1I6VD

Thermus aquaticus core rna polymerase-rifampicin complex
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
1234
structure length
1174
Chain Sequence
KEVRKVRIALASPEKIRSWSYGEVEKPETEAKVCERCAVEVTRSIVRRYRMAHIELATPAAHIWFVKDVPSKIATLLDLSATELEQVLYFNKYIVLDPKAAVLDAVPVEKRQLLTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDARMGAEAIQELLKELDLEKLERELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNPGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIVVAGRETSVGRLKFVFANPDEALLAVAHGLLDLQDTVTTRYLGRRLETSPGRILFARIVGEAVGDEKVAQELIQMDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTLSTTSGITIGIDDAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKVTQAVFNNFEENYPFNPLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTNYISVPLFQMDEVTRTLRLRKRSDIESGLYGRVLAREVEALGRRLEEGRYLSLEDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGVVAAESIGEPGTQLTMRTGTDITQGLPRVIELFEARRPKAKAVISEIDGVVRIEEGEDRLSVFVESEGFSKEYKLPKDARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVDEIQKVYRAQGVKLHDKHIEIVVRQMLKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAVPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQRTLKAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural mechanism for rifampicin inhibition of bacterial rna polymerase.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 181
structure length 1174
sequence length 1234
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00623 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2
D PF04983 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3
D PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
D PF05000 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.30 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1i6vD03
1.10.274.100 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 1i6vD02
3.90.105.30 Alpha Beta Alpha-Beta Complex Molybdopterin biosynthesis moea protein, domain 2 Molybdopterin biosynthesis moea protein, domain 2 1i6vD05
1TWGA 1Y1VA 3HKZA 4AYBA 3H0GA 3GTGA 2Y0SA 2E2HA 1ZYRD 1R9TA 3GTLA 3GTQA 1K83A 3GTPA 1Y1WA 2R93A 3GTJA 1I50A 2CW0D 2NVYA 1TWCA 2JA5A 3GTMA 1TWFA 3FKIA 1TWAA 1IW7D 1HQMD 2YU9A 2R92A 2A6ED 2WB1A 1YNND 1SFOA 1SMYD 1YNJD 4QIWA 2BE5D 1I6VD 3GTOA 2VUMA 2A69D 2R7ZA 2JA6A 2JA7A 2A6HD 2E2IA 2WAQA 1TWHA 2A68D 3CQZA 3GTKA 2B63A 2PMZA 4C2MA 2O5JD 1WCMA 2NVXA 1I3QA
chains in the Genus database with same CATH superfamily
2NROA 1FC5A 3HKZA 3NZ4A 3K59A 2MQAA 5G2SA 1EH1A 1EK8A 4CEJA 2FIOA 2E2HA 2Y0NA 4FYDA 3GTPA 1Y1WA 1K4TA 2R93A 1EZAA 2NVYA 2EZAA 4L8IA 2B9SB 2X0PA 4Q5GA 1V9MA 1HQMD 4F3EA 4U90A 2WB1A 2F5JA 1SFOA 3LR8A 2NQMA 1SMYD 1ZYMA 1YNJD 2BE5D 2X0OA 3LR6A 2A6HD 2E2IA 4IP8A 1TWHA 1R49A 2FIPA 3CQZA 1XI8A 1LPQA 4V2RA 2X3LA 2LPJA 4C2MA 3KYLA 5ERRA 3DU5A 1I3QA 2NVXA 1WU2A 4PD0A 3H0GA 1ISEA 3GTGA 2Y0SA 1K4SA 4KC6A 1ZYRD 2F4QA 5CQGA 1SEUA 3EZAA 5JSNB 1I50A 1NH3A 2CW0D 3GTJA 2NQNA 1TWCA 1Y698 1T6PA 4C6GA 4EJ3A 1TWFA 2MP0A 5C9HA 1Y2MA 4CEHA 1T8IA 2R92A 2YU9A 3LRDA 2A6ED 2NQKA 2MX8A 4PD1A 1RR8C 1TGOA 3K57A 1Q8IA 4AN8A 5IZ2A 4C5UA 2VUMA 2AQLA 2NQUA 1WQFA 2NQSA 4NOLA 1SC7A 4FBSA 1R5ZA 3LHPS 2MX9A 3DU6A 1WQGA 4O26A 4C5RA 4TK4A 2EZCA 5G2RA 1WCMA 1A31A 2R4GA 1TL8A 1TWGA 1Y1VA 4CEIA 1A35A 2NQQA 3M4AA 3EZEA 2X0QA 4NOMA 3GTLA 1EZBA 2VK9A 2NQVA 3MAQA 2NRSA 4C5SA 2FTSA 2LKMB 2LYIA 4KB4A 4Q5VA 3FKIA 5JSBB 5ERQA 1TWAA 4TK3A 1IW7D 1DD5A 1YNND 1G8LA 3U44A 2K3QA 5D6GA 3K58A 4QIWA 4D3YA 4BABA 4IP9A 2A69D 4KAWX 4KDDA 4FGUA 4GFQA 2JA7A 3U4QA 2NQRA 3LR2A 2LPIA 5ERUA 1RRJA 1IS1A 3IAYA 4CQ5A 4QCLA 4NWBA 2O5JD 3SJRA 1T3EA 5ERSA 3K5NA 2EZBA 4V2QA 4U91A 2N3EA 3LF9A 4AYBA 4NOKA 2LTHA 4KB2A 3JSYA 1R9TA 4JLRC 3GTQA 1K83A 4AHCA 2FU3A 1A36A 1UZ5A 2K3NA 4D3ZA 3K5LA 3GTMA 4BAAA 3K5MA 3P9AA 1EJ9A 5MLC9 3WVOA 1W27A 4LMOA 2HROA 4TK1A 2K3OA 4H3TA 3GTOA 1I6VD 2R7ZA 4FXDA 2JA6A 2HWGA 1GE9A 5ERTA 2WAQA 3EZBA 2YIIA 4OYDB 5ERVA 2A68D 1WQHA 2B63A 1MIUA 3K5OA 2N1DB 2PMZA 1T6JA 2NRPA 5D8HB 1G8RA 2JA5A 3GTKA
chains in the Genus database with same CATH topology
2NROA 1FC5A 3HKZA 3K59A 2MQAA 5G2SA 1EH1A 1EK8A 4CEJA 2FIOA 2E2HA 2Y0NA 4FYDA 3GTPA 1Y1WA 1K4TA 2R93A 2NVYA 4L8IA 2B9SB 2X0PA 4Q5GA 1V9MA 1HQMD 4F3EA 4U90A 2WB1A 2F5JA 1SFOA 3LR8A 2NQMA 1SMYD 1YNJD 2BE5D 2X0OA 3LR6A 2A6HD 2E2IA 4IP8A 1TWHA 1R49A 2FIPA 3CQZA 1XI8A 1LPQA 2X3LA 2LPJA 4C2MA 3KYLA 5ERRA 3DU5A 1I3QA 2NVXA 1WU2A 4PD0A 3H0GA 1ISEA 3GTGA 2Y0SA 1K4SA 4KC6A 1ZYRD 2F4QA 5CQGA 1SEUA 5JSNB 1I50A 1NH3A 2CW0D 3GTJA 2NQNA 1TWCA 1Y698 4EJ3A 1TWFA 5C9HA 4CEHA 1T8IA 2R92A 2YU9A 3LRDA 2A6ED 2NQKA 2MX8A 4PD1A 1RR8C 1TGOA 3K57A 1Q8IA 4AN8A 5IZ2A 2VUMA 2AQLA 2NQUA 1WQFA 2NQSA 4NOLA 1SC7A 4FBSA 1R5ZA 3LHPS 2MX9A 3DU6A 1WQGA 4O26A 4TK4A 5G2RA 1WCMA 1A31A 2R4GA 1TL8A 1TWGA 1Y1VA 1A35A 2NQQA 3M4AA 2X0QA 4NOMA 3GTLA 2VK9A 2NQVA 3MAQA 2NRSA 2FTSA 2LKMB 2LYIA 4KB4A 4Q5VA 3FKIA 5JSBB 5ERQA 1TWAA 4TK3A 1IW7D 1DD5A 1YNND 1G8LA 3U44A 2K3QA 5D6GA 3K58A 4QIWA 4D3YA 4IP9A 2A69D 4KAWX 4KDDA 4FGUA 4GFQA 2JA7A 3U4QA 2NQRA 3LR2A 2LPIA 5ERUA 1RRJA 1IS1A 3IAYA 4NWBA 4QCLA 2O5JD 3SJRA 1T3EA 5ERSA 3K5NA 4U91A 2N3EA 3LF9A 4AYBA 4NOKA 2LTHA 4KB2A 3JSYA 1R9TA 4JLRC 3GTQA 1K83A 4AHCA 2FU3A 1A36A 1UZ5A 2K3NA 4D3ZA 3K5LA 3GTMA 3K5MA 3P9AA 1EJ9A 5MLC9 3WVOA 4LMOA 4TK1A 2K3OA 4H3TA 3GTOA 1I6VD 2R7ZA 4FXDA 2JA6A 1GE9A 5ERTA 2WAQA 5ERVA 4OYDB 2A68D 1WQHA 2B63A 1MIUA 3K5OA 2N1DB 2PMZA 4CEIA 2NRPA 5D8HB 1G8RA 2JA5A 3GTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWG A;  1Y1V A;  3HKZ A;  4AYB A;  3H0G A;  3GTG A;  2Y0S A;  2E2H A;  1ZYR D;  1R9T A;  3GTL A;  3GTQ A;  1K83 A;  3GTP A;  1Y1W A;  2R93 A;  3GTJ A;  1I50 A;  2CW0 D;  2NVY A;  1TWC A;  2JA5 A;  3GTM A;  1TWF A;  3FKI A;  1TWA A;  1IW7 D;  1HQM D;  2YU9 A;  2R92 A;  2A6E D;  2WB1 A;  1YNN D;  1SFO A;  1SMY D;  1YNJ D;  4QIW A;  2BE5 D;  1I6V D;  3GTO A;  2VUM A;  2A69 D;  2R7Z A;  2JA6 A;  2JA7 A;  2A6H D;  2E2I A;  2WAQ A;  1TWH A;  2A68 D;  3CQZ A;  3GTK A;  2B63 A;  2PMZ A;  4C2M A;  2O5J D;  1WCM A;  2NVX A;  1I3Q A; 
#chains in the Genus database with same CATH topology
 2NRO A;  1FC5 A;  3HKZ A;  3NZ4 A;  3K59 A;  2MQA A;  5G2S A;  1EH1 A;  1EK8 A;  4CEJ A;  2FIO A;  2E2H A;  2Y0N A;  4FYD A;  3GTP A;  1Y1W A;  1K4T A;  2R93 A;  1EZA A;  2NVY A;  2EZA A;  4L8I A;  2B9S B;  2X0P A;  4Q5G A;  1V9M A;  1HQM D;  4F3E A;  4U90 A;  2WB1 A;  2F5J A;  1SFO A;  3LR8 A;  2NQM A;  1SMY D;  1ZYM A;  1YNJ D;  2BE5 D;  2X0O A;  3LR6 A;  2A6H D;  2E2I A;  4IP8 A;  1TWH A;  1R49 A;  2FIP A;  3CQZ A;  1XI8 A;  1LPQ A;  4V2R A;  2X3L A;  2LPJ A;  4C2M A;  3KYL A;  5ERR A;  3DU5 A;  1I3Q A;  2NVX A;  1WU2 A;  4PD0 A;  3H0G A;  1ISE A;  3GTG A;  2Y0S A;  1K4S A;  4KC6 A;  1ZYR D;  2F4Q A;  5CQG A;  1SEU A;  3EZA A;  5JSN B;  1I50 A;  1NH3 A;  2CW0 D;  3GTJ A;  2NQN A;  1TWC A;  1Y69 8;  1T6P A;  4C6G A;  4EJ3 A;  1TWF A;  2MP0 A;  5C9H A;  1Y2M A;  4CEH A;  1T8I A;  2R92 A;  2YU9 A;  3LRD A;  2A6E D;  2NQK A;  2MX8 A;  4PD1 A;  1RR8 C;  1TGO A;  3K57 A;  1Q8I A;  4AN8 A;  5IZ2 A;  4C5U A;  2VUM A;  2AQL A;  2NQU A;  1WQF A;  2NQS A;  4NOL A;  1SC7 A;  4FBS A;  1R5Z A;  3LHP S;  2MX9 A;  3DU6 A;  1WQG A;  4O26 A;  4C5R A;  4TK4 A;  2EZC A;  5G2R A;  1WCM A;  1A31 A;  2R4G A;  1TL8 A;  1TWG A;  1Y1V A;  4CEI A;  1A35 A;  2NQQ A;  3M4A A;  3EZE A;  2X0Q A;  4NOM A;  3GTL A;  1EZB A;  2VK9 A;  2NQV A;  3MAQ A;  2NRS A;  4C5S A;  2FTS A;  2LKM B;  2LYI A;  4KB4 A;  4Q5V A;  3FKI A;  5JSB B;  5ERQ A;  1TWA A;  4TK3 A;  1IW7 D;  1DD5 A;  1YNN D;  1G8L A;  3U44 A;  2K3Q A;  5D6G A;  3K58 A;  4QIW A;  4D3Y A;  4BAB A;  4IP9 A;  2A69 D;  4KAW X;  4KDD A;  4FGU A;  4GFQ A;  2JA7 A;  3U4Q A;  2NQR A;  3LR2 A;  2LPI A;  5ERU A;  1RRJ A;  1IS1 A;  3IAY A;  4CQ5 A;  4QCL A;  4NWB A;  2O5J D;  3SJR A;  1T3E A;  5ERS A;  3K5N A;  2EZB A;  4V2Q A;  4U91 A;  2N3E A;  3LF9 A;  4AYB A;  4NOK A;  2LTH A;  4KB2 A;  3JSY A;  1R9T A;  4JLR C;  3GTQ A;  1K83 A;  4AHC A;  2FU3 A;  1A36 A;  1UZ5 A;  2K3N A;  4D3Z A;  3K5L A;  3GTM A;  4BAA A;  3K5M A;  3P9A A;  1EJ9 A;  5MLC 9;  3WVO A;  1W27 A;  4LMO A;  2HRO A;  4TK1 A;  2K3O A;  4H3T A;  3GTO A;  1I6V D;  2R7Z A;  4FXD A;  2JA6 A;  2HWG A;  1GE9 A;  5ERT A;  2WAQ A;  3EZB A;  2YII A;  4OYD B;  5ERV A;  2A68 D;  1WQH A;  2B63 A;  1MIU A;  3K5O A;  2N1D B;  2PMZ A;  1T6J A;  2NRP A;  5D8H B;  1G8R A;  2JA5 A;  3GTK A; 
#chains in the Genus database with same CATH homology
 2NRO A;  1FC5 A;  3HKZ A;  3K59 A;  2MQA A;  5G2S A;  1EH1 A;  1EK8 A;  4CEJ A;  2FIO A;  2E2H A;  2Y0N A;  4FYD A;  3GTP A;  1Y1W A;  1K4T A;  2R93 A;  2NVY A;  4L8I A;  2B9S B;  2X0P A;  4Q5G A;  1V9M A;  1HQM D;  4F3E A;  4U90 A;  2WB1 A;  2F5J A;  1SFO A;  3LR8 A;  2NQM A;  1SMY D;  1YNJ D;  2BE5 D;  2X0O A;  3LR6 A;  2A6H D;  2E2I A;  4IP8 A;  1TWH A;  1R49 A;  2FIP A;  3CQZ A;  1XI8 A;  1LPQ A;  2X3L A;  2LPJ A;  4C2M A;  3KYL A;  5ERR A;  3DU5 A;  1I3Q A;  2NVX A;  1WU2 A;  4PD0 A;  3H0G A;  1ISE A;  3GTG A;  2Y0S A;  1K4S A;  4KC6 A;  1ZYR D;  2F4Q A;  5CQG A;  1SEU A;  5JSN B;  1I50 A;  1NH3 A;  2CW0 D;  3GTJ A;  2NQN A;  1TWC A;  1Y69 8;  4EJ3 A;  1TWF A;  5C9H A;  4CEH A;  1T8I A;  2R92 A;  2YU9 A;  3LRD A;  2A6E D;  2NQK A;  2MX8 A;  4PD1 A;  1RR8 C;  1TGO A;  3K57 A;  1Q8I A;  4AN8 A;  5IZ2 A;  2VUM A;  2AQL A;  2NQU A;  1WQF A;  2NQS A;  4NOL A;  1SC7 A;  4FBS A;  1R5Z A;  3LHP S;  2MX9 A;  3DU6 A;  1WQG A;  4O26 A;  4TK4 A;  5G2R A;  1WCM A;  1A31 A;  2R4G A;  1TL8 A;  1TWG A;  1Y1V A;  1A35 A;  2NQQ A;  3M4A A;  2X0Q A;  4NOM A;  3GTL A;  2VK9 A;  2NQV A;  3MAQ A;  2NRS A;  2FTS A;  2LKM B;  2LYI A;  4KB4 A;  4Q5V A;  3FKI A;  5JSB B;  5ERQ A;  1TWA A;  4TK3 A;  1IW7 D;  1DD5 A;  1YNN D;  1G8L A;  3U44 A;  2K3Q A;  5D6G A;  3K58 A;  4QIW A;  4D3Y A;  4IP9 A;  2A69 D;  4KAW X;  4KDD A;  4FGU A;  4GFQ A;  2JA7 A;  3U4Q A;  2NQR A;  3LR2 A;  2LPI A;  5ERU A;  1RRJ A;  1IS1 A;  3IAY A;  4NWB A;  4QCL A;  2O5J D;  3SJR A;  1T3E A;  5ERS A;  3K5N A;  4U91 A;  2N3E A;  3LF9 A;  4AYB A;  4NOK A;  2LTH A;  4KB2 A;  3JSY A;  1R9T A;  4JLR C;  3GTQ A;  1K83 A;  4AHC A;  2FU3 A;  1A36 A;  1UZ5 A;  2K3N A;  4D3Z A;  3K5L A;  3GTM A;  3K5M A;  3P9A A;  1EJ9 A;  5MLC 9;  3WVO A;  4LMO A;  4TK1 A;  2K3O A;  4H3T A;  3GTO A;  1I6V D;  2R7Z A;  4FXD A;  2JA6 A;  1GE9 A;  5ERT A;  2WAQ A;  5ERV A;  4OYD B;  2A68 D;  1WQH A;  2B63 A;  1MIU A;  3K5O A;  2N1D B;  2PMZ A;  4CEI A;  2NRP A;  5D8H B;  1G8R A;  2JA5 A;  3GTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...