1I6VD

Thermus aquaticus core rna polymerase-rifampicin complex
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
1234
structure length
1174
Chain Sequence
KEVRKVRIALASPEKIRSWSYGEVEKPETEAKVCERCAVEVTRSIVRRYRMAHIELATPAAHIWFVKDVPSKIATLLDLSATELEQVLYFNKYIVLDPKAAVLDAVPVEKRQLLTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDARMGAEAIQELLKELDLEKLERELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNPGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIVVAGRETSVGRLKFVFANPDEALLAVAHGLLDLQDTVTTRYLGRRLETSPGRILFARIVGEAVGDEKVAQELIQMDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTLSTTSGITIGIDDAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKVTQAVFNNFEENYPFNPLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTNYISVPLFQMDEVTRTLRLRKRSDIESGLYGRVLAREVEALGRRLEEGRYLSLEDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGVVAAESIGEPGTQLTMRTGTDITQGLPRVIELFEARRPKAKAVISEIDGVVRIEEGEDRLSVFVESEGFSKEYKLPKDARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVDEIQKVYRAQGVKLHDKHIEIVVRQMLKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAVPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQRTLKAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural mechanism for rifampicin inhibition of bacterial rna polymerase.
pubmed doi rcsb
total genus 181
structure length 1174
sequence length 1234
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00623 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2
D PF04983 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3
D PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
D PF05000 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.30 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1i6vD03
1.10.274.100 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 1i6vD02
3.90.105.30 Alpha Beta Alpha-Beta Complex Molybdopterin biosynthesis moea protein, domain 2 Molybdopterin biosynthesis moea protein, domain 2 1i6vD05
1SMYD 2A68D 2A6HD 3FKIA 3GTQA 2WAQA 2R7ZA 2Y0SA 3CQZA 1YNND 1R9TA 2JA7A 2E2IA 1HQMD 1ZYRD 3GTMA 1K83A 2BE5D 1TWGA 2CW0D 3GTLA 2A6ED 4AYBA 1SFOA 3GTPA 2JA6A 1Y1WA 1IW7D 2R93A 2O5JD 4QIWA 1TWFA 3GTJA 3GTKA 2NVXA 2JA5A 1Y1VA 1TWHA 2VUMA 1WCMA 3GTOA 2NVYA 3GTGA 2B63A 2WB1A 4C2MA 2YU9A 2R92A 1I3QA 1YNJD 1I6VD 1TWCA 3HKZA 1I50A 1TWAA 2PMZA 3H0GA 2E2HA 2A69D
chains in the Genus database with same CATH superfamily
2F4QA 4PD1A 3GTQA 3EZEA 2WAQA 2R7ZA 5JSNB 1EJ9A 1K4SA 2NQNA 1SEUA 4Q5GA 2E2IA 2NQRA 1HQMD 1ZYRD 3M4AA 1Y698 2FIPA 1K83A 1G8RA 2NQKA 4NWBA 4GFQA 5JSBB 1FC5A 1SFOA 1IW7D 2K3NA 5ERQA 5ERRA 2JA5A 1Y1VA 1TWHA 2VUMA 3K58A 1W27A 4KB2A 1LPQA 2EZBA 1WCMA 2NQSA 3SJRA 4U90A 4V2QA 3P9AA 2YU9A 2R92A 2LPIA 4NOLA 4FYDA 4FXDA 1I3QA 4IP9A 1R49A 1A31A 1A35A 1TWAA 3LF9A 2PMZA 4EJ3A 3NZ4A 3H0GA 2E2HA 2A69D 3FKIA 3CQZA 1YNND 4NOMA 1T8IA 4CEJA 4CEHA 1IS1A 3DU6A 1TWGA 1K4TA 2X3LA 3GTLA 4AYBA 1EZAA 2Y0NA 2JA6A 3WVOA 3GTPA 4TK3A 4FBSA 5ERTA 1V9MA 1RR8C 4QCLA 4KDDA 2K3OA 1WU2A 4H3TA 1Y2MA 1Q8IA 4JLRC 3K5OA 2K3QA 3K5NA 5ERVA 5D6GA 3GTOA 5D8HB 4BAAA 1ZYMA 1XI8A 3KYLA 2LYIA 4NOKA 1TGOA 2AQLA 4AN8A 4BABA 1A36A 3IAYA 2X0PA 1YNJD 1I6VD 2LKMB 2YIIA 2N1DB 5C9HA 2EZCA 5CQGA 3K59A 4O26A 1GE9A 5G2SA 1WQGA 3K5MA 1EZBA 2Y0SA 5MLC9 1ISEA 2MX8A 3MAQA 2NQVA 4LMOA 3GTMA 2CW0D 4D3ZA 3LRDA 3U4QA 4C5SA 1Y1WA 1MIUA 2LPJA 1TL8A 2X0OA 2NRSA 1TWFA 3GTJA 3DU5A 2NVXA 4C5UA 2B9SB 5ERSA 4F3EA 4Q5VA 1T3EA 2F5JA 1T6JA 2HROA 1RRJA 2NVYA 2NRPA 2B63A 1R5ZA 2MX9A 5ERUA 2EZAA 3K57A 2LTHA 1EK8A 2MP0A 4TK1A 3JSYA 4KC6A 1G8LA 1SMYD 2A68D 2A6HD 1NH3A 2VK9A 3EZAA 1R9TA 1SC7A 2JA7A 4CQ5A 2NQQA 4OYDB 2HWGA 4KB4A 4V2RA 4FGUA 1EH1A 3LR2A 2FU3A 2BE5D 4PD0A 4AHCA 3EZBA 1T6PA 2A6ED 1WQHA 2NROA 2R93A 2O5JD 4QIWA 4C6GA 2FTSA 2MQAA 2NQUA 4KAWX 2FIOA 3GTKA 1DD5A 1WQFA 5IZ2A 3K5LA 3U44A 4TK4A 4U91A 4CEIA 2N3EA 3GTGA 2NQMA 4D3YA 3LHPS 2WB1A 4C2MA 4L8IA 5G2RA 4IP8A 1TWCA 3HKZA 1I50A 2R4GA 3LR8A 2X0QA 3LR6A 4C5RA 1UZ5A
chains in the Genus database with same CATH topology
2F4QA 4PD1A 3GTQA 2WAQA 2R7ZA 5JSNB 1EJ9A 1K4SA 2NQNA 1SEUA 4Q5GA 2E2IA 2NQRA 1HQMD 1ZYRD 3M4AA 1Y698 2FIPA 1K83A 1G8RA 2NQKA 4NWBA 4GFQA 5JSBB 1FC5A 1SFOA 1IW7D 2K3NA 5ERQA 5ERRA 2JA5A 1Y1VA 1TWHA 2VUMA 3K58A 4KB2A 1LPQA 1WCMA 2NQSA 3SJRA 4U90A 3P9AA 2YU9A 2R92A 2LPIA 4NOLA 4FYDA 4FXDA 1I3QA 4IP9A 1R49A 1A31A 1A35A 1TWAA 3LF9A 2PMZA 4EJ3A 3H0GA 2E2HA 2A69D 3FKIA 3CQZA 1YNND 4NOMA 1T8IA 4CEJA 4CEHA 1IS1A 3DU6A 1TWGA 1K4TA 2X3LA 3GTLA 4AYBA 2Y0NA 2JA6A 3WVOA 3GTPA 4TK3A 4FBSA 5ERTA 1V9MA 1RR8C 4QCLA 4KDDA 2K3OA 1WU2A 4H3TA 1Q8IA 4JLRC 3K5OA 2K3QA 3K5NA 5ERVA 5D6GA 3GTOA 5D8HB 1XI8A 3KYLA 2LYIA 4NOKA 1TGOA 2AQLA 4AN8A 1A36A 3IAYA 2X0PA 1YNJD 1I6VD 2LKMB 2N1DB 5C9HA 5CQGA 3K59A 4O26A 1GE9A 5G2SA 1WQGA 3K5MA 2Y0SA 5MLC9 1ISEA 2MX8A 3MAQA 2NQVA 4LMOA 3GTMA 2CW0D 4D3ZA 3LRDA 3U4QA 1Y1WA 1MIUA 2LPJA 1TL8A 2X0OA 2NRSA 1TWFA 3GTJA 3DU5A 2NVXA 2B9SB 5ERSA 4F3EA 4Q5VA 1T3EA 2F5JA 2NRPA 1RRJA 2NVYA 2B63A 1R5ZA 2MX9A 3K57A 2LTHA 1EK8A 4TK1A 3JSYA 4KC6A 1G8LA 1SMYD 2A68D 2A6HD 1NH3A 2VK9A 1R9TA 1SC7A 2JA7A 2NQQA 4OYDB 4KB4A 4FGUA 1EH1A 3LR2A 2FU3A 2BE5D 4PD0A 4AHCA 2A6ED 1WQHA 2NROA 2R93A 2O5JD 4QIWA 2FTSA 2MQAA 2NQUA 4KAWX 2FIOA 3GTKA 1DD5A 1WQFA 5IZ2A 3K5LA 3U44A 4TK4A 4U91A 4CEIA 2N3EA 3GTGA 2NQMA 4D3YA 3LHPS 2WB1A 4C2MA 4L8IA 5G2RA 4IP8A 1TWCA 3HKZA 1I50A 2R4GA 3LR8A 2X0QA 3LR6A 5ERUA 1UZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMY D;  2A68 D;  2A6H D;  3FKI A;  3GTQ A;  2WAQ A;  2R7Z A;  2Y0S A;  3CQZ A;  1YNN D;  1R9T A;  2JA7 A;  2E2I A;  1HQM D;  1ZYR D;  3GTM A;  1K83 A;  2BE5 D;  1TWG A;  2CW0 D;  3GTL A;  2A6E D;  4AYB A;  1SFO A;  3GTP A;  2JA6 A;  1Y1W A;  1IW7 D;  2R93 A;  2O5J D;  4QIW A;  1TWF A;  3GTJ A;  3GTK A;  2NVX A;  2JA5 A;  1Y1V A;  1TWH A;  2VUM A;  1WCM A;  3GTO A;  2NVY A;  3GTG A;  2B63 A;  2WB1 A;  4C2M A;  2YU9 A;  2R92 A;  1I3Q A;  1YNJ D;  1I6V D;  1TWC A;  3HKZ A;  1I50 A;  1TWA A;  2PMZ A;  3H0G A;  2E2H A;  2A69 D; 
#chains in the Genus database with same CATH topology
 2F4Q A;  4PD1 A;  3GTQ A;  3EZE A;  2WAQ A;  2R7Z A;  5JSN B;  1EJ9 A;  1K4S A;  2NQN A;  1SEU A;  4Q5G A;  2E2I A;  2NQR A;  1HQM D;  1ZYR D;  3M4A A;  1Y69 8;  2FIP A;  1K83 A;  1G8R A;  2NQK A;  4NWB A;  4GFQ A;  5JSB B;  1FC5 A;  1SFO A;  1IW7 D;  2K3N A;  5ERQ A;  5ERR A;  2JA5 A;  1Y1V A;  1TWH A;  2VUM A;  3K58 A;  1W27 A;  4KB2 A;  1LPQ A;  2EZB A;  1WCM A;  2NQS A;  3SJR A;  4U90 A;  4V2Q A;  3P9A A;  2YU9 A;  2R92 A;  2LPI A;  4NOL A;  4FYD A;  4FXD A;  1I3Q A;  4IP9 A;  1R49 A;  1A31 A;  1A35 A;  1TWA A;  3LF9 A;  2PMZ A;  4EJ3 A;  3NZ4 A;  3H0G A;  2E2H A;  2A69 D;  3FKI A;  3CQZ A;  1YNN D;  4NOM A;  1T8I A;  4CEJ A;  4CEH A;  1IS1 A;  3DU6 A;  1TWG A;  1K4T A;  2X3L A;  3GTL A;  4AYB A;  1EZA A;  2Y0N A;  2JA6 A;  3WVO A;  3GTP A;  4TK3 A;  4FBS A;  5ERT A;  1V9M A;  1RR8 C;  4QCL A;  4KDD A;  2K3O A;  1WU2 A;  4H3T A;  1Y2M A;  1Q8I A;  4JLR C;  3K5O A;  2K3Q A;  3K5N A;  5ERV A;  5D6G A;  3GTO A;  5D8H B;  4BAA A;  1ZYM A;  1XI8 A;  3KYL A;  2LYI A;  4NOK A;  1TGO A;  2AQL A;  4AN8 A;  4BAB A;  1A36 A;  3IAY A;  2X0P A;  1YNJ D;  1I6V D;  2LKM B;  2YII A;  2N1D B;  5C9H A;  2EZC A;  5CQG A;  3K59 A;  4O26 A;  1GE9 A;  5G2S A;  1WQG A;  3K5M A;  1EZB A;  2Y0S A;  5MLC 9;  1ISE A;  2MX8 A;  3MAQ A;  2NQV A;  4LMO A;  3GTM A;  2CW0 D;  4D3Z A;  3LRD A;  3U4Q A;  4C5S A;  1Y1W A;  1MIU A;  2LPJ A;  1TL8 A;  2X0O A;  2NRS A;  1TWF A;  3GTJ A;  3DU5 A;  2NVX A;  4C5U A;  2B9S B;  5ERS A;  4F3E A;  4Q5V A;  1T3E A;  2F5J A;  1T6J A;  2HRO A;  1RRJ A;  2NVY A;  2NRP A;  2B63 A;  1R5Z A;  2MX9 A;  5ERU A;  2EZA A;  3K57 A;  2LTH A;  1EK8 A;  2MP0 A;  4TK1 A;  3JSY A;  4KC6 A;  1G8L A;  1SMY D;  2A68 D;  2A6H D;  1NH3 A;  2VK9 A;  3EZA A;  1R9T A;  1SC7 A;  2JA7 A;  4CQ5 A;  2NQQ A;  4OYD B;  2HWG A;  4KB4 A;  4V2R A;  4FGU A;  1EH1 A;  3LR2 A;  2FU3 A;  2BE5 D;  4PD0 A;  4AHC A;  3EZB A;  1T6P A;  2A6E D;  1WQH A;  2NRO A;  2R93 A;  2O5J D;  4QIW A;  4C6G A;  2FTS A;  2MQA A;  2NQU A;  4KAW X;  2FIO A;  3GTK A;  1DD5 A;  1WQF A;  5IZ2 A;  3K5L A;  3U44 A;  4TK4 A;  4U91 A;  4CEI A;  2N3E A;  3GTG A;  2NQM A;  4D3Y A;  3LHP S;  2WB1 A;  4C2M A;  4L8I A;  5G2R A;  4IP8 A;  1TWC A;  3HKZ A;  1I50 A;  2R4G A;  3LR8 A;  2X0Q A;  3LR6 A;  4C5R A;  1UZ5 A; 
#chains in the Genus database with same CATH homology
 2F4Q A;  4PD1 A;  3GTQ A;  2WAQ A;  2R7Z A;  5JSN B;  1EJ9 A;  1K4S A;  2NQN A;  1SEU A;  4Q5G A;  2E2I A;  2NQR A;  1HQM D;  1ZYR D;  3M4A A;  1Y69 8;  2FIP A;  1K83 A;  1G8R A;  2NQK A;  4NWB A;  4GFQ A;  5JSB B;  1FC5 A;  1SFO A;  1IW7 D;  2K3N A;  5ERQ A;  5ERR A;  2JA5 A;  1Y1V A;  1TWH A;  2VUM A;  3K58 A;  4KB2 A;  1LPQ A;  1WCM A;  2NQS A;  3SJR A;  4U90 A;  3P9A A;  2YU9 A;  2R92 A;  2LPI A;  4NOL A;  4FYD A;  4FXD A;  1I3Q A;  4IP9 A;  1R49 A;  1A31 A;  1A35 A;  1TWA A;  3LF9 A;  2PMZ A;  4EJ3 A;  3H0G A;  2E2H A;  2A69 D;  3FKI A;  3CQZ A;  1YNN D;  4NOM A;  1T8I A;  4CEJ A;  4CEH A;  1IS1 A;  3DU6 A;  1TWG A;  1K4T A;  2X3L A;  3GTL A;  4AYB A;  2Y0N A;  2JA6 A;  3WVO A;  3GTP A;  4TK3 A;  4FBS A;  5ERT A;  1V9M A;  1RR8 C;  4QCL A;  4KDD A;  2K3O A;  1WU2 A;  4H3T A;  1Q8I A;  4JLR C;  3K5O A;  2K3Q A;  3K5N A;  5ERV A;  5D6G A;  3GTO A;  5D8H B;  1XI8 A;  3KYL A;  2LYI A;  4NOK A;  1TGO A;  2AQL A;  4AN8 A;  1A36 A;  3IAY A;  2X0P A;  1YNJ D;  1I6V D;  2LKM B;  2N1D B;  5C9H A;  5CQG A;  3K59 A;  4O26 A;  1GE9 A;  5G2S A;  1WQG A;  3K5M A;  2Y0S A;  5MLC 9;  1ISE A;  2MX8 A;  3MAQ A;  2NQV A;  4LMO A;  3GTM A;  2CW0 D;  4D3Z A;  3LRD A;  3U4Q A;  1Y1W A;  1MIU A;  2LPJ A;  1TL8 A;  2X0O A;  2NRS A;  1TWF A;  3GTJ A;  3DU5 A;  2NVX A;  2B9S B;  5ERS A;  4F3E A;  4Q5V A;  1T3E A;  2F5J A;  2NRP A;  1RRJ A;  2NVY A;  2B63 A;  1R5Z A;  2MX9 A;  3K57 A;  2LTH A;  1EK8 A;  4TK1 A;  3JSY A;  4KC6 A;  1G8L A;  1SMY D;  2A68 D;  2A6H D;  1NH3 A;  2VK9 A;  1R9T A;  1SC7 A;  2JA7 A;  2NQQ A;  4OYD B;  4KB4 A;  4FGU A;  1EH1 A;  3LR2 A;  2FU3 A;  2BE5 D;  4PD0 A;  4AHC A;  2A6E D;  1WQH A;  2NRO A;  2R93 A;  2O5J D;  4QIW A;  2FTS A;  2MQA A;  2NQU A;  4KAW X;  2FIO A;  3GTK A;  1DD5 A;  1WQF A;  5IZ2 A;  3K5L A;  3U44 A;  4TK4 A;  4U91 A;  4CEI A;  2N3E A;  3GTG A;  2NQM A;  4D3Y A;  3LHP S;  2WB1 A;  4C2M A;  4L8I A;  5G2R A;  4IP8 A;  1TWC A;  3HKZ A;  1I50 A;  2R4G A;  3LR8 A;  2X0Q A;  3LR6 A;  5ERU A;  1UZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...