1I6VD

Thermus aquaticus core rna polymerase-rifampicin complex
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
1234
structure length
1174
Chain Sequence
b'KEVRKVRIALASPEKIRSWSYGEVEKPETEAKVCERCAVEVTRSIVRRYRMAHIELATPAAHIWFVKDVPSKIATLLDLSATELEQVLYFNKYIVLDPKAAVLDAVPVEKRQLLTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDARMGAEAIQELLKELDLEKLERELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNPGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIVVAGRETSVGRLKFVFANPDEALLAVAHGLLDLQDTVTTRYLGRRLETSPGRILFARIVGEAVGDEKVAQELIQMDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTLSTTSGITIGIDDAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKVTQAVFNNFEENYPFNPLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTNYISVPLFQMDEVTRTLRLRKRSDIESGLYGRVLAREVEALGRRLEEGRYLSLEDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGVVAAESIGEPGTQLTMRTGTDITQGLPRVIELFEARRPKAKAVISEIDGVVRIEEGEDRLSVFVESEGFSKEYKLPKDARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVDEIQKVYRAQGVKLHDKHIEIVVRQMLKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAVPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQRTLKAIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-DIRECTED RNA POLYMERASE
molecule tags Transcription
publication title Structural mechanism for rifampicin inhibition of bacterial rna polymerase.
pubmed doi rcsb
total genus 181
structure length 1174
sequence length 1234
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00623 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2
D PF04983 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3
D PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
D PF05000 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.30 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1i6vD03
1.10.274.100 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 1i6vD02
3.90.105.30 Alpha Beta Alpha-Beta Complex Molybdopterin biosynthesis moea protein, domain 2 Molybdopterin biosynthesis moea protein, domain 2 1i6vD05
1R9TA 1SMYD 1TWHA 3GTOA 1WCMA 2R92A 1IW7D 1TWCA 2E2IA 2JA7A 1I50A 2E2HA 2WB1A 1ZYRD 2B63A 3CQZA 1Y1WA 1TWFA 2Y0SA 2JA5A 1YNND 2R7ZA 2NVXA 2A6ED 2R93A 4QIWA 1HQMD 2A68D 2O5JD 4C2MA 2JA6A 3FKIA 1I3QA 2WAQA 2VUMA 1K83A 3H0GA 3HKZA 3GTKA 2NVYA 3GTQA 2A6HD 1TWGA 4AYBA 2A69D 2CW0D 3GTJA 1YNJD 1I6VD 1SFOA 3GTGA 2PMZA 2YU9A 3GTPA 3GTLA 1TWAA 3GTMA 1Y1VA 2BE5D
chains in the Genus database with same CATH superfamily
3DU5A 1TWHA 1A36A 2MP0A 1Y2MA 1WCMA 4AHCA 3K57A 2YIIA 1IW7D 1TWCA 1TGOA 4NOMA 2EZBA 4JLRC 4EJ3A 3K5MA 1WU2A 5D8HB 1R5ZA 3CQZA 2N3EA 1ZYMA 1YNND 1EZBA 3U44A 4U90A 1K4TA 4L8IA 4Q5GA 2HROA 2EZAA 3SJRA 4C2MA 1K4SA 3EZEA 2WAQA 1T6JA 2NQUA 1MIUA 3GTKA 4V2RA 1WQGA 4Q5VA 1DD5A 4FBSA 1IS1A 4C5SA 4AN8A 1WQFA 3GTGA 1TL8A 4QCLA 1SEUA 2LKMB 3GTPA 1G8RA 2NQRA 4TK3A 4IP9A 5ERSA 2NQNA 1NH3A 1R9TA 5JSNB 1T3EA 4PD0A 1GE9A 2LPJA 2MQAA 2EZCA 4NWBA 3M4AA 3K58A 1Q8IA 1RRJA 2X3LA 1EH1A 3K5NA 1ZYRD 1R49A 2B63A 1Y1WA 3MAQA 2FIPA 3LR2A 3KYLA 2JA5A 2X0OA 1T6PA 4C5UA 2R7ZA 3LR6A 3K5LA 2R93A 5ERTA 2A68D 2X0PA 1K83A 1LPQA 2X0QA 3HKZA 5D6GA 2HWGA 3GTQA 2NQVA 2A6HD 4AYBA 4KB2A 3EZBA 1SFOA 4KC6A 4NOKA 3DU6A 3GTLA 1TWAA 1V9MA 4CQ5A 4QIWA 2NQKA 2BE5D 1I6VD 2K3QA 2NRPA 5ERVA 4O26A 3GTOA 1EJ9A 4KAWX 3IAYA 1A31A 4CEIA 3LF9A 2VK9A 3P9AA 1I50A 5ERRA 2Y0NA 2WB1A 3LRDA 3NZ4A 4C5RA 2NROA 1TWFA 2A6ED 2FU3A 4NOLA 2K3NA 1RR8C 2O5JD 4H3TA 2B9SB 4CEJA 2JA6A 4FXDA 1EZAA 4LMOA 3H0GA 3K5OA 4D3ZA 2NVYA 4GFQA 2A69D 2NRSA 4F3EA 2CW0D 4KDDA 1XI8A 1EK8A 5ERUA 4U91A 4BABA 1T8IA 5ERQA 2F5JA 3JSYA 1Y1VA 4FGUA 1A35A 3LR8A 1UZ5A 4C6GA 1ISEA 5G2RA 3LHPS 1SMYD 4OYDB 5G2SA 2R92A 2E2IA 3U4QA 4CEHA 4BAAA 5JSBB 2F4QA 5C9HA 2JA7A 2N1DB 4TK1A 2E2HA 1WQHA 3WVOA 2LTHA 2MX8A 1G8LA 2Y0SA 1FC5A 1W27A 2AQLA 2NQSA 4TK4A 2K3OA 2NVXA 2LYIA 5CQGA 2FTSA 3K59A 1HQMD 5MLC9 4KB4A 5IZ2A 3FKIA 1I3QA 4IP8A 2VUMA 2NQQA 2NQMA 4D3YA 1TWGA 3GTJA 4FYDA 2FIOA 2R4GA 1YNJD 2MX9A 1Y698 4V2QA 2PMZA 1SC7A 2YU9A 3GTMA 2LPIA 3EZAA 4PD1A
chains in the Genus database with same CATH topology
3DU5A 1TWHA 1A36A 1WCMA 4AHCA 3K57A 1IW7D 1TWCA 1TGOA 4NOMA 4JLRC 4EJ3A 3K5MA 1WU2A 5D8HB 1R5ZA 3CQZA 2N3EA 1YNND 3U44A 4U90A 1K4TA 4L8IA 4Q5GA 3SJRA 4C2MA 1K4SA 2WAQA 2NQUA 1MIUA 3GTKA 1WQGA 4Q5VA 1DD5A 4FBSA 1IS1A 4AN8A 1WQFA 3GTGA 1TL8A 4QCLA 1SEUA 2LKMB 3GTPA 1G8RA 2NQRA 4TK3A 4IP9A 5ERSA 2NQNA 1NH3A 1R9TA 5JSNB 1T3EA 4PD0A 1GE9A 2LPJA 2MQAA 4NWBA 3M4AA 3K58A 1Q8IA 1RRJA 2X3LA 1EH1A 3K5NA 1ZYRD 1R49A 2B63A 1Y1WA 3MAQA 2FIPA 3LR2A 3KYLA 2JA5A 2X0OA 2R7ZA 3LR6A 3K5LA 2R93A 5ERTA 2A68D 2X0PA 1K83A 1LPQA 2X0QA 3HKZA 5D6GA 3GTQA 2NQVA 2A6HD 4AYBA 4KB2A 1SFOA 4KC6A 4NOKA 3DU6A 3GTLA 1TWAA 1V9MA 2NQKA 4QIWA 2NRPA 2BE5D 1I6VD 2K3QA 5ERVA 4O26A 3GTOA 1EJ9A 4KAWX 3IAYA 1A31A 4CEIA 3LF9A 2VK9A 3P9AA 1I50A 5ERRA 2Y0NA 2WB1A 3LRDA 2NROA 1TWFA 2A6ED 2FU3A 4NOLA 2K3NA 1RR8C 2O5JD 4H3TA 2B9SB 4CEJA 2JA6A 4FXDA 4LMOA 3H0GA 3K5OA 4D3ZA 2NVYA 4GFQA 2A69D 2NRSA 4F3EA 2CW0D 4KDDA 1XI8A 1EK8A 5ERUA 4U91A 1T8IA 5ERQA 2F5JA 3JSYA 1Y1VA 4FGUA 1A35A 3LR8A 1UZ5A 1ISEA 5G2RA 3LHPS 1SMYD 4OYDB 5G2SA 2R92A 2E2IA 3U4QA 4CEHA 5JSBB 2F4QA 5C9HA 2JA7A 2N1DB 4TK1A 2E2HA 1WQHA 3WVOA 2LTHA 2MX8A 1G8LA 2Y0SA 1FC5A 2AQLA 2NQSA 4TK4A 2K3OA 2NVXA 2LYIA 5CQGA 2FTSA 3K59A 1HQMD 5MLC9 4KB4A 5IZ2A 3FKIA 1I3QA 4IP8A 2VUMA 2NQQA 2NQMA 4D3YA 1TWGA 3GTJA 4FYDA 2FIOA 2R4GA 1YNJD 2MX9A 1Y698 2PMZA 1SC7A 2YU9A 3GTMA 2LPIA 4PD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T A;  1SMY D;  1TWH A;  3GTO A;  1WCM A;  2R92 A;  1IW7 D;  1TWC A;  2E2I A;  2JA7 A;  1I50 A;  2E2H A;  2WB1 A;  1ZYR D;  2B63 A;  3CQZ A;  1Y1W A;  1TWF A;  2Y0S A;  2JA5 A;  1YNN D;  2R7Z A;  2NVX A;  2A6E D;  2R93 A;  4QIW A;  1HQM D;  2A68 D;  2O5J D;  4C2M A;  2JA6 A;  3FKI A;  1I3Q A;  2WAQ A;  2VUM A;  1K83 A;  3H0G A;  3HKZ A;  3GTK A;  2NVY A;  3GTQ A;  2A6H D;  1TWG A;  4AYB A;  2A69 D;  2CW0 D;  3GTJ A;  1YNJ D;  1I6V D;  1SFO A;  3GTG A;  2PMZ A;  2YU9 A;  3GTP A;  3GTL A;  1TWA A;  3GTM A;  1Y1V A;  2BE5 D; 
#chains in the Genus database with same CATH topology
 3DU5 A;  1TWH A;  1A36 A;  2MP0 A;  1Y2M A;  1WCM A;  4AHC A;  3K57 A;  2YII A;  1IW7 D;  1TWC A;  1TGO A;  4NOM A;  2EZB A;  4JLR C;  4EJ3 A;  3K5M A;  1WU2 A;  5D8H B;  1R5Z A;  3CQZ A;  2N3E A;  1ZYM A;  1YNN D;  1EZB A;  3U44 A;  4U90 A;  1K4T A;  4L8I A;  4Q5G A;  2HRO A;  2EZA A;  3SJR A;  4C2M A;  1K4S A;  3EZE A;  2WAQ A;  1T6J A;  2NQU A;  1MIU A;  3GTK A;  4V2R A;  1WQG A;  4Q5V A;  1DD5 A;  4FBS A;  1IS1 A;  4C5S A;  4AN8 A;  1WQF A;  3GTG A;  1TL8 A;  4QCL A;  1SEU A;  2LKM B;  3GTP A;  1G8R A;  2NQR A;  4TK3 A;  4IP9 A;  5ERS A;  2NQN A;  1NH3 A;  1R9T A;  5JSN B;  1T3E A;  4PD0 A;  1GE9 A;  2LPJ A;  2MQA A;  2EZC A;  4NWB A;  3M4A A;  3K58 A;  1Q8I A;  1RRJ A;  2X3L A;  1EH1 A;  3K5N A;  1ZYR D;  1R49 A;  2B63 A;  1Y1W A;  3MAQ A;  2FIP A;  3LR2 A;  3KYL A;  2JA5 A;  2X0O A;  1T6P A;  4C5U A;  2R7Z A;  3LR6 A;  3K5L A;  2R93 A;  5ERT A;  2A68 D;  2X0P A;  1K83 A;  1LPQ A;  2X0Q A;  3HKZ A;  5D6G A;  2HWG A;  3GTQ A;  2NQV A;  2A6H D;  4AYB A;  4KB2 A;  3EZB A;  1SFO A;  4KC6 A;  4NOK A;  3DU6 A;  3GTL A;  1TWA A;  1V9M A;  4CQ5 A;  4QIW A;  2NQK A;  2BE5 D;  1I6V D;  2K3Q A;  2NRP A;  5ERV A;  4O26 A;  3GTO A;  1EJ9 A;  4KAW X;  3IAY A;  1A31 A;  4CEI A;  3LF9 A;  2VK9 A;  3P9A A;  1I50 A;  5ERR A;  2Y0N A;  2WB1 A;  3LRD A;  3NZ4 A;  4C5R A;  2NRO A;  1TWF A;  2A6E D;  2FU3 A;  4NOL A;  2K3N A;  1RR8 C;  2O5J D;  4H3T A;  2B9S B;  4CEJ A;  2JA6 A;  4FXD A;  1EZA A;  4LMO A;  3H0G A;  3K5O A;  4D3Z A;  2NVY A;  4GFQ A;  2A69 D;  2NRS A;  4F3E A;  2CW0 D;  4KDD A;  1XI8 A;  1EK8 A;  5ERU A;  4U91 A;  4BAB A;  1T8I A;  5ERQ A;  2F5J A;  3JSY A;  1Y1V A;  4FGU A;  1A35 A;  3LR8 A;  1UZ5 A;  4C6G A;  1ISE A;  5G2R A;  3LHP S;  1SMY D;  4OYD B;  5G2S A;  2R92 A;  2E2I A;  3U4Q A;  4CEH A;  4BAA A;  5JSB B;  2F4Q A;  5C9H A;  2JA7 A;  2N1D B;  4TK1 A;  2E2H A;  1WQH A;  3WVO A;  2LTH A;  2MX8 A;  1G8L A;  2Y0S A;  1FC5 A;  1W27 A;  2AQL A;  2NQS A;  4TK4 A;  2K3O A;  2NVX A;  2LYI A;  5CQG A;  2FTS A;  3K59 A;  1HQM D;  5MLC 9;  4KB4 A;  5IZ2 A;  3FKI A;  1I3Q A;  4IP8 A;  2VUM A;  2NQQ A;  2NQM A;  4D3Y A;  1TWG A;  3GTJ A;  4FYD A;  2FIO A;  2R4G A;  1YNJ D;  2MX9 A;  1Y69 8;  4V2Q A;  2PMZ A;  1SC7 A;  2YU9 A;  3GTM A;  2LPI A;  3EZA A;  4PD1 A; 
#chains in the Genus database with same CATH homology
 3DU5 A;  1TWH A;  1A36 A;  1WCM A;  4AHC A;  3K57 A;  1IW7 D;  1TWC A;  1TGO A;  4NOM A;  4JLR C;  4EJ3 A;  3K5M A;  1WU2 A;  5D8H B;  1R5Z A;  3CQZ A;  2N3E A;  1YNN D;  3U44 A;  4U90 A;  1K4T A;  4L8I A;  4Q5G A;  3SJR A;  4C2M A;  1K4S A;  2WAQ A;  2NQU A;  1MIU A;  3GTK A;  1WQG A;  4Q5V A;  1DD5 A;  4FBS A;  1IS1 A;  4AN8 A;  1WQF A;  3GTG A;  1TL8 A;  4QCL A;  1SEU A;  2LKM B;  3GTP A;  1G8R A;  2NQR A;  4TK3 A;  4IP9 A;  5ERS A;  2NQN A;  1NH3 A;  1R9T A;  5JSN B;  1T3E A;  4PD0 A;  1GE9 A;  2LPJ A;  2MQA A;  4NWB A;  3M4A A;  3K58 A;  1Q8I A;  1RRJ A;  2X3L A;  1EH1 A;  3K5N A;  1ZYR D;  1R49 A;  2B63 A;  1Y1W A;  3MAQ A;  2FIP A;  3LR2 A;  3KYL A;  2JA5 A;  2X0O A;  2R7Z A;  3LR6 A;  3K5L A;  2R93 A;  5ERT A;  2A68 D;  2X0P A;  1K83 A;  1LPQ A;  2X0Q A;  3HKZ A;  5D6G A;  3GTQ A;  2NQV A;  2A6H D;  4AYB A;  4KB2 A;  1SFO A;  4KC6 A;  4NOK A;  3DU6 A;  3GTL A;  1TWA A;  1V9M A;  2NQK A;  4QIW A;  2NRP A;  2BE5 D;  1I6V D;  2K3Q A;  5ERV A;  4O26 A;  3GTO A;  1EJ9 A;  4KAW X;  3IAY A;  1A31 A;  4CEI A;  3LF9 A;  2VK9 A;  3P9A A;  1I50 A;  5ERR A;  2Y0N A;  2WB1 A;  3LRD A;  2NRO A;  1TWF A;  2A6E D;  2FU3 A;  4NOL A;  2K3N A;  1RR8 C;  2O5J D;  4H3T A;  2B9S B;  4CEJ A;  2JA6 A;  4FXD A;  4LMO A;  3H0G A;  3K5O A;  4D3Z A;  2NVY A;  4GFQ A;  2A69 D;  2NRS A;  4F3E A;  2CW0 D;  4KDD A;  1XI8 A;  1EK8 A;  5ERU A;  4U91 A;  1T8I A;  5ERQ A;  2F5J A;  3JSY A;  1Y1V A;  4FGU A;  1A35 A;  3LR8 A;  1UZ5 A;  1ISE A;  5G2R A;  3LHP S;  1SMY D;  4OYD B;  5G2S A;  2R92 A;  2E2I A;  3U4Q A;  4CEH A;  5JSB B;  2F4Q A;  5C9H A;  2JA7 A;  2N1D B;  4TK1 A;  2E2H A;  1WQH A;  3WVO A;  2LTH A;  2MX8 A;  1G8L A;  2Y0S A;  1FC5 A;  2AQL A;  2NQS A;  4TK4 A;  2K3O A;  2NVX A;  2LYI A;  5CQG A;  2FTS A;  3K59 A;  1HQM D;  5MLC 9;  4KB4 A;  5IZ2 A;  3FKI A;  1I3Q A;  4IP8 A;  2VUM A;  2NQQ A;  2NQM A;  4D3Y A;  1TWG A;  3GTJ A;  4FYD A;  2FIO A;  2R4G A;  1YNJ D;  2MX9 A;  1Y69 8;  2PMZ A;  1SC7 A;  2YU9 A;  3GTM A;  2LPI A;  4PD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...