The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
110
|
structure length |
110
|
Chain Sequence |
RIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMDHDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALSDNGEHFSAKAEYL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of the N-terminal domain of E. coli Lon protease.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Escherichia coli
|
| molecule keywords |
ATP-dependent protease La
|
| total genus |
27
|
| structure length |
110
|
| sequence length |
110
|
| chains with identical sequence |
B, C, D, E, F, G, H
|
| ec nomenclature |
ec
3.4.21.53: Endopeptidase La. |
| pdb deposition date | 2005-08-11 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 | LON domain-like |
#chains in the Genus database with same CATH superfamily 1ZBO A; 4TZ4 C; 4CI3 B; 4CI1 B; 2ANE A; 4CI2 B; 3M65 A; 3LJC A; #chains in the Genus database with same CATH topology 3HJW A; 3UAI A; 3D79 A; 2KKU A; 3IUW A; 3M6X A; 3LWO A; 1WXW A; 1IT8 A; 1UOY A; 2Z0T A; 1SGV A; 1ZBO A; 3U28 A; 3LWQ A; 2E5O A; 4DMG A; 3LWR A; 2HVY A; 3M6V A; 4CI3 B; 4CI1 B; 2ANE A; 2AB4 A; 3M4X A; 1IQ8 A; 1WXX A; 2EY4 A; 1ZS7 A; 2APO A; 3C0K A; 3M65 A; 3M6W A; 1ZE2 A; 3LJC A; 1ZL3 A; 2RFK A; 2J5V A; 2P38 A; 4TZ4 C; 3LWP A; 1R3E A; 1XNE A; 3M6U A; 1J2B A; 1TE7 A; 2B78 A; 2Q07 A; 3LDF A; 1Q7H A; 3LWV A; 3MQK A; 3HAX A; 1K8W A; 2AS0 A; 1IT7 A; 1R3F A; 1WK2 A; 2CX0 A; 2J5T A; 3VSE A; 2AUS A; 4Q1T A; 2FRX A; 3ZV0 C; 1SQW A; 1ZE1 A; 4CI2 B; 2CWW A; 1T5Y A; 3HJY A; 2CX1 A; 1S04 A; 2DP9 A; #chains in the Genus database with same CATH homology 1ZBO A; 4TZ4 C; 4CI3 B; 4CI1 B; 2ANE A; 4CI2 B; 3M65 A; 3LJC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
