5JSNB

Bcl2-inhibitor complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
115
structure length
115
Chain Sequence
DPKKVLDKAKDEAENRVRELKQRLEELYKEARKLDLTQEMRQELVDKARAASLQANGDIFYAILRALAEAEKLKKAGLVNSQQLDELKRRLEELAEEARRKAEKLRDEFRLKLEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis regulator Bcl-2
publication title Computationally designed high specificity inhibitors delineate the roles of BCL2 family proteins in cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/inhibitor
total genus 54
structure length 115
sequence length 115
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 5jsnB00
1IS1A 1ISEA 1EH1A 4KAWX 4KB2A 3LF9A 1Y698 1DD5A 4GFQA 4OYDB 4JLRC 3LHPS 1EK8A 5JSNB 4KC6A 1WQGA 1GE9A 4L8IA 5JSBB 1WQFA 5MLC9 1WQHA 4KB4A 4KDDA
chains in the Genus database with same CATH superfamily
1IS1A 1ISEA 1K83A 4D3ZA 3LF9A 2Y0SA 1YNND 2F4QA 2PMZA 1K4TA 1DD5A 5C9HA 2WAQA 3SJRA 4FYDA 1TWGA 3LHPS 1EK8A 3GTQA 4KC6A 1RR8C 1Y1WA 1MIUA 3K59A 2BE5D 1T8IA 3K5LA 1GE9A 1TWFA 1R49A 1I3QA 1TWHA 4AN8A 1YNJD 1TWAA 1IW7D 2R7ZA 1NH3A 4H3TA 2NVYA 3K5MA 1LPQA 4KAWX 1TGOA 4IP9A 2B63A 2E2IA 1SMYD 4Q5GA 4GFQA 2A6ED 2A69D 1TL8A 4QCLA 4AHCA 4FGUA 1Y1VA 4IP8A 3GTKA 4O26A 3K5NA 4LMOA 1Q8IA 3GTLA 2B9SB 1R9TA 1WQGA 1SEUA 5JSBB 1A31A 2JA5A 1I50A 3DU5A 5CQGA 3P9AA 1WQHA 2JA6A 2NVXA 3K5OA 2YU9A 1RRJA 4D3YA 2WB1A 3FKIA 4AYBA 2A6HD 2CW0D 2O5JD 4OYDB 2R92A 4JLRC 2JA7A 1TWCA 3KYLA 3IAYA 4NOMA 3GTPA 3GTOA 3GTMA 3CQZA 4F3EA 2VUMA 3MAQA 4L8IA 4C2MA 2R4GA 1HQMD 3M4AA 1WCMA 1ZYRD 4KDDA 3DU6A 1SC7A 4NOKA 1EH1A 1I6VD 4KB2A 2R93A 1A35A 1Y698 3K57A 3WVOA 3GTJA 4EJ3A 1A36A 3GTGA 2A68D 5JSNB 1EJ9A 2E2HA 4QIWA 3HKZA 1SFOA 1K4SA 4FXDA 3K58A 3H0GA 1WQFA 5MLC9 4NOLA 4KB4A 4Q5VA 1R5ZA 1V9MA
chains in the Genus database with same CATH topology
1IS1A 1ISEA 1K83A 4D3ZA 3LF9A 2Y0SA 1YNND 2F4QA 2PMZA 1K4TA 1DD5A 5C9HA 2WAQA 3SJRA 4FYDA 1TWGA 3LHPS 1EK8A 3GTQA 4KC6A 1RR8C 1Y1WA 1MIUA 3K59A 2BE5D 1T8IA 3K5LA 1GE9A 1TWFA 1R49A 1I3QA 1TWHA 4AN8A 1YNJD 1TWAA 1IW7D 2R7ZA 1NH3A 4H3TA 2NVYA 3K5MA 1LPQA 4KAWX 1TGOA 4IP9A 2B63A 2E2IA 1SMYD 4Q5GA 4GFQA 2A6ED 2A69D 1TL8A 4QCLA 4AHCA 4FGUA 1Y1VA 4IP8A 3GTKA 4O26A 3K5NA 4LMOA 1Q8IA 3GTLA 2B9SB 1R9TA 1WQGA 1SEUA 5JSBB 1A31A 2JA5A 1I50A 3DU5A 5CQGA 3P9AA 1WQHA 2JA6A 2NVXA 3K5OA 2YU9A 1RRJA 4D3YA 2WB1A 3FKIA 4AYBA 2A6HD 2CW0D 2O5JD 4OYDB 2R92A 4JLRC 2JA7A 1TWCA 3KYLA 3IAYA 4NOMA 3GTPA 3GTOA 3GTMA 3CQZA 4F3EA 2VUMA 3MAQA 4L8IA 4C2MA 2R4GA 1HQMD 3M4AA 1WCMA 1ZYRD 4KDDA 3DU6A 1SC7A 4NOKA 1EH1A 1I6VD 4KB2A 2R93A 1A35A 1Y698 3K57A 3WVOA 3GTJA 4EJ3A 1A36A 3GTGA 2A68D 5JSNB 1EJ9A 2E2HA 4QIWA 3HKZA 1SFOA 1K4SA 4FXDA 3K58A 3H0GA 1WQFA 5MLC9 4NOLA 4KB4A 4Q5VA 1R5ZA 1V9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IS1 A;  1ISE A;  1EH1 A;  4KAW X;  4KB2 A;  3LF9 A;  1Y69 8;  1DD5 A;  4GFQ A;  4OYD B;  4JLR C;  3LHP S;  1EK8 A;  5JSN B;  4KC6 A;  1WQG A;  1GE9 A;  4L8I A;  5JSB B;  1WQF A;  5MLC 9;  1WQH A;  4KB4 A;  4KDD A; 
#chains in the Genus database with same CATH topology
 1IS1 A;  1ISE A;  1K83 A;  4D3Z A;  3LF9 A;  2Y0S A;  1YNN D;  2F4Q A;  2PMZ A;  1K4T A;  1DD5 A;  5C9H A;  2WAQ A;  3SJR A;  4FYD A;  1TWG A;  3LHP S;  1EK8 A;  3GTQ A;  4KC6 A;  1RR8 C;  1Y1W A;  1MIU A;  3K59 A;  2BE5 D;  1T8I A;  3K5L A;  1GE9 A;  1TWF A;  1R49 A;  1I3Q A;  1TWH A;  4AN8 A;  1YNJ D;  1TWA A;  1IW7 D;  2R7Z A;  1NH3 A;  4H3T A;  2NVY A;  3K5M A;  1LPQ A;  4KAW X;  1TGO A;  4IP9 A;  2B63 A;  2E2I A;  1SMY D;  4Q5G A;  4GFQ A;  2A6E D;  2A69 D;  1TL8 A;  4QCL A;  4AHC A;  4FGU A;  1Y1V A;  4IP8 A;  3GTK A;  4O26 A;  3K5N A;  4LMO A;  1Q8I A;  3GTL A;  2B9S B;  1R9T A;  1WQG A;  1SEU A;  5JSB B;  1A31 A;  2JA5 A;  1I50 A;  3DU5 A;  5CQG A;  3P9A A;  1WQH A;  2JA6 A;  2NVX A;  3K5O A;  2YU9 A;  1RRJ A;  4D3Y A;  2WB1 A;  3FKI A;  4AYB A;  2A6H D;  2CW0 D;  2O5J D;  4OYD B;  2R92 A;  4JLR C;  2JA7 A;  1TWC A;  3KYL A;  3IAY A;  4NOM A;  3GTP A;  3GTO A;  3GTM A;  3CQZ A;  4F3E A;  2VUM A;  3MAQ A;  4L8I A;  4C2M A;  2R4G A;  1HQM D;  3M4A A;  1WCM A;  1ZYR D;  4KDD A;  3DU6 A;  1SC7 A;  4NOK A;  1EH1 A;  1I6V D;  4KB2 A;  2R93 A;  1A35 A;  1Y69 8;  3K57 A;  3WVO A;  3GTJ A;  4EJ3 A;  1A36 A;  3GTG A;  2A68 D;  5JSN B;  1EJ9 A;  2E2H A;  4QIW A;  3HKZ A;  1SFO A;  1K4S A;  4FXD A;  3K58 A;  3H0G A;  1WQF A;  5MLC 9;  4NOL A;  4KB4 A;  4Q5V A;  1R5Z A;  1V9M A; 
#chains in the Genus database with same CATH homology
 1IS1 A;  1ISE A;  1K83 A;  4D3Z A;  3LF9 A;  2Y0S A;  1YNN D;  2F4Q A;  2PMZ A;  1K4T A;  1DD5 A;  5C9H A;  2WAQ A;  3SJR A;  4FYD A;  1TWG A;  3LHP S;  1EK8 A;  3GTQ A;  4KC6 A;  1RR8 C;  1Y1W A;  1MIU A;  3K59 A;  2BE5 D;  1T8I A;  3K5L A;  1GE9 A;  1TWF A;  1R49 A;  1I3Q A;  1TWH A;  4AN8 A;  1YNJ D;  1TWA A;  1IW7 D;  2R7Z A;  1NH3 A;  4H3T A;  2NVY A;  3K5M A;  1LPQ A;  4KAW X;  1TGO A;  4IP9 A;  2B63 A;  2E2I A;  1SMY D;  4Q5G A;  4GFQ A;  2A6E D;  2A69 D;  1TL8 A;  4QCL A;  4AHC A;  4FGU A;  1Y1V A;  4IP8 A;  3GTK A;  4O26 A;  3K5N A;  4LMO A;  1Q8I A;  3GTL A;  2B9S B;  1R9T A;  1WQG A;  1SEU A;  5JSB B;  1A31 A;  2JA5 A;  1I50 A;  3DU5 A;  5CQG A;  3P9A A;  1WQH A;  2JA6 A;  2NVX A;  3K5O A;  2YU9 A;  1RRJ A;  4D3Y A;  2WB1 A;  3FKI A;  4AYB A;  2A6H D;  2CW0 D;  2O5J D;  4OYD B;  2R92 A;  4JLR C;  2JA7 A;  1TWC A;  3KYL A;  3IAY A;  4NOM A;  3GTP A;  3GTO A;  3GTM A;  3CQZ A;  4F3E A;  2VUM A;  3MAQ A;  4L8I A;  4C2M A;  2R4G A;  1HQM D;  3M4A A;  1WCM A;  1ZYR D;  4KDD A;  3DU6 A;  1SC7 A;  4NOK A;  1EH1 A;  1I6V D;  4KB2 A;  2R93 A;  1A35 A;  1Y69 8;  3K57 A;  3WVO A;  3GTJ A;  4EJ3 A;  1A36 A;  3GTG A;  2A68 D;  5JSN B;  1EJ9 A;  2E2H A;  4QIW A;  3HKZ A;  1SFO A;  1K4S A;  4FXD A;  3K58 A;  3H0G A;  1WQF A;  5MLC 9;  4NOL A;  4KB4 A;  4Q5V A;  1R5Z A;  1V9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...