  3K59 A;  3DU5 A;  1EK8 A;  2BE5 D;  4O26 A;  1Y1V A;  1K4S A;  1RRJ A;  2A6H D;  1Y1W A;  3K5M A;  4FGU A;  3GTG A;  4KB2 A;  1SEU A;  2NVX A;  2VUM A;  4D3Z A;  1TWC A;  4OYD B;  3P9A A;  2R7Z A;  1TWF A;  1K83 A;  4QCL A;  1RR8 C;  2R93 A;  4Q5G A;  2PMZ A;  4IP8 A;  3HKZ A;  3GTK A;  2A6E D;  1R49 A;  1EH1 A;  3CQZ A;  1K4T A;  1WQF A;  2B63 A;  1TL8 A;  5JSN B;  3WVO A;  4NOL A;  3FKI A; 
#chains in the Genus database with same CATH homology
 1MIU A;  4FXD A;  4Q5V A;  1SFO A;  1A36 A;  2JA5 A;  1SC7 A;  1YNN D;  3GTO A;  1NH3 A;  4AHC A;  3GTM A;  1IS1 A;  1ISE A;  3DU6 A;  4IP9 A;  5CQG A;  4NOM A;  3KYL A;  1DD5 A;  3GTQ A;  4JLR C;  3LHP S;  2E2I A;  4FYD A;  3GTJ A;  2R4G A;  1I50 A;  1Q8I A;  4KDD A;  3K58 A;  1SMY D;  1T8I A;  2O5J D;  3MAQ A;  4NOK A;  4KB4 A;  2A69 D;  3GTL A;  4KAW X;  4H3T A;  1V9M A;  4L8I A;  1ZYR D;  3M4A A;  1IW7 D;  5C9H A;  3K57 A;  4AN8 A;  1R9T A;  1I6V D;  3H0G A;  2YU9 A;  1A31 A;  1TWG A;  5MLC 9;  1GE9 A;  2JA6 A;  1TWH A;  4LMO A;  1I3Q A;  2CW0 D;  3SJR A;  2NVY A;  3K5O A;  1LPQ A;  4KC6 A;  3LF9 A;  4F3E A;  1TGO A;  2JA7 A;  1Y69 8;  2F4Q A;  4AYB A;  3IAY A;  3K5N A;  2R92 A;  4D3Y A;  1A35 A;  1WCM A;  1TWA A;  2WB1 A;  3K5L A;  2B9S B;  1R5Z A;  4EJ3 A;  1EJ9 A;  4GFQ A;  1YNJ D;  2E2H A;  3GTP A;  1HQM D;  2Y0S A;  4C2M A;  2WAQ A;  1WQG A;  4QIW A;  1WQH A;  2A68 D;  5JSB B;  3K59 A;  3DU5 A;  1EK8 A;  2BE5 D;  4O26 A;  1Y1V A;  1K4S A;  1RRJ A;  2A6H D;  1Y1W A;  3K5M A;  4FGU A;  3GTG A;  4KB2 A;  1SEU A;  2NVX A;  2VUM A;  4D3Z A;  1TWC A;  4OYD B;  3P9A A;  2R7Z A;  1TWF A;  1K83 A;  4QCL A;  1RR8 C;  2R93 A;  4Q5G A;  2PMZ A;  4IP8 A;  3HKZ A;  3GTK A;  2A6E D;  1R49 A;  1EH1 A;  3CQZ A;  1K4T A;  1WQF A;  2B63 A;  1TL8 A;  5JSN B;  3WVO A;  4NOL A;  3FKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...