3FN1A

E2-ring expansion of the nedd8 cascade confers specificity to cullin modification.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
PQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYMQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8-activating enzyme E1 catalytic subunit
publication title E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08825 E2_bind E2 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 3fn1A00
2NVUB 3FN1A 2LQ7A 3ONGA 1Y8QB 4W5VB 3ONHA 3KYCB 1Y8XB 5FQ2B 3KYDB 1Y8RB
chains in the Genus database with same CATH superfamily
2K6PA 1P9KA 4DV1D 1N33D 4DR3D 4LF5D 1XNRD 1HNWD 4DR2D 4LFBD 4W5VB 2NVUB 3J80E 1KSKA 3T1HD 4YHHD 4JV5D 5IT9E 4X65D 4NNJA 2UUBD 1FKAD 3ONHA 5KNLA 2UXBD 3T1YD 1I94D 3KBGA 5FLXE 4LGTA 3JAME 4JI0D 4JI3D 2KTLA 4KHPD 4DV6D 3J7AF 1H3EA 5IWAD 4JYAD 1FJGD 1JH3A 1Y8XB 1DM9A 1C06A 4II2A 2VQED 4JI2D 1N36D 4JI4D 1VIOA 2LQ7A 3ONGA 4LF4D 1Y8QB 4JI1D 4II3A 2VQFD 4B3SD 2HHHD 4B3RD 1N34D 4NXMD 2UUAD 2ZM6D 4AQYD 4DUYD 3KYDB 1IBMD 1Y8RB 4LFAD 5BR8D 1C05A 2JANA 1XMOD 4YY3D 1HNXD 4DV2D 4LF7D 4DV4D 4LF6D 2I1SA 4DR7D 1XMQD 3FN1A 1J5ED 2UXDD 4DV5D 1IBLD 4DR4D 5A2QE 4GKJD 5LMND 1HNZD 4B3MD 4DR6D 4DV0D 1KSLA 4JI6D 2F4VD 1N32D 4X64D 4DV3D 5LMUD 4NXND 4JI5D 4GKKD 4X66D 4LF8D 4DUZD 4DV7D 1XNQD 2ZTBA 4DR1D 4OUDA 1KSVA 1HR0D 4JI7D 3CMMA 4DR5D 2E5LD 5LL6S 5FQ2B 4JI8D 2UU9D 2UXCD 2ISTA 3DH3A 4LF9D 4K0KD 2UUCD 1IBKD 4X62D 1H3FA 4B3TD 3HP7A 3OTOD 3KYCB 4OX9D 4LFCD 3J81E
chains in the Genus database with same CATH topology
2NVUB 3FN1A 2LQ7A 3ONGA 1Y8QB 4W5VB 3ONHA 3KYCB 1Y8XB 5FQ2B 3KYDB 1Y8RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVU B;  3FN1 A;  2LQ7 A;  3ONG A;  1Y8Q B;  4W5V B;  3ONH A;  3KYC B;  1Y8X B;  5FQ2 B;  3KYD B;  1Y8R B; 
#chains in the Genus database with same CATH topology
 2K6P A;  1P9K A;  4DV1 D;  1N33 D;  4DR3 D;  4LF5 D;  1XNR D;  1HNW D;  4DR2 D;  4LFB D;  4W5V B;  2NVU B;  3J80 E;  1KSK A;  3T1H D;  4YHH D;  4JV5 D;  5IT9 E;  4X65 D;  4NNJ A;  2UUB D;  1FKA D;  3ONH A;  5KNL A;  2UXB D;  3T1Y D;  1I94 D;  3KBG A;  5FLX E;  4LGT A;  3JAM E;  4JI0 D;  4JI3 D;  2KTL A;  4KHP D;  4DV6 D;  3J7A F;  1H3E A;  5IWA D;  4JYA D;  1FJG D;  1JH3 A;  1Y8X B;  1DM9 A;  1C06 A;  4II2 A;  2VQE D;  4JI2 D;  1N36 D;  4JI4 D;  1VIO A;  2LQ7 A;  3ONG A;  4LF4 D;  1Y8Q B;  4JI1 D;  4II3 A;  2VQF D;  4B3S D;  2HHH D;  4B3R D;  1N34 D;  4NXM D;  2UUA D;  2ZM6 D;  4AQY D;  4DUY D;  3KYD B;  1IBM D;  1Y8R B;  4LFA D;  5BR8 D;  1C05 A;  2JAN A;  1XMO D;  4YY3 D;  1HNX D;  4DV2 D;  4LF7 D;  4DV4 D;  4LF6 D;  2I1S A;  4DR7 D;  1XMQ D;  3FN1 A;  1J5E D;  2UXD D;  4DV5 D;  1IBL D;  4DR4 D;  5A2Q E;  4GKJ D;  5LMN D;  1HNZ D;  4B3M D;  4DR6 D;  4DV0 D;  1KSL A;  4JI6 D;  2F4V D;  1N32 D;  4X64 D;  4DV3 D;  5LMU D;  4NXN D;  4JI5 D;  4GKK D;  4X66 D;  4LF8 D;  4DUZ D;  4DV7 D;  1XNQ D;  2ZTB A;  4DR1 D;  4OUD A;  1KSV A;  1HR0 D;  4JI7 D;  3CMM A;  4DR5 D;  2E5L D;  5LL6 S;  5FQ2 B;  4JI8 D;  2UU9 D;  2UXC D;  2IST A;  3DH3 A;  4LF9 D;  4K0K D;  2UUC D;  1IBK D;  4X62 D;  1H3F A;  4B3T D;  3HP7 A;  3OTO D;  3KYC B;  4OX9 D;  4LFC D;  3J81 E; 
#chains in the Genus database with same CATH homology
 2NVU B;  3FN1 A;  2LQ7 A;  3ONG A;  1Y8Q B;  4W5V B;  3ONH A;  3KYC B;  1Y8X B;  5FQ2 B;  3KYD B;  1Y8R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...