5MLC9

Cryo-em structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
183
structure length
107
Chain Sequence
SLIETNTKQRMEKTIETIRSNFNSVRLTSDRRKELAKVVSKLAEEGKVAVRNIRRDALKSYEKLEKEKKLSEDNVKDLSADLQKLTDEYMKKVESIYKQKEQELMKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA, chloroplastic
publication title Cryo-EM structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions.
pubmed doi rcsb
total genus 34
structure length 107
sequence length 183
ec nomenclature
pdb deposition date 2016-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
9 PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 5mlc900
4KAWX 4JLRC 5JSNB 1WQHA 4KC6A 1DD5A 4OYDB 5MLC9 4L8IA 1WQFA 1GE9A 1WQGA 5JSBB 4KB4A 3LHPS 1Y698 4GFQA 4KDDA 3LF9A 1EK8A 1EH1A 1IS1A 1ISEA 4KB2A
chains in the Genus database with same CATH superfamily
5CQGA 4JLRC 1LPQA 2R4GA 3HKZA 5JSNB 3K59A 1DD5A 3SJRA 2WB1A 3H0GA 4OYDB 4L8IA 2YU9A 4AHCA 1WQFA 3KYLA 1SFOA 1WQGA 3GTMA 3LHPS 1Y698 4AYBA 1R49A 1NH3A 4Q5GA 2NVXA 1R5ZA 1TWFA 3DU5A 1IS1A 3GTKA 2R92A 3WVOA 2WAQA 4KAWX 2JA6A 4H3TA 1I3QA 3K5NA 4KC6A 4AN8A 5MLC9 2B9SB 1SEUA 2A69D 3K5MA 2A6ED 2R7ZA 4EJ3A 3CQZA 5C9HA 4NOKA 3GTGA 1K4SA 5JSBB 4KB4A 4GFQA 3FKIA 3GTJA 1EK8A 1Q8IA 1TWGA 2NVYA 1A35A 2CW0D 3P9AA 4NOMA 4QCLA 2PMZA 4C2MA 4O26A 1TWHA 1WQHA 1I50A 1V9MA 1HQMD 4D3YA 4LMOA 4FYDA 1Y1WA 3MAQA 1GE9A 1TWCA 1TL8A 2VUMA 1YNND 1TWAA 1WCMA 4KDDA 2R93A 4IP8A 1EH1A 1IW7D 1K4TA 1EJ9A 1TGOA 1ISEA 1K83A 2F4QA 3GTLA 1Y1VA 4KB2A 3GTQA 2A68D 3IAYA 2BE5D 3K5OA 1MIUA 4D3ZA 1SMYD 3K57A 1RR8C 1R9TA 3DU6A 1I6VD 2O5JD 4IP9A 2E2IA 3K58A 1T8IA 3K5LA 3GTOA 1YNJD 4Q5VA 1RRJA 1ZYRD 2A6HD 3GTPA 4QIWA 2B63A 3LF9A 2Y0SA 2JA5A 4FXDA 4NOLA 4FGUA 4F3EA 1SC7A 1A36A 2JA7A 1A31A 3M4AA 2E2HA
chains in the Genus database with same CATH topology
5CQGA 4JLRC 1LPQA 2R4GA 3HKZA 5JSNB 3K59A 1DD5A 3SJRA 2WB1A 3H0GA 4OYDB 4L8IA 2YU9A 4AHCA 1WQFA 3KYLA 1SFOA 1WQGA 3GTMA 3LHPS 1Y698 4AYBA 1R49A 1NH3A 4Q5GA 2NVXA 1R5ZA 1TWFA 3DU5A 1IS1A 3GTKA 2R92A 3WVOA 2WAQA 4KAWX 2JA6A 4H3TA 1I3QA 3K5NA 4KC6A 4AN8A 5MLC9 2B9SB 1SEUA 2A69D 3K5MA 2A6ED 2R7ZA 4EJ3A 3CQZA 5C9HA 4NOKA 3GTGA 1K4SA 5JSBB 4KB4A 4GFQA 3FKIA 3GTJA 1EK8A 1Q8IA 1TWGA 2NVYA 1A35A 2CW0D 3P9AA 4NOMA 4QCLA 2PMZA 4C2MA 4O26A 1TWHA 1WQHA 1I50A 1V9MA 1HQMD 4D3YA 4LMOA 4FYDA 1Y1WA 3MAQA 1GE9A 1TWCA 1TL8A 2VUMA 1YNND 1TWAA 1WCMA 4KDDA 2R93A 4IP8A 1EH1A 1IW7D 1K4TA 1EJ9A 1TGOA 1ISEA 1K83A 2F4QA 3GTLA 1Y1VA 4KB2A 3GTQA 2A68D 3IAYA 2BE5D 3K5OA 1MIUA 4D3ZA 1SMYD 3K57A 1RR8C 1R9TA 3DU6A 1I6VD 2O5JD 4IP9A 2E2IA 3K58A 1T8IA 3K5LA 3GTOA 1YNJD 4Q5VA 1RRJA 1ZYRD 2A6HD 3GTPA 4QIWA 2B63A 3LF9A 2Y0SA 2JA5A 4FXDA 4NOLA 4FGUA 4F3EA 1SC7A 1A36A 2JA7A 1A31A 3M4AA 2E2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAW X;  4JLR C;  5JSN B;  1WQH A;  4KC6 A;  1DD5 A;  4OYD B;  5MLC 9;  4L8I A;  1WQF A;  1GE9 A;  1WQG A;  5JSB B;  4KB4 A;  3LHP S;  1Y69 8;  4GFQ A;  4KDD A;  3LF9 A;  1EK8 A;  1EH1 A;  1IS1 A;  1ISE A;  4KB2 A; 
#chains in the Genus database with same CATH topology
 5CQG A;  4JLR C;  1LPQ A;  2R4G A;  3HKZ A;  5JSN B;  3K59 A;  1DD5 A;  3SJR A;  2WB1 A;  3H0G A;  4OYD B;  4L8I A;  2YU9 A;  4AHC A;  1WQF A;  3KYL A;  1SFO A;  1WQG A;  3GTM A;  3LHP S;  1Y69 8;  4AYB A;  1R49 A;  1NH3 A;  4Q5G A;  2NVX A;  1R5Z A;  1TWF A;  3DU5 A;  1IS1 A;  3GTK A;  2R92 A;  3WVO A;  2WAQ A;  4KAW X;  2JA6 A;  4H3T A;  1I3Q A;  3K5N A;  4KC6 A;  4AN8 A;  5MLC 9;  2B9S B;  1SEU A;  2A69 D;  3K5M A;  2A6E D;  2R7Z A;  4EJ3 A;  3CQZ A;  5C9H A;  4NOK A;  3GTG A;  1K4S A;  5JSB B;  4KB4 A;  4GFQ A;  3FKI A;  3GTJ A;  1EK8 A;  1Q8I A;  1TWG A;  2NVY A;  1A35 A;  2CW0 D;  3P9A A;  4NOM A;  4QCL A;  2PMZ A;  4C2M A;  4O26 A;  1TWH A;  1WQH A;  1I50 A;  1V9M A;  1HQM D;  4D3Y A;  4LMO A;  4FYD A;  1Y1W A;  3MAQ A;  1GE9 A;  1TWC A;  1TL8 A;  2VUM A;  1YNN D;  1TWA A;  1WCM A;  4KDD A;  2R93 A;  4IP8 A;  1EH1 A;  1IW7 D;  1K4T A;  1EJ9 A;  1TGO A;  1ISE A;  1K83 A;  2F4Q A;  3GTL A;  1Y1V A;  4KB2 A;  3GTQ A;  2A68 D;  3IAY A;  2BE5 D;  3K5O A;  1MIU A;  4D3Z A;  1SMY D;  3K57 A;  1RR8 C;  1R9T A;  3DU6 A;  1I6V D;  2O5J D;  4IP9 A;  2E2I A;  3K58 A;  1T8I A;  3K5L A;  3GTO A;  1YNJ D;  4Q5V A;  1RRJ A;  1ZYR D;  2A6H D;  3GTP A;  4QIW A;  2B63 A;  3LF9 A;  2Y0S A;  2JA5 A;  4FXD A;  4NOL A;  4FGU A;  4F3E A;  1SC7 A;  1A36 A;  2JA7 A;  1A31 A;  3M4A A;  2E2H A; 
#chains in the Genus database with same CATH homology
 5CQG A;  4JLR C;  1LPQ A;  2R4G A;  3HKZ A;  5JSN B;  3K59 A;  1DD5 A;  3SJR A;  2WB1 A;  3H0G A;  4OYD B;  4L8I A;  2YU9 A;  4AHC A;  1WQF A;  3KYL A;  1SFO A;  1WQG A;  3GTM A;  3LHP S;  1Y69 8;  4AYB A;  1R49 A;  1NH3 A;  4Q5G A;  2NVX A;  1R5Z A;  1TWF A;  3DU5 A;  1IS1 A;  3GTK A;  2R92 A;  3WVO A;  2WAQ A;  4KAW X;  2JA6 A;  4H3T A;  1I3Q A;  3K5N A;  4KC6 A;  4AN8 A;  5MLC 9;  2B9S B;  1SEU A;  2A69 D;  3K5M A;  2A6E D;  2R7Z A;  4EJ3 A;  3CQZ A;  5C9H A;  4NOK A;  3GTG A;  1K4S A;  5JSB B;  4KB4 A;  4GFQ A;  3FKI A;  3GTJ A;  1EK8 A;  1Q8I A;  1TWG A;  2NVY A;  1A35 A;  2CW0 D;  3P9A A;  4NOM A;  4QCL A;  2PMZ A;  4C2M A;  4O26 A;  1TWH A;  1WQH A;  1I50 A;  1V9M A;  1HQM D;  4D3Y A;  4LMO A;  4FYD A;  1Y1W A;  3MAQ A;  1GE9 A;  1TWC A;  1TL8 A;  2VUM A;  1YNN D;  1TWA A;  1WCM A;  4KDD A;  2R93 A;  4IP8 A;  1EH1 A;  1IW7 D;  1K4T A;  1EJ9 A;  1TGO A;  1ISE A;  1K83 A;  2F4Q A;  3GTL A;  1Y1V A;  4KB2 A;  3GTQ A;  2A68 D;  3IAY A;  2BE5 D;  3K5O A;  1MIU A;  4D3Z A;  1SMY D;  3K57 A;  1RR8 C;  1R9T A;  3DU6 A;  1I6V D;  2O5J D;  4IP9 A;  2E2I A;  3K58 A;  1T8I A;  3K5L A;  3GTO A;  1YNJ D;  4Q5V A;  1RRJ A;  1ZYR D;  2A6H D;  3GTP A;  4QIW A;  2B63 A;  3LF9 A;  2Y0S A;  2JA5 A;  4FXD A;  4NOL A;  4FGU A;  4F3E A;  1SC7 A;  1A36 A;  2JA7 A;  1A31 A;  3M4A A;  2E2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...