1I6VD

Thermus aquaticus core rna polymerase-rifampicin complex
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
1234
structure length
1174
Chain Sequence
KEVRKVRIALASPEKIRSWSYGEVEKPETEAKVCERCAVEVTRSIVRRYRMAHIELATPAAHIWFVKDVPSKIATLLDLSATELEQVLYFNKYIVLDPKAAVLDAVPVEKRQLLTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDARMGAEAIQELLKELDLEKLERELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNPGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIVVAGRETSVGRLKFVFANPDEALLAVAHGLLDLQDTVTTRYLGRRLETSPGRILFARIVGEAVGDEKVAQELIQMDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTLSTTSGITIGIDDAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKVTQAVFNNFEENYPFNPLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTNYISVPLFQMDEVTRTLRLRKRSDIESGLYGRVLAREVEALGRRLEEGRYLSLEDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGVVAAESIGEPGTQLTMRTGTDITQGLPRVIELFEARRPKAKAVISEIDGVVRIEEGEDRLSVFVESEGFSKEYKLPKDARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVDEIQKVYRAQGVKLHDKHIEIVVRQMLKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAVPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQRTLKAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural mechanism for rifampicin inhibition of bacterial rna polymerase.
pubmed doi rcsb
molecule tags Transcription
total genus 181
structure length 1174
sequence length 1234
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00623 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2
D PF04983 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3
D PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
D PF05000 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.30 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1i6vD03
1.10.274.100 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 1i6vD02
3.90.105.30 Alpha Beta Alpha-Beta Complex Molybdopterin biosynthesis moea protein, domain 2 Molybdopterin biosynthesis moea protein, domain 2 1i6vD05
2YU9A 3GTPA 1IW7D 1I6VD 4AYBA 2R92A 2O5JD 1TWCA 2A6HD 3HKZA 3GTQA 1WCMA 2A68D 3GTOA 2BE5D 2Y0SA 1Y1WA 1TWAA 1I3QA 2NVXA 1SFOA 1I50A 1HQMD 4C2MA 3GTGA 1YNJD 2R7ZA 3CQZA 2VUMA 2A6ED 1TWGA 2WB1A 4QIWA 1R9TA 1Y1VA 1ZYRD 2CW0D 2E2IA 2WAQA 2NVYA 2R93A 2E2HA 1SMYD 3GTMA 2JA5A 3FKIA 2JA6A 1YNND 3GTKA 2A69D 1TWFA 2PMZA 1K83A 2JA7A 1TWHA 2B63A 3GTJA 3GTLA 3H0GA
chains in the Genus database with same CATH superfamily
1Y698 2NQMA 1I6VD 2MQAA 1TWCA 4TK4A 2MP0A 1RR8C 2BE5D 4GFQA 4KB4A 4KAWX 4Q5GA 3WVOA 1G8LA 1I3QA 4FYDA 2FTSA 5G2SA 1SFOA 4C6GA 5IZ2A 4NWBA 3LHPS 4V2QA 3P9AA 1RRJA 1A31A 3GTGA 2R7ZA 4PD0A 2NQRA 2VUMA 5ERRA 2A6ED 5ERSA 4QIWA 4CEHA 4AN8A 1ISEA 1Y1VA 1ZYRD 2JA5A 2LTHA 4CEIA 2E2HA 3GTKA 5ERQA 2A69D 4D3YA 1R5ZA 1FC5A 4QCLA 2K3QA 1TWHA 4TK3A 2YU9A 2EZAA 2X0QA 2O5JD 3EZAA 2X3LA 4H3TA 3HKZA 2NQQA 4LMOA 1T6JA 1K4TA 2HWGA 4BAAA 4AHCA 1SC7A 4U91A 1TWAA 3KYLA 3U44A 1WU2A 1A35A 2NVXA 4FGUA 1DD5A 4CEJA 1XI8A 1EH1A 3LF9A 3K5MA 5ERVA 2F4QA 3DU6A 2K3NA 2LKMB 4V2RA 4CQ5A 2NQSA 4IP9A 2WB1A 4NOMA 2Y0NA 2R4GA 2NQKA 5D8HB 5JSBB 1NH3A 5C9HA 4JLRC 4OYDB 2JA6A 1EZAA 2HROA 4KB2A 3K58A 4L8IA 2PMZA 3NZ4A 1T3EA 2NQNA 1WQFA 2X0OA 5MLC9 3GTJA 4FBSA 3GTLA 1W27A 3H0GA 3GTPA 2EZBA 5D6GA 2R92A 4NOKA 2VK9A 3MAQA 2MX8A 3GTQA 2A68D 3K59A 4C5RA 1TGOA 1V9MA 4BABA 2N1DB 2NQUA 1Y1WA 1WQGA 1GE9A 5JSNB 2F5JA 4IP8A 3EZBA 3M4AA 1Q8IA 4D3ZA 4U90A 1I50A 1EK8A 4C5UA 4TK1A 4C2MA 3U4QA 4Q5VA 1UZ5A 1EJ9A 2AQLA 3K5NA 2LPIA 5CQGA 1TWGA 1SEUA 2JA7A 3LR8A 2CW0D 2NRPA 2WAQA 2NVYA 2B9SB 4C5SA 1SMYD 2NQVA 4PD1A 3FKIA 1R49A 1TWFA 1WQHA 2EZCA 2N3EA 1K83A 3IAYA 4O26A 4AYBA 2FIPA 3JSYA 3SJRA 1Y2MA 1IW7D 3DU5A 2LYIA 2NRSA 1ZYMA 2A6HD 1WCMA 3GTOA 2K3OA 4KDDA 2Y0SA 1K4SA 3EZEA 2FIOA 2LPJA 1EZBA 1G8RA 1T8IA 1LPQA 1T6PA 4F3EA 4NOLA 1HQMD 2X0PA 3K5LA 3LR6A 2FU3A 1A36A 1YNJD 4KC6A 3CQZA 1R9TA 3K57A 2E2IA 2NROA 1MIUA 2R93A 3K5OA 4EJ3A 3GTMA 2MX9A 2YIIA 1YNND 3LRDA 1IS1A 5G2RA 5ERUA 3LR2A 4FXDA 5ERTA 2B63A 1TL8A
chains in the Genus database with same CATH topology
1Y698 2NQMA 1I6VD 2MQAA 1TWCA 4TK4A 1RR8C 2BE5D 4GFQA 4KB4A 4KAWX 4Q5GA 3WVOA 1G8LA 1I3QA 4FYDA 2FTSA 5G2SA 1SFOA 5IZ2A 4NWBA 3LHPS 3P9AA 1RRJA 1A31A 3GTGA 2R7ZA 4PD0A 2NQRA 2VUMA 5ERRA 2A6ED 5ERSA 4QIWA 4CEHA 4AN8A 1ISEA 1Y1VA 1ZYRD 2JA5A 2LTHA 4CEIA 2E2HA 3GTKA 5ERQA 2A69D 4D3YA 1R5ZA 1FC5A 4QCLA 2K3QA 1TWHA 4TK3A 2YU9A 2X0QA 2O5JD 2X3LA 4H3TA 3HKZA 2NQQA 4LMOA 1K4TA 4AHCA 1SC7A 4U91A 1TWAA 3KYLA 3U44A 1WU2A 1A35A 2NVXA 4FGUA 1DD5A 4CEJA 1XI8A 1EH1A 3LF9A 3K5MA 5ERVA 2F4QA 3DU6A 2K3NA 2LKMB 2NQSA 4IP9A 2WB1A 4NOMA 2Y0NA 2R4GA 2NQKA 5D8HB 5JSBB 1NH3A 5C9HA 4JLRC 4OYDB 2JA6A 4KB2A 3K58A 4L8IA 2PMZA 2NQNA 1T3EA 1WQFA 2X0OA 5MLC9 3GTJA 4FBSA 3GTLA 3H0GA 3GTPA 5D6GA 2R92A 4NOKA 2VK9A 3MAQA 2MX8A 3GTQA 2A68D 3K59A 1TGOA 1V9MA 2NQUA 2N1DB 1Y1WA 1WQGA 1GE9A 5JSNB 2F5JA 4IP8A 3M4AA 1Q8IA 4D3ZA 4U90A 1I50A 1EK8A 4TK1A 4C2MA 3U4QA 4Q5VA 1UZ5A 1EJ9A 2AQLA 3K5NA 2LPIA 5CQGA 1TWGA 1SEUA 2JA7A 3LR8A 2CW0D 2NRPA 2WAQA 2NVYA 2B9SB 2NQVA 1SMYD 4PD1A 3FKIA 1R49A 1TWFA 1WQHA 2N3EA 1K83A 3IAYA 4O26A 4AYBA 2FIPA 3JSYA 3SJRA 1IW7D 3DU5A 2LYIA 2NRSA 2A6HD 1WCMA 3GTOA 2K3OA 4KDDA 2Y0SA 1K4SA 2FIOA 2LPJA 1G8RA 1T8IA 1LPQA 4F3EA 4NOLA 1HQMD 2X0PA 3K5LA 3LR6A 2FU3A 1A36A 1YNJD 4KC6A 3CQZA 1R9TA 3K57A 2E2IA 2NROA 1MIUA 2R93A 3K5OA 4EJ3A 3GTMA 2MX9A 1YNND 3LRDA 1IS1A 5G2RA 5ERUA 3LR2A 4FXDA 5ERTA 2B63A 1TL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU9 A;  3GTP A;  1IW7 D;  1I6V D;  4AYB A;  2R92 A;  2O5J D;  1TWC A;  2A6H D;  3HKZ A;  3GTQ A;  1WCM A;  2A68 D;  3GTO A;  2BE5 D;  2Y0S A;  1Y1W A;  1TWA A;  1I3Q A;  2NVX A;  1SFO A;  1I50 A;  1HQM D;  4C2M A;  3GTG A;  1YNJ D;  2R7Z A;  3CQZ A;  2VUM A;  2A6E D;  1TWG A;  2WB1 A;  4QIW A;  1R9T A;  1Y1V A;  1ZYR D;  2CW0 D;  2E2I A;  2WAQ A;  2NVY A;  2R93 A;  2E2H A;  1SMY D;  3GTM A;  2JA5 A;  3FKI A;  2JA6 A;  1YNN D;  3GTK A;  2A69 D;  1TWF A;  2PMZ A;  1K83 A;  2JA7 A;  1TWH A;  2B63 A;  3GTJ A;  3GTL A;  3H0G A; 
#chains in the Genus database with same CATH topology
 1Y69 8;  2NQM A;  1I6V D;  2MQA A;  1TWC A;  4TK4 A;  2MP0 A;  1RR8 C;  2BE5 D;  4GFQ A;  4KB4 A;  4KAW X;  4Q5G A;  3WVO A;  1G8L A;  1I3Q A;  4FYD A;  2FTS A;  5G2S A;  1SFO A;  4C6G A;  5IZ2 A;  4NWB A;  3LHP S;  4V2Q A;  3P9A A;  1RRJ A;  1A31 A;  3GTG A;  2R7Z A;  4PD0 A;  2NQR A;  2VUM A;  5ERR A;  2A6E D;  5ERS A;  4QIW A;  4CEH A;  4AN8 A;  1ISE A;  1Y1V A;  1ZYR D;  2JA5 A;  2LTH A;  4CEI A;  2E2H A;  3GTK A;  5ERQ A;  2A69 D;  4D3Y A;  1R5Z A;  1FC5 A;  4QCL A;  2K3Q A;  1TWH A;  4TK3 A;  2YU9 A;  2EZA A;  2X0Q A;  2O5J D;  3EZA A;  2X3L A;  4H3T A;  3HKZ A;  2NQQ A;  4LMO A;  1T6J A;  1K4T A;  2HWG A;  4BAA A;  4AHC A;  1SC7 A;  4U91 A;  1TWA A;  3KYL A;  3U44 A;  1WU2 A;  1A35 A;  2NVX A;  4FGU A;  1DD5 A;  4CEJ A;  1XI8 A;  1EH1 A;  3LF9 A;  3K5M A;  5ERV A;  2F4Q A;  3DU6 A;  2K3N A;  2LKM B;  4V2R A;  4CQ5 A;  2NQS A;  4IP9 A;  2WB1 A;  4NOM A;  2Y0N A;  2R4G A;  2NQK A;  5D8H B;  5JSB B;  1NH3 A;  5C9H A;  4JLR C;  4OYD B;  2JA6 A;  1EZA A;  2HRO A;  4KB2 A;  3K58 A;  4L8I A;  2PMZ A;  3NZ4 A;  1T3E A;  2NQN A;  1WQF A;  2X0O A;  5MLC 9;  3GTJ A;  4FBS A;  3GTL A;  1W27 A;  3H0G A;  3GTP A;  2EZB A;  5D6G A;  2R92 A;  4NOK A;  2VK9 A;  3MAQ A;  2MX8 A;  3GTQ A;  2A68 D;  3K59 A;  4C5R A;  1TGO A;  1V9M A;  4BAB A;  2N1D B;  2NQU A;  1Y1W A;  1WQG A;  1GE9 A;  5JSN B;  2F5J A;  4IP8 A;  3EZB A;  3M4A A;  1Q8I A;  4D3Z A;  4U90 A;  1I50 A;  1EK8 A;  4C5U A;  4TK1 A;  4C2M A;  3U4Q A;  4Q5V A;  1UZ5 A;  1EJ9 A;  2AQL A;  3K5N A;  2LPI A;  5CQG A;  1TWG A;  1SEU A;  2JA7 A;  3LR8 A;  2CW0 D;  2NRP A;  2WAQ A;  2NVY A;  2B9S B;  4C5S A;  1SMY D;  2NQV A;  4PD1 A;  3FKI A;  1R49 A;  1TWF A;  1WQH A;  2EZC A;  2N3E A;  1K83 A;  3IAY A;  4O26 A;  4AYB A;  2FIP A;  3JSY A;  3SJR A;  1Y2M A;  1IW7 D;  3DU5 A;  2LYI A;  2NRS A;  1ZYM A;  2A6H D;  1WCM A;  3GTO A;  2K3O A;  4KDD A;  2Y0S A;  1K4S A;  3EZE A;  2FIO A;  2LPJ A;  1EZB A;  1G8R A;  1T8I A;  1LPQ A;  1T6P A;  4F3E A;  4NOL A;  1HQM D;  2X0P A;  3K5L A;  3LR6 A;  2FU3 A;  1A36 A;  1YNJ D;  4KC6 A;  3CQZ A;  1R9T A;  3K57 A;  2E2I A;  2NRO A;  1MIU A;  2R93 A;  3K5O A;  4EJ3 A;  3GTM A;  2MX9 A;  2YII A;  1YNN D;  3LRD A;  1IS1 A;  5G2R A;  5ERU A;  3LR2 A;  4FXD A;  5ERT A;  2B63 A;  1TL8 A; 
#chains in the Genus database with same CATH homology
 1Y69 8;  2NQM A;  1I6V D;  2MQA A;  1TWC A;  4TK4 A;  1RR8 C;  2BE5 D;  4GFQ A;  4KB4 A;  4KAW X;  4Q5G A;  3WVO A;  1G8L A;  1I3Q A;  4FYD A;  2FTS A;  5G2S A;  1SFO A;  5IZ2 A;  4NWB A;  3LHP S;  3P9A A;  1RRJ A;  1A31 A;  3GTG A;  2R7Z A;  4PD0 A;  2NQR A;  2VUM A;  5ERR A;  2A6E D;  5ERS A;  4QIW A;  4CEH A;  4AN8 A;  1ISE A;  1Y1V A;  1ZYR D;  2JA5 A;  2LTH A;  4CEI A;  2E2H A;  3GTK A;  5ERQ A;  2A69 D;  4D3Y A;  1R5Z A;  1FC5 A;  4QCL A;  2K3Q A;  1TWH A;  4TK3 A;  2YU9 A;  2X0Q A;  2O5J D;  2X3L A;  4H3T A;  3HKZ A;  2NQQ A;  4LMO A;  1K4T A;  4AHC A;  1SC7 A;  4U91 A;  1TWA A;  3KYL A;  3U44 A;  1WU2 A;  1A35 A;  2NVX A;  4FGU A;  1DD5 A;  4CEJ A;  1XI8 A;  1EH1 A;  3LF9 A;  3K5M A;  5ERV A;  2F4Q A;  3DU6 A;  2K3N A;  2LKM B;  2NQS A;  4IP9 A;  2WB1 A;  4NOM A;  2Y0N A;  2R4G A;  2NQK A;  5D8H B;  5JSB B;  1NH3 A;  5C9H A;  4JLR C;  4OYD B;  2JA6 A;  4KB2 A;  3K58 A;  4L8I A;  2PMZ A;  2NQN A;  1T3E A;  1WQF A;  2X0O A;  5MLC 9;  3GTJ A;  4FBS A;  3GTL A;  3H0G A;  3GTP A;  5D6G A;  2R92 A;  4NOK A;  2VK9 A;  3MAQ A;  2MX8 A;  3GTQ A;  2A68 D;  3K59 A;  1TGO A;  1V9M A;  2NQU A;  2N1D B;  1Y1W A;  1WQG A;  1GE9 A;  5JSN B;  2F5J A;  4IP8 A;  3M4A A;  1Q8I A;  4D3Z A;  4U90 A;  1I50 A;  1EK8 A;  4TK1 A;  4C2M A;  3U4Q A;  4Q5V A;  1UZ5 A;  1EJ9 A;  2AQL A;  3K5N A;  2LPI A;  5CQG A;  1TWG A;  1SEU A;  2JA7 A;  3LR8 A;  2CW0 D;  2NRP A;  2WAQ A;  2NVY A;  2B9S B;  2NQV A;  1SMY D;  4PD1 A;  3FKI A;  1R49 A;  1TWF A;  1WQH A;  2N3E A;  1K83 A;  3IAY A;  4O26 A;  4AYB A;  2FIP A;  3JSY A;  3SJR A;  1IW7 D;  3DU5 A;  2LYI A;  2NRS A;  2A6H D;  1WCM A;  3GTO A;  2K3O A;  4KDD A;  2Y0S A;  1K4S A;  2FIO A;  2LPJ A;  1G8R A;  1T8I A;  1LPQ A;  4F3E A;  4NOL A;  1HQM D;  2X0P A;  3K5L A;  3LR6 A;  2FU3 A;  1A36 A;  1YNJ D;  4KC6 A;  3CQZ A;  1R9T A;  3K57 A;  2E2I A;  2NRO A;  1MIU A;  2R93 A;  3K5O A;  4EJ3 A;  3GTM A;  2MX9 A;  1YNN D;  3LRD A;  1IS1 A;  5G2R A;  5ERU A;  3LR2 A;  4FXD A;  5ERT A;  2B63 A;  1TL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...