The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
197
|
structure length |
197
|
Chain Sequence |
AEIPLFPLSNALFPAGVLRLRVFEIRYLDMVRRCIADGSEFGVVVLEQGTEVRRPDGREVLARAGTMARIDHWEAPMPALLELACTGTGRFRLHACTQGKYGLWTGQAEPVPDDAPLEVPPELARSASALGRLIARLQREGVPPHIMPMAAPFRLDDCGWVADRWAEMLSLPPADKARLLLLPPLDRLREIDAVLAA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of the Hypothetical Protein BPP1347 from Bordetella parapertussis, Northeast Structural Genomics Target BoR27.
rcsb |
| molecule keywords |
hypothetical protein BPP1347
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Bordetella parapertussis
|
| total genus |
45
|
| structure length |
197
|
| sequence length |
197
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2005-04-08 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02190 | LON_substr_bdg | ATP-dependent protease La (LON) substrate-binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | LON domain-like fold | BPP1347 like domain | ||
| Mainly Beta | Roll | Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 | LON domain-like |
#chains in the Genus database with same CATH superfamily 3LJC A; 4CI1 B; 4CI2 B; 1ZBO A; 4CI3 B; 4TZ4 C; 2ANE A; 3M65 A; #chains in the Genus database with same CATH topology 1ZS7 A; 2J5T A; 4DMG A; 2RFK A; 3LWV A; 3M4X A; 3M6X A; 3LWP A; 3HAX A; 1TE7 A; 1ZE1 A; 2DP9 A; 1WXX A; 2FRX A; 3U28 A; 3MQK A; 3ZV0 C; 2APO A; 1R3F A; 1ZE2 A; 3C0K A; 4CI1 B; 1J2B A; 2HVY A; 1Q7H A; 3HJY A; 1IT8 A; 1K8W A; 1UOY A; 3IUW A; 3M6V A; 1WXW A; 3UAI A; 1IT7 A; 2B78 A; 3M65 A; 2CWW A; 2AS0 A; 3M6U A; 3LWR A; 3LWO A; 4CI2 B; 2CX1 A; 1ZBO A; 1SQW A; 2Z0T A; 2Q07 A; 3VSE A; 4CI3 B; 1S04 A; 2AB4 A; 2P38 A; 3D79 A; 1ZL3 A; 2EY4 A; 2KKU A; 2CX0 A; 2J5V A; 3LJC A; 3M6W A; 2E5O A; 1SGV A; 1WK2 A; 2AUS A; 1T5Y A; 3LWQ A; 3LDF A; 1XNE A; 1IQ8 A; 2ANE A; 4TZ4 C; 1R3E A; 3HJW A; 4Q1T A; #chains in the Genus database with same CATH homology 3LJC A; 4CI1 B; 4CI2 B; 1ZBO A; 4CI3 B; 4TZ4 C; 2ANE A; 3M65 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...