5FLXE

Mammalian 40s hcv-ires complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
257
structure length
257
Chain Sequence
ARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S RRNA
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 36
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00467 KOW KOW motif
E PF00900 Ribosomal_S4e Ribosomal family S4e
E PF08071 RS4NT RS4NT (NUC023) domain
E PF16121 40S_S4_C 40S ribosomal protein S4 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5flxE03
2.40.50.740 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5flxE02
3.10.290.40 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A 5flxE01
2JUFA 1UEBA 1XNIA 3CC2A 2L3RA 3ER0A 5A2QE 1JJ2A 3CC2T 3OW2A 1W2BS 1K73U 1Q81C 4CRIA 1Q86U 3J80E 1VQ8T 3CCQA 2MWPA 1KQSS 1VQMA 1VQKA 5IAYA 3CCMT 1VQMT 2MWOA 1N8RC 4YTLA 3HKSA 1VQNA 1N8RU 2MI6A 1YIJA 2XHCA 3PIOA 1YJ9T 1EIFA 1YIJT 3CCVA 2JOYA 2LCLA 3DB3A 2OTLA 4X34A 3JAME 2QA4A 2KVQG 3KBGA 1S72T 1X6OA 5DM7R 3TREA 3CPWA 1K73C 1KD1U 1NPPA 1VQPT 1Q7YC 1BKBA 3J81E 1Q86C 1Q7YU 1KHIA 1W2BA 1NJIC 2OTJA 1VQ8A 5J3BA 3J7AF 2OTJT 2IG0A 3LGLA 3G4SA 1YJWT 1Q82C 1NJIU 3CCUA 1VQ5A 3G4ST 3CMAA 3CCMA 1KQSA 1VQ5T 1Q82U 3CMAT 2E70A 2KDSA 3CMEA 1VQ7A 3CMET 1YJ9A 3CC4A 2G3RA 1SSFA 3PIPA 3CC4T 1VQ7T 5J26A 3DLLA 3CD6T 1VQLA 3CCRA 1M1KU 1VQLT 3CCJT 3CCRT 3CCEA 1VQOT 1QVGS 1S72A 3CCET 1YBYA 3CC7A 1VQ9T 3A5ZB 3CC7T 1K9MU 1KD1C 1QVFS 1VQ4T 1VQPA 3CCLA 2DO3A 3CCLT 1YJWA 3CPFA 3I55T 3G6ET 5LL6S 2JVVA 1XTDA 1RL2A 3LH0A 3P8BB 2EIFA 5FLXE 4ZN3A 1M1GA 3CXCS 3CD6A 1YI2T 2QEXA 1YJNA 1M1KC 2QA4T 1M90U 2QEXT 3CCUT 1YJNT 3CCSA 1VQ6A 3CCJA 1VQ6T 3CCST 1JJ2S 1VQOA 1IZ6A 2JNGA 3CPWS 3OW2S 1VQ9A 1K8AC 1K9MC 1QVGA 3G71A 3I56A 1K8AU 3G71T 1VQ4A 3I56T 1QVFA 4TVRA 5IT9E 1Q81U 1YHQA 3LGFA 3CCQT 1YHQT 4RG2A 3I55A 1VQKT 3G6EA 2LVMA 5HY6A 4ZN1A 1YITA 1NPRA 1YITT 1VQNT 3DB4A 1KC8C 3OYYA 2LQ8A 3CCVT 1KC8U 2E6ZA 1NZ9A 1YI2A 5DLQE 1M90C 2CKKA 3CXCA 2OTLT 4QQDA
chains in the Genus database with same CATH superfamily
2JUFA 4JRKA 2IX0A 4CBVA 1AEYA 4BBRB 5BN5A 3VA7A 4X64L 4JI6L 3SK8A 4LF7Q 1WHKA 4WJ4A 1V9PA 2RHSB 1S3OA 2XNAC 1A3VA 1PD1A 2JS2A 3SWNC 3PTAA 1STAA 4ORZA 1KSLA 4QQ6A 2HHHQ 4BE2A 4J9FA 2IWHA 1K73U 4M77C 1NTGA 3MP1A 2YDLA 3EA6A 4UP7A 5LJ5g 4ZUIA 1KAWA 3NMZC 1N34L 2E2JB 1JBMA 3J80c 4OWXB 1W3SA 3PGZA 4X66Q 2DRKA 1X9NA 3EGXB 4M7AF 1IXDA 4JI5D 5FRMA 3BZKA 4A3BB 4XQJA 2XHCA 5LJ5d 3M55A 1DOLA 1EIFA 2K14A 2NB0A 3H3VC 1JORA 3TEHB 5KNDA 5ISRA 2RB6A 1VQ7Q 1MUZA 4LF9Q 1VIOA 2KENA 4IPHA 2OQKA 3MP8A 3D4RA 4DV7Q 4NXNL 3S1NB 4O1NA 1VA7A 5CBAE 4PLLA 1EU3A 2Z4HA 5IYBH 5GAN8 1NM7A 2ICIA 3FKIG 4F7UF 5M3MG 4UAIA 2QTXA 4J9GA 1SYFA 3PUYA 3MKDA 3J7AF 3GTGB 3I4NB 4POFA 3STBC 4K0KQ 1WDXA 4IO9A 1NJIR 2NVTH 1KFZA 1GRIA 2WAQG 3CMAT 1PYSB 5GAOn 1N33D 1XPRA 2E5LD 3B6YA 2E3IA 2N49A 3OSOA 1SHGA 3TP5A 3M59A 4FT4A 3W3AA 4FYDA 3P20A 1RJTA 4JI8L 5CCAA 4J6WA 4GLAC 2B86A 3M5AA 3ITPA 3NHHA 4DBRA 4XU2A 2DXUA 2WB1B 4L5RC 3S2DB 5C3EG 2PI2E 4M7DB 1GD7A 1JICA 1VQ6Q 5DY9A 1WCMB 4J7FA 1GUSA 1I3QB 2XICA 4ZRZA 3T53B 4C56C 4IURA 1FYCA 1Z7TA 4JI0Q 2DO3A 3LH5A 4JZ3A 4C1NK 2RA2A 2VGNA 1B7YB 2LT1A 3J80L 2G5DA 3G7LA 4QGUA 4HEDA 3V2TA 3P8BB 2RHQB 1PHTA 3GTOH 1U9RA 1UUEA 1A2UA 4C3JB 1WX6A 2I07B 3PUZA 1O9SA 3OA6A 3KFUA 2VASA 4G7HC 1ICFB 4ZCKA 2KUMA 3JCMd 1XMQL 1ZQ1A 3CCJA 2OTLQ 4LF6Q 3DWAA 1WTHA 2ZTBA 1VQBA 1CQFA 1QVGA 3PUWA 3CC2Q 1E6HA 1A63A 2WKDA 2AUKA 2R93G 1K8AR 1U5KA 2YU9B 2R5MA 4II1A 1EY5A 2I5LX 2RK2A 5E4XA 1GL5A 1TXQA 3CCQT 1SYDA 2LNHB 3MCAB 3MEUA 2ICEC 4ZYSA 2NVYH 5KGUA 1JC7A 5ELDA 1X6GA 1BQQT 1H641 5I2SA 4GZYC 2PUOB 5E3FA 4A3BG 1IBKL 2FYKA 2UXCL 2RH2A 3E19A 1YCSB 1PRTF 4HCEA 5EPJA 2D8HA 2A73B 1STHA 1JEGA 2A68C 4V190 3T56B 3OYAA 4M7AD 4DR3D 3HOWG 5I11A 2KHSA 3PO2H 1WOCA 3FN1A 3OYYA 2KBNA 3W1BA 1OEBA 5GANh 2I1SA 4LGTA 5LJ5j 4AYBE 1UEBA 4OF1A 1D3BB 3VYUA 4A3DG 2K5LA 1JU5C 2BZYA 1QMCA 2K03A 3OYBA 1Y14B 4LFCL 2B8AA 3CKIB 4EGVA 2CZ7B 1WTQA 4POGA 1ZSZA 3E6ZX 1D7QA 3J7ZC 2CS7A 4J6YA 2DMOA 5CQYA 3RN5A 3BVGA 1EYAA 2EGEA 2CSQA 1Y69U 3KK7A 5C4XB 1R8OB 1H9KA 4HTHA 4KKTA 4GOPB 3X25B 4DN4M 2PU9B 1VQMT 4QW2A 1TWFH 2ZXPA 4PZ8A 3OTOQ 3S15B 4H44C 1NYFA 2G6FX 3JCMP 1CKBA 2WACA 9ATCB 1Y8QB 4ODGA 2FFKB 3P8HA 1H8KA 4CDEC 2ZPEB 2OWOA 4N4IA 1BCPC 3KLSX 3SXHA 2L55A 2ZT9C 5IWAQ 3QKJA 3A54A 3D3RA 3C1FA 2DUDA 1I81A 1M4VA 4HXJA 2JA7H 2K5WA 2EBPA 2NLUA 2RQVA 4PFZA 5IP7G 4JV5L 3META 3RLFA 1QCOA 1UTIA 1ZLMA 5KYXA 2D0NA 1X3QA 2L9HA 4JVZA 3PMIA 1J3TA 1TWAB 1LCKA 4LNPA 1K8GA 5KH6A 4E7LA 2UXDL 4B3TD 2VB6A 2N78A 4WORA 4JS4A 1VQ5T 3P8DA 1C0MA 4M77F 4C3JG 3S14H 2CDTA 4B3RD 2KCMA 1R9TB 4A53A 1E7OA 1E7ZA 2GTJA 1DXMA 4HMJA 4M7AB 1Y96A 4A4IA 2HBPA 2A74C 2JZ2A 4C8QA 2DNCA 2Z6KC 3CCRA 2M2LA 3M7NA 3DXJC 4I7ZC 2QA4Q 3ZL7C 2KROA 1PZKD 1YCYA 4L5GA 5HKCA 2JYOA 2XWJB 4P71A 4OB3B 3MP6A 4KD3A 4NB3A 4LF5Q 5LJ3h 4EMKA 4B3MQ 2PZTA 1CA6A 3GTKH 1XJWB 3DM3A 3A5UA 4ZLTF 4LN2A 2ECZA 4TRDA 4DR4L 4YHHL 4VUBA 3OMGA 4F7UB 2KQ3A 5LL6S 1XNQD 4KHPQ 2FPEA 3PV0A 1WYXA 2B2YC 3DWQA 3K5NA 1GUGA 4CKCA 2D9UA 1KDBA 2R3ZA 2BIVA 4R4QA 4FXGC 1NR4A 4AT1B 1T5XD 4A4GA 4OO1I 4EQOA 1PRTD 4JRQA 1F1BB 3S9WA 1WHGA 4L63B 3HOYB 2PMZE 3UF4A 5LJ5e 4N0AC 4DA4A 3OYEA 1KDAA 4JJCA 4RG8A 5FO7B 2CKZB 2JNGA 2H8HA 3A8OB 4FF3A 4U68A 3GIBA 1YEZA 3K7UC 1AE3A 1JXMA 3ZJYC 1GUWA 3Q22A 1F9SA 2A0FB 1Q12A 4ANJA 3HZXA 2FZKB 3QO3A 4EMHA 5C3XA 1DOKA 5C4XG 2L2PA 1JWUD 1YN8A 3FEOA 4JCVE 1PH6A 4IZ8A 4DXGA 2DK3A 5FOBB 2HQHA 1QUQB 2NN6G 2VUMB 2DA9A 2DIGA 1G3SA 3HOXG 3DEPA 5EAYA 4A54A 1V76A 1KK7A 3MWYW 4JYAD 1NNXA 2K5QA 5HCKA 1YJ9Q 4JDSA 1TWGH 5CV8A 3H41A 2GTOA 1Q95G 4J8OA 4N4GA 2LKVA 3ND8A 5ELBA 3W5OA 3OBWA 1EYCA 2JTMA 3JCMW 1GCQC 3OW2A 1YNZA 4MDWA 1BR9A 1VQAA 4DR6L 4DR5D 2AQ1B 4M75E 3L2UA 3RZDB 1UG1A 2ZCFB 4F17A 2HZYA 1WNLA 5M5XH 4M78F 1HNZD 1Q81R 3C95A 2CP7A 3U9OA 1WIEA 4DV6Q 4OGEA 3LGJA 2PNRC 1SN8A 2RJCA 1HA5A 1C6VX 4A93H 1O7YA 4DUZQ 1QP3A 1TVXA 4M77D 4EX5A 3DUZA 4CJ0B 1V1CA 1PRTB 2O4XA 1XXGA 4CKBA 1OU8A 1CKNA 1ILQA 4L5TA 1N36Q 4DV2D 5EBCA 2B2UA 1U4MA 4WJ3M 2VNUD 4C92E 1X6OA 1U4LA 2WSEE 1B50A 3E1SA 2QK0A 8AT1B 3CCEQ 1L0YB 2RVLA 4FO2A 4IN3A 4O42A 4DR7D 3DEOA 2LZ6B 5GAN7 3S2HB 2EFIA 2VUBA 1NEBA 5GAN4 1BBZA 1Q7YU 1NAPA 3RD4A 1D09B 3OYMA 3KDFA 4RMFA 4X3TA 4GN5A 4FYVB 1ZX6A 4X9DA 5GAMf 5KE2A 2XRQD 1YJWQ 2A37A 3ASKA 4ME7A 1B70B 2MIOA 5E4WC 4R1JA 5BR8D 3HEJA 2JTEA 3K0YA 4XIGS 4PG3A 3M4GA 5CQXA 2E12A 2F0JA 2FB7A 4FDBA 2M1HA 4PJNA 1Q1BA 1MMAA 2F0TA 2JN4A 4H13C 4PV1C 4X65L 2A08A 2EDGA 1DYQA 3STBD 3QUIA 4KHZA 2BUDA 1SRLA 5C6AA 5JAVA 1BCPF 1JWSD 4OMOA 1PSEA 2B2TC 1K0XA 2EQSA 3PIP3 2R93H 1V1PB 4DUYD 3J7A5 3K80C 4BY6C 3TCJA 3ND9A 1QKWA 5DNFA 1X75C 1IBMD 4LF7D 1A3UA 1QG7A 3CPFA 5COYA 3H0HA 1HK9A 1F2ZA 2EAYA 3OQ5A 1LYLA 3SWNB 2MF2A 3EH1A 4LFBQ 2D0QB 1ENFA 1VQNQ 1T9HA 3URYA 4AMCA 4M77B 1XPUA 4XYQA 4RGNA 4GKKD 1M1GA 1IKLA 2H4OA 2NTSA 4QKUA 1QWYA 3HOWH 1AW7A 4JBWA 2F0PA 5CORA 1D5ZC 5GJWB 2VQEL 2DILA 5LMUQ 2NVQB 3E9FA 1QZHA 2F3IA 1IZ6A 4QF4A 3EJIA 4P5NA 1B4OA 1VQ9A 1F2LA 4R4CA 1G291 4OVAA 3E0JA 1D0YA 4E7IA 3V7SA 3BJUA 5AJ3Q 4IPCA 1YHQA 4DV7D 3C12A 2UUCQ 4QQGA 5LJ5h 1RUWA 3QDRB 1N32L 1XOVA 2O5JC 3EVQA 2PQAA 2Y0SE 1F9RA 5T1GA 5JVG3 4M78D 5EC7A 5D6XA 1HXYD 2ZXRA 2L5TA 1CM9A 3KF6B 4MNOA 2DJGC 3VDYA 2YTVA 3I35A 1EFWA 2GGRA 5M3FB 1W1FA 4HCZA 2CUBA 4C0ZA 1EQRA 4CDCC 4A3MB 1AZQA 4CHTB 3KYCB 2FEIA 4PJOC 3TMEA 1JXOA 4KH1B 1QVGP 4C0DC 4JLGA 1PZID 4A3JB 3I9QA 1T5EA 4JI8D 3ER0A 1FVIA 5CBEE 1BYMA 4DR1L 3GTJH 2L0AA 2A68D 1M9SA 3LYIA 3NE5B 1N33Q 2E5LQ 1V29B 3HOUH 2FZGB 5IYDG 2HD0A 3J80E 1VQ8T 3CRLC 1XYIA 2RPNA 5CGKA 5KYLA 4AFQC 2VY3A 5FU7C 3BZCA 1TU2B 3BS1A 4JBKA 2MWOA 1G83A 5EPLA 4JI0D 2HNIA 4XTWA 4DEYA 2DYIA 1YIJA 1B3QA 2NWGA 2B3GA 3HFNA 4C8QC 1SG5A 5GMKe 1SE8A 3E3XA 1N9SA 4PFPA 5FLMG 4LF4L 2O9SA 4IUUA 1LTID 2CW0C 5CKBA 3SGIA 4C3IH 1WTXA 2RJDA 2CP3A 2W10A 1ET6A 1Y7XA 1WD1A 2M9VA 2FPDA 2DZ9A 4ZKBB 4J7IA 2J6OA 1BBUA 1X3EA 2X6GA 4FF2A 4HT9A 3HP3A 3M4QA 1X01A 2PVDB 2Q2IA 2QDLA 3CPWA 4KKUA 3MJXA 2XU8A 4UC4A 2JA5H 2HQXA 1DCZA 1VQ4Q 1BCPD 1RABB 3IRBA 1YJWT 2DVJA 1SFOB 4TSSA 2ZJQA 3ERSX 1KIKA 1HCZA 4JZ4A 5GAMg 1JRIA 2KDSA 2H3JA 2KGTA 1UE7A 3FHWA 4FSSA 4M77G 1GBRA 1GUOA 4HCKA 1M8AA 2F0GA 3NGPA 4RFBA 3VA5A 1HTLD 3ERQA 1CUKA 2X69A 1NR2A 1AWWA 4JJBA 5GAMd 1VF5C 2FPFA 2E10A 2L15A 3K0XA 4BXXH 3PT9A 1VQLA 3JB9H 1NYGA 4CC2A 1JJ2P 1FD7D 3FP9A 3CCRT 2F4VQ 1B34B 5I22A 3CCUQ 1XNQL 4JI5L 4CDFC 3VR6A 4QIWE 1PH8A 3JCMJ 2EQJA 2R92G 4ZKCB 3HOVB 1MIUA 2FRYA 1UE6A 4IFDI 1FGBD 1PFBA 2F5KA 1H3HA 5HGQA 3HRZC 3I56Q 2ESWA 4ALPA 2HMAA 4RTVA 1QNKA 2AWNA 4E7JA 4DV0L 2LX9A 2PZ1A 2NN6H 4DR3Q 5CKEA 2EIFA 2JT4A 2CYZB 2LJ3A 2D6FA 4A3MG 4A4KA 3CCVQ 2W0ZA 3N6RA 2Z0WA 4C3IB 2JA8H 3OTOD 2B2VC 4NP5A 4A3JG 1UGVA 1VS0A 4PQXA 1E0BA 2KECA 1AFPA 1L1OA 5IP9G 2F2VA 2R6GA 4JC0A 3OB9A 3HRUA 2N3SA 2XN9C 3RIRA 1SNPA 1BCPB 4QQBX 4JRIA 2K4KA 3CQZH 4LDVA 1PZJD 1QNUA 3MFGA 4HIMA 3TS2A 1GHKA 3KYHC 2XG8D 2F1LA 2LFNA 2I5MX 3PCOB 3M0RA 1KRTA 2CQAA 3J7YW 3J80i 1ILPA 3MPUB 1IHVA 3H0IA 3QR8A 3DB4A 2UXDD 3AMUA 3D0FA 5IGBA 4LXCA 3RLNA 1KC8U 4NXML 1TG0A 1WHMA 2E6ZA 4V0BA 4OB0B 3S24A 2GF7A 5DLQE 1LLRD 2RDFA 1UNSA 4LW1A 1P16A 3VS2A 5CR3A 3TZDA 5K36H 2EXZA 4XTXA 3H6ZA 2F1MA 1GVPA 2CT4A 2VWFA 1L0WA 3GPLA 3TSSA 3FRNA 2CREA 4B3TQ 4JS5A 1OTCA 2ZGWA 4K5VA 5CV5A 1Q3LA 4B3RQ 2DE0X 4DV3D 4IOAA 2JMCA 2CT3A 4K5XA 3TN2A 3CCQA 4DR2L 3BY7A 1OXTA 4M78G 3UDFA 4KY5A 3QPHA 4YTLA 4GOPA 1ZBXA 4B3MD 1TWHH 2K32A 4BI3A 3NBHA 3Q6SA 1WXTA 3TZUA 1KXLA 3E2UA 3J81j 3EAEA 3I3CA 2YUNA 4YHHD 5C0XJ 1F9QA 1D0XA 4EQNA 2LCLA 4HT8A 3RMHA 1PM3A 2K3YA 2Z1CA 4GLMA 3VS3A 3R3OA 2EJMA 3PGGA 1G8ZD 5ECAA 2VQFL 4DK3C 4B6MA 3HOVG 3JAMc 4KMUC 2CQOA 3HRTA 1SPKA 2E74C 4DK1A 5GAHC 1HUNA 2ISTA 4PJOF 2JXBA 3MXUA 4OB2B 4MIUA 1BI1A 3VV0A 1M3CA 3VUBA 3ZBDA 2K75A 2LJ0A 1IL8A 5IE8A 1JT8A 2IG0A 3CBOA 3GP7A 2JA8G 3MHXA 4EDUA 1VDZA 2SNSA 1KQSA 2PCFB 4JI2D 1WHLA 2X3WD 3G6EQ 1X56A 1TWCB 3MVVA 3VR4A 2RA4A 2CZ1B 2DL5A 1S5ED 4HVWA 1NUCA 5GQOA 1PH9A 1VQ7A 3KFVA 1I94L 1TTHB 3PIPA 1EWIA 4C3IG 2UXBQ 1LTAD 2C0TA 1A15A 4R4IA 4M7DF 1Z9ZA 2F0DA 4E6RA 5KYNA 1SMYC 2FO0A 5DM63 1M1KR 3F2UA 1IO6A 5GAN2 1D1IA 1Y8OB 4YWLA 4Z8AA 1PFSA 2BTTA 1K9MU 1OO9B 3EG9B 2L1BA 3DM1A 5KNCA 3AEVA 1X2QA 4DV4L 3RKXA 4KJNA 2F2XA 3M3YB 2R7ZB 2P4RA 1UUPA 4JYAQ 3D6CA 3IAYA 3OYIA 1PDQA 4DXFA 1Y1WH 3KXTA 3X3NA 4QVZA 2UUBL 3MZ5A 1FYNA 4FIBA 3GD7A 2R5AA 5D3DA 1IB8A 2EJFA 1CHPD 5C0XG 3KJPA 3RZOB 1DM0B 2XGTA 1Q46A 2C9OA 2K04A 4OELB 1KSVA 2F2WA 4DV6D 3K7AB 4J83A 4DR5Q 2K5FA 3PF4A 1M90R 1VQ6A 4HCSA 2OI3A 4LDXA 3OS5A 4IJLA 4Y52H 1WJSA 1JJ2S 1WFWA 5CAIA 3JAML 1JH3A 2K05A 1RTNA 2LTOA 2RN8A 3S16H 1LT4D 1GM5A 3RUZA 1WTRA 4TVRA 1E2WA 2XDDA 4MDXA 1Q81U 1QOHA 3LGFA 2L3QA 2VYTA 1HQRD 1SE4A 2MFIA 2MYSA 4RG2A 4DQ2A 1YHQT 2HSEB 3V7RA 1HXDA 3L1AA 1LO5D 5JPMC 3GTLB 1R0CB 2HL5C 5ELEA 1RF2D 3T4AC 3GTQB 4C3HG 4WFN3 3JCMX 4DV2Q 4HCCA 2D2CC 1G3TA 2EYZA 3L2ZA 2DETA 4DR7Q 3LW5E 1R77A 1N27A 2D0OA 2IJ0A 2D9TA 3UI2A 3CC2A 5IH2A 1ZHIA 4LF8L 5GAMe 5KNBA 5IOCA 2EY6A 1IBLD 4NL3A 2NBFA 2RI5A 5BR8Q 2AZVA 2OX7A 3NPFA 1IREB 3R6NA 1WLPB 3A8LB 5GMKl 1VQPQ 3WVDB 2HD3A 4PJOD 1VIFA 1S40A 3CCMT 2ID0A 1B9MA 4A3IB 4A63B 3G4SQ 3S17H 1JOOA 4LD9K 2E2HB 1C1AA 2VVKA 1UGRB 2PZWA 2FXQA 4C5HA 3BW1A 1YIJT 2JM9A 4BY6B 3CMEQ 1GUNA 1EYGA 4C8QE 3CP0A 3WDNA 1IHZA 5FU6C 2COWA 3VRYA 4DUYQ 2MO0A 3KUFA 1MV3A 3GNGA 3I8ZA 2KI7A 1S72T 2VKNA 1H9MA 4M7DD 4X64Q 1IBMQ 4WTOB 4JI6Q 2R92H 2E8GA 3S1MB 4M75C 1PYBA 1NPPA 1P92A 2KXDA 2IVWA 1KD1R 2L89A 3J81E 1S5DD 1W2BA 3NEMA 1O7IA 3W2DA 3A98A 4OX9L 2CW0D 2I2LA 2R7ZG 5LMUD 1EQVA 4RGTA 1H9SA 1UGQB 4GKKQ 4OWWB 2DTOA 2E70A 2E2IB 2JJ9A 4LD6A 2CSIA 3VJPA 4K6LA 3RESA 2LCCA 1Y1VG 4JI3L 2G3RA 2UUCD 4LFAD 4A3GG 4OGCA 3CD6T 1O7ZA 2KEAA 4H02A 1EOVA 3FPUB 3QIAA 3JCMQ 1L1OC 2JK8A 1OXXK 1SROA 3QDFA 2RSOA 1VQLT 4KKSA 1P9KA 3CPWP 2QEXQ 1YJNQ 1D6EC 4DFAA 3TS0A 2PNIA 4C92C 1UEAB 2FHTA 1MI2A 5IP9H 2HHHL 4JBMA 2CH4W 2JA6B 1G2BA 4FYXB 1A3TA 2IHEA 3O5ZA 5C4JH 4UP9A 3EROA 4XXEA 5LMNL 1X65A 4DR4D 3M4YA 1K8OA 1LTSD 1X6BA 4PJOB 1IYJB 4PKCC 4C0DB 4C5IA 1EZ6A 2NYSA 4JJDA 4X66L 1SNMA 3JC66 3RMSA 1I1JA 4C1NI 5KYXB 1HTPA 3INZA 1YITQ 4JI4L 2RI3A 4Z02A 3UATA 4HJ8A 4JI8Q 2FL7A 3BDLA 4RMOA 3GTPB 4B3SD 1UHFA 2HDMA 2F03A 1EIHA 1S5BD 2GBQA 1M1KC 4X62L 5FU7B 5CK9A 1YVCA 2NUTB 3FJ5A 1WD0A 1N6AA 4DBHA 3AYHB 2BA0A 4M4ZA 1TQOA 2ZPFB 5D7UA 3HKZB 1SRMA 4JG2A 4LUZA 3Q0AA 4KRTA 4E47A 3WVEB 2CP0A 1RDPD 4JRPA 4K0KL 3I4MG 3X24B 2C0IA 1HNXL 4A3IG 1AWOA 1VQEA 1NMGA 2L0CA 2FZCB 5HY6A 4AQYD 1JO8A 4N9PA 2MPXC 5IYCH 3GP8A 4RCCA 1A0IA 1G6ZA 3A55A 3L2RA 5L8RE 1M90C 4J1MA 4QL5A 4BBRG 5JJKA 5M9OA 2E4HA 1BUVT 1LTBD 2AQ3B 1KTKA 1SYBA 3H09A 4LJZC 1XMQQ 4J9BA 5KYYB 2EPDA 1ZUYA 4DEXA 4E7HA 2RQRA 3X20B 3DMUA 3EHQA 3DWPA 4MZ9A 1J8IA 3VS4A 4LDWA 2LSSA 1M5Q1 2GQIA 3IKJA 2F4VD 4UHVA 3VYHB 1NBWA 1Q86U 1PWTA 2Y4XA 2LS01 2X4WA 2ZTCA 5BN3A 2OTJQ 1EY8A 4NKLA 3U4VA 2ZJPA 2JANA 1LT3D 1Q1EA 4GN3B 1VQIA 3J81i 5CV7A 5GAMh 1IXRA 1IBKQ 1N8RU 2UXCQ 1OYXA 4YCUA 2E65A 2YLBA 1PNJA 1ZEQX 2EY5A 1RACB 4A3LH 4Z9CB 1C05A 2GQVA 1CQVA 1ET9A 2PZUA 3NWTA 4LF6L 2J05A 1IKMA 2LT4A 4DBQA 1HFNA 1LV9A 1BI3A 2KVMA 5C44B 1G2SA 4G7ZC 4BE1A 2K2VA 2KVQG 3TSZA 2JA6G 1WTWA 1GKHA 1UE5A 2CZ0B 1HZAA 4L6TB 3TREA 4GNXA 3CQTA 1WGSA 3S1RB 3SVMA 3CC7Q 1Q7YC 3H0GH 4X3UA 4GBQA 5CMDA 2JA5B 3MXNB 1JE5A 1T0JA 1UGSB 1PTOH 1KHIA 3V8LA 5KYWB 3S3MA 1ZBJA 3CCLQ 1VQ8A 1E1TA 4WRDA 3LWEA 1MGQA 3OYKA 3P75A 5CV6A 1IYUA 3VYTA 4M1UB 1GUTA 2CZ6B 2XKOC 1HNWL 3I55Q 4C2MB 1H3EA 3QJYA 4GLKA 2EJFC 5ELFA 1D1KA 1MBYA 4HIKA 4NOYA 3CXCP 3ULPA 1VQ7T 1WTOA 4FXKC 1SSOA 4BD3A 2RM4A 2WB1G 2ATCB 1EQTA 5I2XA 2NVXB 2EWNA 4M7DG 2F4IA 3OMCA 2FINB 3HKZG 1QP2A 3CCEA 1M30A 3CCSQ 4CI0C 2JS0A 1SNOA 5GJVB 2SEMA 1VQGA 1WCMG 5EBDA 4BY7H 4JV5Q 3NHNA 1KD1C 4ZK9B 4APVA 4ZNXA 3EGXA 2DD4A 2NUPA 4DV1D 1KQSP 4DK0A 2P0PA 4FSXA 2RCFA 2UUAD 1IGUA 1KQ1A 1YJWA 1SMYD 2UXDQ 3D6WA 3QWXX 4M75F 2TSSA 4RG1A 5CR2A 2NWMA 1G3WA 2DXBA 1M2VB 1XTDA 2JVVA 2J7IA 1B7TA 4J9EA 1O80A 1VQDA 4DV5D 3L2QA 1M1FA 2EGCA 2V26A 1BXTA 3ULLA 2YXYA 4DR2D 4BY1H 4JK1C 4JI7L 3C4SA 5JJLA 4BDZA 2YRVA 2D0PA 4IPDA 1EWCA 5IWAL 5GAOl 1RHPA 4DNTB 4XT3B 5A0DA 1LTGD 2X4YA 3BDCA 3SD4A 1YI2Q 3CF5A 1VQ6T 4DV3Q 4O2DA 1H9JA 2A1AA 2DTIA 3CPWS 1A0NB 1JCKB 3D4WA 2NUZA 1DD2A 1U1TA 3G7ZA 4ZGEB 1Q8KA 1SBBB 2E1HA 2EQMA 5D6WA 4C92F 3QYHB 4AYBB 2F0LA 1UDLA 4DAYB 1AZPA 4ULLA 2O31A 4YHHQ 4UDUC 4DA2A 1AT1B 1OU9A 2R61A 3E9GA 2C5CA 2E5QA 1I4XA 5FJ8G 1G2TA 1H9RA 3M85A 1STGA 2WSFE 5EKIA 2LMCB 2PNHA 3RN2A 5JVH3 1E6GA 3MO8A 2CKKA 4J5YA 5IHNA 2OTLT 5C44G 3PO3H 4BBSH 3TQ7P 4OO1G 1S1NA 2WP8J 2QKIC 4A3CH 1SE2A 4LF5L 1BIAA 3CC2T 1HYOA 1G5VA 3LLRA 2QAZA 2UXBD 1I50H 4J8QA 1FR3A 3EG0A 4JI2Q 1MV0B 5GAN5 2EVRA 2A28A 1CKOA 4LUVA 4ABNA 5M3FG 4A3EB 4X3SA 1HZBA 1JJCB 2JMAA 2KY9A 5DAUA 5A35A 3HOZB 5IAYA 4ESRA 1CT1D 1QLYA 3N5BB 4Y92A 2LJ1A 1OZ3A 4OL7A 3SEMA 1TWHB 2K28A 1Y1VH 3L2PA 2EJGA 2M0OA 2RHYA 1M8VA 4DNRB 3JB9I 2JOYA 3MEWA 3PF5A 1GCPA 4LWCA 4A3GH 2PQAB 5C5LA 4DBFA 1UAPA 5KIXA 1AVZC 1MMNA 3JAME 4QVCA 1U4PA 4A3KB 2ES2A 3M57A 3S6WA 3CU7A 5KNLA 2L11A 3PSIA 3UPUA 2M00A 3KBGA 2A8VA 5DM7R 4HIOA 1QVFP 5CC4A 3C1EA 1ACMB 2MPMA 3OBYA 2YUPA 5M5WH 3GV6A 1Z9QA 3S1QB 4XTUA 3FKIH 5M3MH 2NN6I 4PZ7A 2DBKA 3QZ5B 3AB9A 2JEBI 3GO5A 3AHUA 1QW1A 4MMKA 5LMNW 1Q82U 4KI0A 1TH7A 3AU7A 2DXTA 3L42A 2HT1A 1OULA 2DERA 4M8AA 2OEOA 3OPOA 3M0PA 1C48A 4A3FB 4RTUA 4M75D 4PJLA 4M7AG 3MXGA 4PNYA 1FNVA 1C0AA 5J26A 5H1SE 1PRMC 5IGFA 1XMOL 1SYGA 2Z0SA 1S4ZA 5C3EH 1NLOC 2M0YA 1KRSA 4Q5WA 2MP1A 3A5ZB 3HGBA 2EKOA 1EY7A 1UHCA 5JEAJ 1EYDA 4IIOA 4HSPA 2PYKA 4Y7NH 1JOQA 2EVBA 3UDXA 2QILA 3I4MH 2QTVA 2PMZB 4G57A 4YY3D 4F7UG 1FMKA 1ZXTA 3MEVA 4CDDC 3J81c 1OZ2A 1FGUA 5M5YH 4C92D 1Y1WB 2RHXA 2TMPA 4DUZL 2FRWA 2AT1B 4RGOS 1W70A 3E5SA 4IQZA 5J1ZA 1XNRL 1J5ED 1ASYA 4PMBA 4B08A 3SEBA 5GMKj 3REBB 4ZN3A 3CXCS 3D8GA 1YI2T 2LCSA 1MSGA 1UE1A 3WOFA 2QA4T 3TQYA 5I2MA 1PV4A 3MA2B 1IBLQ 3HOYG 2KNBB 3NQIA 1K0RA 2QYZA 2NYZD 2Z9HA 4OMFB 3SB2A 5IGGA 1FWZA 2KT1A 4OP0A 1HJPA 1P8LA 4OONA 3I56A 4A3EG 3CEYA 3T1HD 1OV3A 4BB7A 5FU6B 2E2JH 4HVUA 4IUVA 4M7AA 2SNMA 1UE9A 5FW9A 2ZM6L 5KCOA 4X64D 2M51A 4JI6D 2B8GA 2EYLA 2HQLA 5JOBA 1ONLA 2VUMG 3BYYB 5GROA 4R4OA 3M53A 3FIFA 4A3BH 4PJJA 3I70A 1WTVA 4M75B 4QVDA 3NP8A 3GTMB 1KC8C 2BE9B 3SK4A 4DF7A 1AHJB 3BYTB 5GANf 1N34D 4P75A 4A3KG 1PD0A 5IN1A 4QY7A 4EQPA 3M54A 3ONAB 2ENBA 3HRSA 5K5PA 4LDYA 2J0TD 4OIJA 3U9SA 2IHFA 3S1NH 5GAOp 4A3DH 4A3CG 1KLUD 2BDNA 2KTLA 1ZSZC 2AKKA 4F7UA 3OYDA 5JEAG 4CC7A 3JAMi 3D4DA 2UXCD 1K73R 3GTGH 2CP6A 3I4NH 2ZPIB 1L1OB 1ARKA 1WQ7A 4GLVB 4IPGA 3E0EA 3J81L 1QILA 4NXND 4C92B 4LFAQ 4LFBL 4E7KA 3WWVA 4A3FG 1Q90A 4JI1L 2J7ZA 2KR3A 2YHTA 1QJOA 3I4OA 1YJ9T 1PC0A 2R58A 1R4PB 1SEMA 1MSHA 4NMZA 5FK9C 5C4ZA 3R93A 4JUVA 3CC4Q 2HAXA 1LM0A 2OF1A 2B63B 4DR4Q 1TS2A 4L5QA 2KRMA 3A7AB 1WCMH 3EGUA 1I3QH 4BDYA 5IP7H 1K3RA 4PL6A 4QT7A 2JEAI 1B44D 3KLWA 3A56A 1FJGL 4KGXB 1YNJC 1BI0A 4IFDJ 4CKEA 4FNFA 1NJIU 2V1QA 1TIID 5EKLA 4EIKA 3CCMA 1PVOA 4R0KA 1MHWC 1A62A 2PW5A 5FKAC 5KYUA 4B3SQ 4C3JH 4ZAIA 3L7ZC 3WOEA 1WHJA 2DL7A 4BE0A 1BVSA 3AT1B 3ZEHA 3V8KA 1BDOA 4F8MA 1GJXA 1HNXD 4XU1A 1HR0L 4FXDA 3QB3A 2CWAA 3QZ9B 3I4LA 3NXWA 3A7LA 4LF4Q 4KK7A 3FVQA 2QW7A 2O88A 3L0OA 4CJ1B 4KHPL 3VS5A 5TSSA 2X4XA 4BS9A 2KYMA 3W1GA 1QCFA 4F04B 5LJ3f 1S72A 3CCET 1T0HA 4EMKC 5D14A 1OXUA 4BWGB 1STYA 1YP5A 5C4JB 2DNUA 2MCNA 1QVFS 2QF7A 2VXWA 2VXEA 2ZTEA 3PQIA 4AQYQ 1H3ZA 1MJEA 2E5LL 3OW7A 2YU9H 1XMQD 2WKCA 1D1AA 1EIYB 3Q23A 5I4DA 2XDPA 5I21A 4B9WA 2NVTB 2RHZA 1RL2A 4M75G 5EPKA 5FJ8H 1QQJA 1MMDA 4O5VA 1R4QB 4C5EA 2C35B 5ELCA 4N8X1 1LNXA 3SK5A 1RLQC 3PFSA 3CD6A 2P84A 4UY8C 4U673 3VYGA 4OO1H 1EUJA 2QGFB 1IBKD 4HJ9A 2Y0SB 1HHVA 1XNQQ 4YWKA 5GADC 5IY0A 1K8AU 2ZJRA 3D7SB 2XMFA 5IT9E 4IFDG 3NENA 3RERA 2L5QA 5C4XH 4CC3A 2CUDA 3S15H 1B2TA 4OMQA 4E7SA 1CI3M 4Q5VA 1KIXA 4XAXB 4LFCD 4YCWA 4HIDA 1VQNT 3HOXH 3MEFA 3GTOB 2L4NA 5GAGC 3NTKA 3R6OA 5GMKm 2M16A 2C06A 3T51B 1NZ9A 1W6XA 2JN0A 2QXFA 2LQNA 1V1PA 2KRNA 2EE1A 2DAQA 2LXJA 2RBMA 2ZPBB 2DLPA 2OAUA 1G3YA 4ZUJA 1AD5A 2NTTA 3WXMB 1NG2A 4BI4A 5F2DA 1JJGA 1EFNA 4DK6C 2HIXA 2QCPX 1SHFA 1HJDA 2KT8A 2Y4YA 1PHJA 4J9DA 4K2LA 2RJFA 4XTVA 3SWNA 5HGTA 3GLXA 2VGMA 3JCMb 4ME5A 4O0AA 4BUGA 1KL9A 5EJWA 1LT6D 1TWAH 2ZPHB 2RNAA 4M77A 4BA1I 3VR2A 4DR3L 2IX1A 2R7FA 4DOVA 1OI1A 2B8FA 4JV5D 1RAEB 2D1XA 3F70A 2NVYB 4LUEA 2B2WA 2K79A 1JOKA 3IFTA 1BU1A 1I8FA 3OHXC 1R9TH 3HKSA 5G3LF 4L5SA 4HN7A 1X2KA 3UDGA 2L3SA 4IKFA 2MNAA 1YNXA 1B8AA 5KE3A 2AMCB 3SHLA 1WHHA 4TQUS 4R8NA 5GAN6 1UFFA 2BE7D 1TXYA 1MKHA 3EQLC 2KMTA 1XTCD 2B2UC 4DV1Q 3PO2B 2HCKA 1D0ZA 1N9RA 3A1PA 2YYZA 2HKNA 2UUAQ 3OY9A 3M9BA 4JI7D 1PRLC 5IYBG 2WIIB 2VXFA 3PIO3 3QYGB 1K73C 2GCXA 2PTKA 2E6NA 1TUCA 2EYWA 2JW4A 2MQHA 4DV5Q 2F3WA 4A4FA 4JJNK 1PH7A 3K5OA 3V05A 2MJ8A 3G4SA 4DR2Q 3NPPA 4IOCA 2BDOA 4K8JA 1SRUA 1TY2A 2HDLA 4QIWB 4K2KA 2EKHA 2X9HA 1PFMA 2DL3A 1YWOA 1D5XC 1TWFB 3A8HB 2L3PA 2V1CC 3CMEA 2ZXOA 4EVOA 2K33A 2JQOA 3TVTA 3A8JE 3G6JB 3H9NA 4Z88A 1MNEA 4RKLA 4P74A 1QWFA 1ZA1B 1MNDA 3HOYH 2Y0SG 2KE9A 5LHY1 2EYQA 1CSPA 1EWHA 1RADB 3OW2P 1G51A 3H15A 3X28B 1B53A 4LK1C 2JA7B 3A8GB 5LJ3g 1QVGS 4OMPA 5GAMj 1VQ4T 2YTXA 5GMKh 3OS0A 2JM8A 5A0LA 3G71Q 3H6MA 3DH3A 2OXPA 2DY7A 2E41A 1SLJA 2JXMB 2VUMH 2RD1A 2GNCA 2V8KA 1AWJA 2K3XA 3OSSC 3S14B 1C4QA 1CKMA 3UE0A 2V8JA 5GMKi 1I94Q 4A75A 4ZGDB 2DL8A 3M58A 3PE0A 4PNOA 1GO3E 2QEXA 1YJNA 4KUIA 3CCUT 4XTCS 2EQIA 1Y07A 3GDEA 1N5ZA 3ULRB 4Y91A 3VRZA 4C8QF 5A0GA 4M78A 2WAQE 1WTPA 3RZDH 3I56T 4RA8A 3RKWA 1FNUA 5LJ5f 1EY6A 3GTKB 1RKNA 3HPWA 1EOTA 3T1YL 4J9IA 1Y8RB 4F88A 4KY6A 4DOWA 1YITA 2MK5A 3EH2A 1VQKQ 1NPRA 4DR6D 3O13A 4IUTA 4FF1A 2UUBQ 3HP9A 2K5NA 4II2A 1JB7A 4FVMA 3U50C 3CCVT 3OIQA 1TOVA 3M4OH 5ELOA 5G3LD 2DN8A 1LOJA 3EFSA 1FMWA 2BCOA 1LT5D 1PXUA 4HSVA 4MTKA 1VUBA 3NTIA 4GKJL 2QASA 2NZHA 5AYFA 1STBA 2IT1A 3I90A 2K6PA 3FDTA 5I2YA 3QXEB 5IHKA 4R8IA 2J4XA 3RNJA 4K6DA 3S2HH 5DEHA 4FM4B 1UECA 4R56A 2XRSD 5AT1B 4QUCA 5IYDH 1XPOA 1S5CD 4FL6A 4RTTA 4J15A 3VYSA 1N8RC 1SAPA 2KEDA 4IUNA 3G48A 1QB5D 3CMAQ 5IGCA 2Q8TA 2EYYA 2YSQA 4N4HA 4PMCA 4C0GA 3SE0A 3BDOA 2PQWA 2AIRB 2DX1A 4XU3A 4H7BA 2ED0A 1WZOA 1AZEA 2X35A 1TSFA 5FLMH 2N8NA 4AFSC 3TP7A 3T9NA 2OTLA 1TWGB 4PMWA 2ROLA 2K7VA 2JA7G 1XNRD 2E2DC 3MXPA 2HKQB 4KJOA 1ZSGA 2BKDN 1HNZL 1HR0W 3MC0B 2EGAA 3I72A 4YY3Q 5EKKA 2XVSA 1WI7A 1QE6A 4RTYA 4X6AH 4PJMA 4X65D 2VC8A 2K57A 3PNWC 2OTJA 1PRTC 2WSCE 1Q7YR 1J5EQ 4QJFA 5M5XB 1AZGB 1UJ0A 5EGTA 3JCMf 5DM73 1VF7A 3OWFA 1ZA2B 1I6HH 2IPOB 3EBEA 4DV2L 1SKUB 1HH2P 5JJIA 4C0FA 4A93B 4HJAA 4WF2A 2VW9A 3Q24A 3JB9F 4DR7L 2ZM6D 3MHBA 4MN3A 3FJPA 2KCCA 4BA2I 4RTXA 3BE3A 3T1HQ 2NVQH 3FC3A 2Z6KA 4OGQC 4G7OC 1CSKA 1UB4A 4GS3A 4NPSA 4FYWB 3F1ZA 1CZGA 3CC7A 2F52A 1FL0A 2GVAA 1XX8A 3H3VH 4DNIA 3M0SA 4V2SA 5BR8L 2EJ9A 2DTHA 2MAMA 2FG0A 1OX9A 5GAOm 3CCLA 1JE4A 1JMCA 3EGDA 4C8QD 3J7AV 1K76A 4Y7NB 2PPBC 2VQED 1BK2A 1S5FD 5GANe 4OX9Q 1JB0E 5E7NA 3G6ET 4DPGA 1EY9A 2DL4A 1N34Q 1E3PA 5FRNA 1NMFA 1ZSZB 3LH0A 1IW7C 2RQXA 5GAN3 2EYFA 1O75A 2DEQA 2YLCA 3HFOA 2B2YA 2QQ9A 2FMCA 3AQQA 3NUCA 4UP8A 5AFWA 2QGGA 5FLXE 4HJ5A 3NFCA 4JI3Q 3FLGA 4A3MH 1SYEA 3K5LA 1N32D 2AHJB 3H94A 4KGZB 5KCHA 4JI1D 3CCSA 4A3JH 3O8VA 2EYHA 1PA6A 1IBML 4LF7L 1G6PA 2HCIA 4N0AA 2K7AA 2DKGA 3OW2S 1M2OA 2PQEA 1L2FA 4NXNQ 5I9OA 3FMCA 3X26B 2R93B 4G4KA 5LMNQ 1K83H 2ZZDA 3JV3A 5HURA 3PVLA 3M0TA 2B2WC 4GKKL 2PVGB 3FRPB 1VQKT 2A69C 3G1JA 1RAHB 4QUFA 4ZN1A 2NUPB 2L8DA 3UWNA 4KY7A 1VQMQ 4RH6A 4DR1D 4LE9A 3NELA 1FJGD 2GFUA 4BACA 2OT2A 4JI4Q 1GFDA 3RMQA 4XT1B 4A4HA 2K5IA 4LF9L 3EG9A 1YI2A 1SDFA 2JP1A 1LTRD 2QA4A 3NK9A 3HOWB 4QQDA 4X62Q 3I73A 2QQRA 4DV7L 1XNIA 4A3DB 2MMPA 2K2MA 1V8QA 4CC4B 2EY2A 1HR0D 1Y96B 2E5KA 2EXDA 1TS3A 3PUXA 3KF8A 4XDXA 4LF4D 1GCQA 4C8QB 4KHPD 1U5SA 2DZCA 2O5IC 1C06A 2QQAA 1U8RA 1TS5A 1SFOH 1HNXQ 2F0QA 2JE6I 4GOPC 5IT9c 3HSBA 3M56A 1SEBD 1WXUA 4EMKB 3QSUA 2RF4A 1VQ5Q 5J22A 2EYMA 3P7JA 1I4RA 3KJOA 4A93G 1SSHA 4D6WA 5LJ3e 2YWWA 1X3FA 4RTZA 6AT1B 3PIOA 3JRZA 2RQUA 1F2YA 3RUXA 5I6WA 5FWCA 4KN4C 5FQ2B 2HEQA 3OSVA 2RDGA 4FP5D 4RCOA 3KLSA 2SOBA 2UU9D 3JB9D 1RCVD 2F0IA 4CGYB 1BI2A 3HOVH 1X69A 2AWOA 3RLOA 2Q2TA 3BFMA 4AIMA 3VR3A 1WQWA 4O6JA 3LWUA 4JI0L 1VQPT 3GTJB 1EIGA 1Z9FA 1SNQA 1MGSA 1LVKA 5J3BA 2HDAA 1UJYA 3HOUB 1DM9A 2DEUA 1ABOA 1W6KA 1Q82C 1RIPA 1FX7A 3RBBB 4A4EA 2KEEA 2J6KA 4KGVB 2K6DA 3JCMg 3G4ST 3Q8DA 1XWEA 4ZQ3A 1PH2A 4A76A 4Z89A 1Z6HA 3GV3A 2AQ2B 4RKBA 2FJ2A 3CMET 3I4NG 1YJ9A 3HP7A 3QIIA 4PK4A 5CO7A 3DLLA 1I6VC 1J9OA 1YHBA 1ZKOA 2A5HA 3VKIA 1KNAA 1TY0A 3V7CA 1RD9D 2QEJC 1PG5B 3AFQA 2RO0A 4DV0D 3L2WA 1VQHA 2XWBB 2SDFA 2WV6D 2Z6BA 4D8DA 1I4K1 3C94A 4M78C 3VS1A 3K5MA 1II3A 1BF4A 1RAFB 3QOJA 3F2DA 2KOLA 3I7FA 3IFDA 1VQOQ 3BZDB 3ONGA 3OYCA 1RAIB 2CFMA 4LFCQ 2F0SA 1RTOA 2B2TA 3Q1JA 3JSCA 3VS7A 4PJOG 5FO9B 4II3A 4R55A 3R8BA 4M7AE 1SJED 4EQ5A 5GAOr 4DAMA 1U3OA 1GXIE 4QCLA 3K8AA 5IT9L 1PCXA 2O9VA 4XQNA 1VMCA 2M02A 2EQUA 2MOXA 2XK0A 1HNWQ 2QDBA 2O01E 5CKHA 3EFOA 2LX7A 2IPKD 2NUCA 1IGQA 2DJFC 2I0NA 5C0XH 3EHRA 1KLGD 1K28A 4DAVA 2KYBA 3QOLA 1PYWD 5IXBA 2K6AA 4IJHA 2QEXT 1YJNT 2P0KA 1M8MA 3M0UA 1ABQA 4F7UE 2LY7A 4PFOA 1D5MC 2N88A 1H95A 2KK4A 2G9DA 4C8QG 4JW0A 1DJRD 2K3BA 4NXMD 4P72A 2O4XB 1KQ2A 5J39A 1CKNB 4GY5A 4XTZA 1I5LA 2ABLA 1NY4A 2AHOB 5KYIA 1MD2D 5HK3A 1PH4A 4ZTFA 2D62A 3OTOL 2LVMA 4C5GA 5E1FA 4OB1B 4HCBA 3U58A 1YITT 1ENAA 2KAFA 3F2CA 1U1SA 1SE3A 3HOXB 1EEFD 3SFMA 1Y8PB 2PW7A 4C3HH 4IALA 2P5ZX 3KDFB 4JI7Q 1KC8R 2IIMA 1K1ZA 4RWSC 1PTOC 3JB9J 1E1OA 1BCMA 4PJOA 2KA7A 3GBQA 2XSCA 2L3RA 3ZFJA 4JOIA 1JJ2A 1X54A 4E7ZA 1SF9A 3K57A 3C3LA 4DAPA 2A3LA 2DM1A 3CW2C 1DZ1A 3HOUG 1HZCA 2CP5A 1CTMA 2VQFD 1MMGA 2MWPA 3CAMA 3CQZB 5CV9A 3I5RA 3IL8A 1TWCH 1WJRA 1F9PA 2MO1A 4RGMA 2NUTA 1VQNA 2A6HC 3EN2A 4IUQA 2RF0A 3BDUA 4M7DA 1ML0D 2HIVA 4LUDA 1JB3A 3JCMV 1ZUUA 5FROA 2XIWA 1W4SA 4GN4B 4DV3L 1IL2A 3D31A 1PSFA 3OIPA 2KQWA 4L8JA 1DGSA 2ROTA 1I94D 3OYNA 1WFQA 4CJ2C 4B3ML 1V1QA 2JA5G 3NBIA 5IXFA 1BKBA 3DLMA 1NJIC 2VV5A 2OTJT 2R7ZH 3M3YH 1FMVA 2EQKA 1I4GA 3AFPA 2VB3X 2JTFA 4JBJA 8ATCB 4N8FA 1PH3A 1H92A 4S3SA 4DV4D 5KYYA 1GHJA 3RZOH 2XDBA 3CC4A 2R57A 3QO2A 3T1YD 1PKSA 1SNDA 1X32A 3GNFB 3K7AH 4FCYA 1AN8A 4MZTA 3JB9G 4I65A 1VYTA 4BXXG 5HK0A 1ZUKA 1M1KU 1O78A 4HA8A 2UUBD 1V1OA 3IQLA 1E22A 1FNWA 1VQOT 1KAAA 4AH6A 3CCJQ 2RK1A 1QVPA 1PMRA 1YNNC 3M7GA 3CC7T 4JI2L 1F77A 1K9MR 1X3PA 3HHTB 4KH0B 4PLIA 1KG1A 4OXPA 4XYOA 2CWPA 4DR6Q 4GKJD 3CCLT 4EMGA 2H5XA 4BI8B 1YWPA 1WXBA 2BZ8A 2LDMA 1TU0B 1KHCA 1KNEA 4NL2A 2Q2HA 3I55T 1B1ZA 3GTLH 2DY8A 3GTQH 1N9WA 3MEHA 2Y90A 1EX4A 1D3BA 1IYVA 1WPYA 4ZTJA 1SMXA 1B9NA 2KSSA 4X1VA 5FWBA 4LDUA 1U4RA 2K1BA 4R9WA 2LC4A 5KYUB 1M90U 1JR0D 3MXNA 4FF4A 2CP2A 3FDRA 5KYWA 1XMOQ 1WA7A 4L6V5 3CCST 2B2VA 2PI2A 4R4TA 1EL0A 1IW7D 4AG1C 1K0SA 3OYGA 3RDVA 5KEEA 1K8AC 1NSNS 1I4PA 2DXCA 1K9AA 1W2BP 2WFWA 3UT1A 1C7YA 2ED1A 1VQ4A 2KRSA 2M9UA 4M77E 3UA7A 3I2ZA 4AYBG 3RNUA 4FYYB 4KTAA 1TKWB 5FO8B 1VQ8Q 3TEEA 3TRZA 4A3IH 4DV6L 4LF8D 2AK5A 2E2HH 3V96A 1KJWA 1VQCA 1XNRQ 1PH5A 4WCIA 3C46A 3M0QA 4IIMA 2ZAEA 2L12A 1NLPC 2E64A 3M9QA 2EPBA 3M4OB 1EY4A 1DONA 3S3NA 5K36G 2YV5A 2DVEA 3ME9A 4X65Q 3CCUA 2KXCA 2A69D 4QB4A 4BBRH 5FLXc 1XJVA 1N36L 2ATWA 4KBMB 3PUVA 3S1MH 3JCMe 2YUQA 5A2QE 3GF5A 4MZMA 3NQTA 4J6HA 1M2VA 3S16B 3MEAA 4TKOB 4AG2C 3LWIA 4WJWA 4CRIA 4IUPA 3QBYA 2D8JA 1I4QA 4XK8E 5I6YA 3HOZG 1KQSS 2BA1A 2K5DA 1C8CA 2ZM6Q 2YRCA 4RTWA 4F16A 2E2IH 1IRXA 2NZOA 2HSPA 4RKUE 2MI6A 1VMPA 3TSWA 3REAB 4OX9D 3VUZA 2AUJD 2CH4A 3CCVA 2F0UA 2FMMA 1IBLL 1TUGB 1HRJA 2KJXA 1YHAA 2HBWA 3GOXA 1LPLA 1OPKA 2R7DA 4J9CA 5L37A 3CCRQ 4B9XA 4DAYA 2VQEQ 4GNXC 4FU6A 2JA6H 4YWMA 1VOMA 1EEID 2COZA 2LQKA 1PTOF 1U0LA 1KD1U 1QCBD 5GAEC 2C0OA 4OMLA 2I46A 2V4DA 1QCNA 5CKFA 3KLRA 2RI2A 2A6EC 1SJHD 2OQ0A 1VIEA 3EG2A 3RR6A 2DGYA 2XD0A 1LTLA 1STEA 2EYPA 4ID6A 4OUDA 1OXVA 3P1HA 4RHSA 2HHHD 3T13A 1OX8A 1VYUA 3CBMA 7AT1B 2Z4IA 1SR3A 1N32Q 1I6HB 3H0FA 4JI1Q 2H3EB 3OYHA 4NW2A 1YZ6A 3S17B 4K5WA 2QI2A 5LMND 1HA6A 3I5SA 1AOJA 2F69A 1BOSA 2KCNA 4FW2A 3GTPH 2DJQA 4ATOA 1QKXA 2DRMA 2E75C 1M4ZA 3NSWA 4X66D 2X4JA 2RJEA 5FLXL 4F87A 2EYXA 5KRUA 5GAOq 5LMUL 3SR1A 3CCJT 3S2DH 4JI4D 3VS0A 1WJQA 3OS1A 3S3OA 4NNJA 3L9AX 4M78E 4LF9D 1ESFA 4DU9A 4AFUC 1CFMA 2R92B 3FPPA 2YT6A 1QUQA 3HG9A 5T1IA 1B3AA 5AJ3L 1CK1A 4X62D 4DR1Q 1OXSC 2DBMA 2LXKA 4HAEA 4NS5A 4F7XA 4KUDK 1FJGQ 2UUCL 2GN5A 4LFAL 1Y1WG 3EG3A 1NEGA 2HL3A 1LTTD 1LACA 1C9OA 3BU2A 2KHJA 3BVMA 1EZZB 1Y0MA 2OAWA 4F14A 2MGSA 4K0KD 1OPLA 3VYRA 1CA5A 1VCIA 3LX0A 1KSKA 1HR0Q 4D8KA 3CHBD 2P0QA 3HS0C 2H1EA 1RAGB 3HFZB 3K6OA 1SYCA 4JOIC 3NWSA 1XQHA 3X3MA 1E2VA 1UGPB 3FB9A 2F0WA 2BZXA 2GVBA 3NBHB 1ASZA 3UA6A 2F0FA 4H0LC 1HSQA 2EY1A 2XIDA 1K9MC 1ZYRC 4KV6A 3G71A 2DJZA 2QG9B 3HL8A 1BBXC 2K01A 1N33L 2BE5C 3DKMA 4RCBA 1CSQA 1K83B 2Z8LA 3K81C 5I9PA 4B3SL 3G6EA 1FXXA 4DGZA 1WJJA 2IX3A 4RUGA 1I5FA 3U4ZA 4M7DC 1WYDA 4FW1A 1EZ8A 1G91A 1KDCA 2XTIA 2UU9Q 1PKTA 5IGDA 2A36A 1NE8A 2G9HD 2QGQA 1O7LA 1RI0A 4K14A 4QMGA 1QVCA 2BH2A 2VB2X 5C44H 1K3BC 5IHIA 4N9TA 1F2MA 2A7YA 2F0EA 2V8IA 4ILWA 2GFAA 1MHNA 1HUMA 3S1RH 4JI5Q 3A8MB 4RCNA 4AQYL 2CGHA 5EQ0A 3K58A 2RMOA 1W2BS 1AEXA 2IL8A 2JSOA 3FEWX 2NVUB 2EW3A 1Q81C 1EFID 2F0HA 3N52A 5M3FH 4LF6D 3KYDB 1Q86R 1PTOD 2IY5B 1I5OB 4C92G 1VQKA 2VZAA 4C2MH 1FKAD 4M78B 4E6IA 4K11A 3V8JA 3JCMh 4DV0Q 2B39A 2ZTDA 2RHUA 2EOTA 2EJGC 3KOJA 4J9HA 1N8RR 2DF6A 1GOZA 3OYLA 2ALYB 3ONHA 2COYA 3GQBA 2MUYA 3CRKC 1NCVA 3KBXA 1LABA 4HMIA 5GANg 2NVXH 2B63G 1SNCA 1HNWD 2F4VL 4X34A 3MAQA 3H3VI 3DHQA 2YRDA 2JJQA 2Q8IB 4LMQD 2P4TA 2A6HD 1GFCA 2JA9A 3I91A 1KABA 5GANd 4OIKA 5C3WA 3ICEA 1H3FA 4M75A 1TS4A 4JPBW 1L0XB 2K50A 3LGLA 3GTMH 2JA8B 3CMAA 3C0CA 2K9GA 2SEBD 1CKAA 1HD3A 3MFYA 4OHJA 3F2BA 1BNZA 1PLFA 5EG2A 2LNVA 4X3KA 1ESRA 3UDIA 2F0VA 3H91A 4P2CB 5IYCG 3CC4T 1M3AA 3ULJA 2XI9A 4OMNA 2AZSA 1X55A 2RDHA 3HTRA 2RKSA 1Q8IA 3BVZA 4NXMQ 3QG1A 3VS6A 1J6QA 4W5VB 1I0CA 2AKWB 2FVUA 1EQQA 1OQKA 4C92A 1HZ9A 2V1RA 5IWAD 2LQWA 1E2ZA 2LMJA 1VQ9Q 2KCTA 1VQPA 1WVLA 3PMTA 3H0GB 3QHSA 3KF6A 4EPCA 1PTOB 1Z47A 3BG3A 1YHQQ 2IW3A 2PO4A 1AWXA 2OJ2A 4X9CA 2EYOA 2WINB 4FT2A 1HQMC 4MHEA 2RSNA 1SXTA 1YNND 3EFXD 1BO0A 4AFZC 1BB9A 2K4YA 1RI9A 3SK6A 3MTSA 2EYJA 2PVOB 4DV1L 3THKA 2LP5A 4KD4A 2BOSA 3TU4K 2UUAL 2YUOA 2QQSA 4HVVA 4YCVA 4B3TL 4LUOA 2VQFQ 2KBTA 4BY7B 1OOTA 4DV5L 2HUGA 4NDXA 4B3RL 4A3EH 1M3BA 1RAAB 3L3OC 2CHBD 2B29A 2DIQA 1Y57A 4M7AC 1STNA 1V43A 4KN7C 3HOZH 1U06A 4KT0E 5LL6X 2F0MA 2AKLA 5LJ3d 4LF5D 2K5HA 2ENMA 2X51A 1D1CA 4I7AA 4KULA 1GBQA 2DYBA 1T3SA 2SRCA 3CCMQ 1TT2A 2E3HA 3EGDB 2BH8A 5C0MA 4UPAA 2A19A 4C3HB 3H8ZA 1K4US 5JPNC 4K8IA 3OOCA 3TBIB 4GLXA 4BY1B 1YIJQ 1H9SB 3CXCA 4TVAB 4A3KH 1NE3A 5CIUA 3R2TA 1G8XA 4RAUC 1D8LA 2MHVA 1TS9A 1Y71A 1S72Q 2DFUA 1Y8XB 5JEAH 4HJ7A 4J6XA 2HQEA 2CVRA 3S1QH 1VQJA 2F5TX 4DV4Q 4ME3A 1JWMD 2DNEA 1HPCA 5GANj 4LAAA 1VQMA 5IODA 3LNNA 3T1YQ 2K5VA 5D65A 2J6FA 3SDZA 2O2LD 3URGA 3ZYYX 1QWEA 4A3FH 5L23A 3QJ6A 1TR5A 1PH1A 4RHRA 1B34A 4A3LG 3RKYA 1BIBA 3K59A 2UXBL 2RHIA 2QDYB 4OWTB 2RCNA 2CCZA 1AH9A 5BN4A 2KHIA 3PO2G 3DB3A 1NBEB 3CD6Q 4P73A 3L2VA 4YIJA 5D3IB 3QWYA 1W6JA 3TP8A 2EZVA 3PO3B 4GKJQ 4BBSB 1X3GA 3E9IA 3VR5A 3PVQA 1VQLQ 1YFNA 3OYFA 2J06A 1D2BA 3H0GG 1ICWA 3E9HA 1TWBA 1I50B 5IGEA 4ELYC 1K8MA 1Q86C 2I0QA 1XMOD 3OS2A 1LJOA 1DOMA 4JYAL 2X6LA 4MMLA 1VQ5A 4DKAC 4MZPA 5IIFA 3KF8B 4XTYA 1Q82R 3SHWA 5CKDA 5DLOA 4Q0FA 5C0XI 1Y8NB 4Y28E 2NZ1D 2RQWA 2YTYA 1ENCA 1CHQD 1Y1VB 1SSFA 1A2TA 2GA4B 2O2OA 3KUPA 3OWEB 4OEMB 2A6ED 2F3VA 4DR5L 4A3GB 1IHWA 2ASBA 1MJCA 3NTHA 3A74A 1KSWA 1JQYD 4DUZD 1E24A 4LNQA 4BY7G 2K52A 1HNZQ 1RODA 1HFGA 1A6XA 1YBYA 1VQ9T 4HR7B 1AP0A 2LRQA 2DD5A 3R2IA 2N55A 4LF8Q 4OMMA 2X3XD 1A8VA 2VS1A 1N36D 2VL6A 3TP6A 1EY0A 4JLIA 3M4PA 5M5WB 3A0JA 3UDCA 2E76C 3FKIB 1VYVA 1B07A 5M3MB 2F0OA 5C4HA 1VQFA 1R0BG 1T3LA 4ZGJB 2HCCA 3C2PA 2WAQB 5D6YA 1I4HA 5ELNA 1X43A 3EG1A 3LX7A 4XQQA 3QWNA 5LJ3j 1UWVA 3VU3C 4BY1G 2UU9L 3PMFA 4MTNA 3A8IE 3U23A 4ELZC 3F8TA 1BCOA 1D1BA 3LWHA 1YNJD 3JCMc 5C6SA 4PJOE 2OCEA 1AE2A 5JJZA 3OYJA 4YY3L 1QZGA 2D5DA 1I07A 1VQOA 1GXDC 3EIVA 3RR5A 2Q8RE 5NUCA 3TDQA 1RLPC 3CBPA 5C3EB 1DJ7B 2FHDA 5CV4A 1JQQA 2ZPGB 1BBWA 1LUZA 4KHVA 3UE1A 2F0NA 4XU0A 5CVIA 5A2QL 3G71T 1QVFA 1J5EL 1WI5A 3CMMA 4IFDH 2RQTA 2DPPB 3I4MB 4JI3D 3I55A 4PZ6A 3CCQQ 3EFRA 3T16A 2WB1E 4GNXB 4HKEA 5M5YB 1CZWA 1ZYRD 4M7DE 1PFNA 2QQBA 3HKZE 3A8KE 1M27C 4XQ3A 5C5MA 2Q2UA 2LQ7A 5CYUA 2LQ8A 4L59A 2BE5D 1X27A 4KLKA 1EU4A 2I5HA 1TUDA 3T1HL 2B63H 2PUKB 3PO3G 4E2FB 2F0KA 4DUYL 4BBSG 4LFBD 3EFOB
chains in the Genus database with same CATH topology
2JUFA 4JRKA 2IX0A 4CBVA 4BBRB 5BN5A 3VA7A 3SK8A 2XNAC 1A3VA 3SWNC 1STAA 3PTAA 4QQ6A 4BE2A 2IWHA 1K73U 4M77C 3MP1A 3EA6A 5LJ5g 4ZUIA 2E2JB 1JBMA 4M7AF 5FRMA 4A3BB 4XQJA 2XHCA 5LJ5d 3M55A 1DOLA 1EIFA 1JORA 2NB0A 3H3VC 5KNDA 5ISRA 2RB6A 3MP8A 3D4RA 3S1NB 4O1NA 5CBAE 4PLLA 1EU3A 2Z4HA 5GAN8 2ICIA 4F7UF 4UAIA 2QTXA 1SYFA 3PUYA 3GTGB 3J7AF 3I4NB 3CMAT 5GAOn 3OSOA 3TP5A 3M59A 4FT4A 3W3AA 4FYDA 3P20A 1RJTA 5CCAA 4J6WA 3M5AA 3ITPA 3NHHA 4XU2A 2DXUA 2WB1B 3S2DB 4M7DB 1JICA 5DY9A 1WCMB 4J7FA 1GUSA 1I3QB 2XICA 4ZRZA 3T53B 4C56C 4IURA 1FYCA 1Z7TA 2DO3A 4C1NK 2RA2A 2VGNA 2LT1A 3J80L 3G7LA 4HEDA 3V2TA 3P8BB 1U9RA 1A2UA 4C3JB 2I07B 3PUZA 1O9SA 3OA6A 4G7HC 2KUMA 3JCMd 1ZQ1A 3CCJA 3DWAA 2ZTBA 1CQFA 1QVGA 3PUWA 2WKDA 2AUKA 2YU9B 2R5MA 4II1A 1EY5A 5E4XA 2RK2A 3CCQT 1SYDA 3MCAB 3MEUA 2ICEC 4ZYSA 5KGUA 1JC7A 5ELDA 1BQQT 4GZYC 1H641 5I2SA 2PUOB 5E3FA 2FYKA 2RH2A 3E19A 4HCEA 1PRTF 5EPJA 2A73B 1STHA 2A68C 4V190 3T56B 3OYAA 4M7AD 2KHSA 3OYYA 5GANh 5LJ5j 1UEBA 4OF1A 1D3BB 3VYUA 2K5LA 2K03A 3OYBA 1WTQA 2B8AA 3CKIB 4EGVA 2CZ7B 3E6ZX 2CS7A 4J6YA 5CQYA 3BVGA 1EYAA 1Y69U 3KK7A 5C4XB 1R8OB 1H9KA 4HTHA 4KKTA 3X25B 4DN4M 2PU9B 1VQMT 4QW2A 2ZXPA 3S15B 4H44C 3JCMP 2WACA 4ODGA 2FFKB 3P8HA 2ZPEB 4N4IA 1BCPC 3KLSX 3SXHA 2L55A 2ZT9C 3QKJA 3A54A 3D3RA 3C1FA 1I81A 1M4VA 2K5WA 2NLUA 3META 3RLFA 1X3QA 2L9HA 3PMIA 1TWAB 5KH6A 4E7LA 4WORA 4JS4A 1VQ5T 3P8DA 4M77F 4C3JG 1R9TB 4A53A 1DXMA 4HMJA 4M7AB 1Y96A 2HBPA 2A74C 2JZ2A 4C8QA 2DNCA 3CCRA 2M2LA 3M7NA 3DXJC 4I7ZC 1PZKD 1YCYA 4L5GA 5HKCA 2JYOA 2XWJB 4OB3B 3MP6A 4KD3A 5LJ3h 4EMKA 2PZTA 1CA6A 4ZLTF 4TRDA 4VUBA 3OMGA 4F7UB 2KQ3A 5LL6S 3PV0A 2B2YC 3DWQA 3K5NA 1GUGA 4CKCA 2D9UA 1KDBA 2R3ZA 2BIVA 4FXGC 1NR4A 1T5XD 4A4GA 4OO1I 4EQOA 1PRTD 4JRQA 3S9WA 4L63B 3HOYB 5FO7B 5LJ5e 4N0AC 4DA4A 3OYEA 1KDAA 4RG8A 2JNGA 3A8OB 4FF3A 4U68A 3GIBA 1GUWA 3Q22A 1F9SA 1Q12A 3HZXA 5C3XA 3QO3A 4EMHA 1DOKA 1JWUD 3FEOA 4IZ8A 4DXGA 2DK3A 5FOBB 2NN6G 2VUMB 2DIGA 1G3SA 3DEPA 4A54A 3MWYW 2K5QA 4JDSA 5CV8A 4J8OA 4N4GA 2LKVA 3ND8A 5ELBA 3OBWA 1EYCA 2JTMA 3JCMW 3OW2A 1BR9A 4MDWA 2AQ1B 4M75E 3L2UA 3RZDB 2ZCFB 1WNLA 4M78F 3C95A 3U9OA 4OGEA 2PNRC 2RJCA 1HA5A 1O7YA 1QP3A 1TVXA 4M77D 4CJ0B 3DUZA 1PRTB 2O4XA 1XXGA 4CKBA 1ILQA 5EBCA 2B2UA 1U4MA 2VNUD 4C92E 1X6OA 1U4LA 2WSEE 1B50A 3E1SA 4IN3A 1L0YB 2RVLA 4FO2A 4O42A 3DEOA 5GAN7 3S2HB 2EFIA 2VUBA 1NAPA 5GAN4 1Q7YU 3RD4A 3OYMA 4X3TA 5KE2A 2XRQD 4X9DA 5GAMf 3ASKA 4ME7A 5E4WC 3HEJA 3K0YA 4XIGS 3M4GA 5CQXA 2E12A 2FB7A 2M1HA 1Q1BA 2F0TA 4H13C 4PV1C 2EDGA 1DYQA 3QUIA 4KHZA 2BUDA 5C6AA 5JAVA 1BCPF 1JWSD 1PSEA 2B2TC 3PIP3 1V1PB 3ND9A 4BY6C 3TCJA 5DNFA 1X75C 1A3UA 1QG7A 3CPFA 5COYA 1HK9A 1F2ZA 2EAYA 3OQ5A 3SWNB 2MF2A 2D0QB 1ENFA 3URYA 4M77B 4XYQA 4RGNA 1M1GA 1IKLA 2H4OA 2NTSA 1QWYA 1AW7A 4JBWA 2F0PA 5CORA 1D5ZC 2NVQB 3E9FA 1IZ6A 4QF4A 3EJIA 4P5NA 1B4OA 1VQ9A 1F2LA 1G291 4OVAA 3E0JA 4E7IA 3V7SA 1YHQA 3C12A 4QQGA 5LJ5h 3QDRB 2O5JC 1XOVA 3EVQA 5T1GA 1F9RA 5JVG3 4M78D 1HXYD 5D6XA 2ZXRA 2L5TA 1CM9A 4HCZA 4C0ZA 4A3MB 1AZQA 4CHTB 4PJOC 3TMEA 4C0DC 4JLGA 1PZID 4A3JB 1T5EA 3ER0A 5CBEE 1BYMA 2A68D 1M9SA 3LYIA 3NE5B 1V29B 2HD0A 3J80E 1VQ8T 3CRLC 1XYIA 5CGKA 5KYLA 5FU7C 3BS1A 1TU2B 2MWOA 5EPLA 2HNIA 4XTWA 1YIJA 2NWGA 3HFNA 4C8QC 5GMKe 1N9SA 4IUUA 1LTID 2CW0C 5CKBA 1WTXA 2RJDA 1ET6A 1Y7XA 1WD1A 2M9VA 2DZ9A 4ZKBB 4J7IA 4FF2A 2X6GA 4HT9A 3HP3A 1X01A 2PVDB 4KKUA 3CPWA 2XU8A 4UC4A 2HQXA 1DCZA 1BCPD 1YJWT 1SFOB 4TSSA 1HCZA 5GAMg 1JRIA 2KDSA 2H3JA 4M77G 1GUOA 1M8AA 2F0GA 4RFBA 3VA5A 1HTLD 3ERQA 2X69A 1NR2A 5GAMd 1VF5C 2E10A 3PT9A 1VQLA 3JB9H 1FD7D 3CCRT 1B34B 3VR6A 3JCMJ 2EQJA 4ZKCB 3HOVB 4IFDI 1FGBD 1PFBA 2F5KA 3HRZC 1QNKA 2AWNA 4E7JA 2LX9A 2NN6H 5CKEA 2EIFA 2CYZB 2D6FA 4A4KA 3N6RA 4C3IB 2B2VC 4NP5A 4PQXA 1E0BA 2KECA 1AFPA 2R6GA 3OB9A 3HRUA 2XN9C 3RIRA 1SNPA 1BCPB 4JRIA 4LDVA 1PZJD 1QNUA 3MFGA 1GHKA 2XG8D 2LFNA 2CQAA 3J7YW 1ILPA 3DB4A 3AMUA 5IGBA 1KC8U 2E6ZA 4V0BA 4OB0B 2GF7A 5DLQE 1LLRD 2RDFA 1UNSA 5CR3A 3TZDA 5K36H 2EXZA 4XTXA 3H6ZA 2F1MA 3GPLA 3TSSA 3FRNA 4JS5A 2ZGWA 4K5VA 5CV5A 1Q3LA 4K5XA 3TN2A 3CCQA 3BY7A 1OXTA 4M78G 4KY5A 3QPHA 4YTLA 1ZBXA 2K32A 3Q6SA 4BI3A 3NBHA 3TZUA 3EAEA 3I3CA 5C0XJ 1F9QA 4EQNA 2LCLA 4HT8A 3RMHA 2K3YA 2Z1CA 3R3OA 2EJMA 3PGGA 1G8ZD 4KMUC 2E74C 3HRTA 1HUNA 4DK1A 4PJOF 3MXUA 4OB2B 4MIUA 1BI1A 3VV0A 3VUBA 3ZBDA 1IL8A 2IG0A 3CBOA 3GP7A 3MHXA 4EDUA 1VDZA 2SNSA 1KQSA 2PCFB 1TWCB 3MVVA 3VR4A 2RA4A 2CZ1B 1S5ED 1NUCA 1VQ7A 3PIPA 4C3IG 1LTAD 1A15A 4M7DF 2F0DA 1SMYC 5DM63 3F2UA 5GAN2 1D1IA 1Y8OB 1K9MU 1OO9B 2L1BA 3DM1A 5KNCA 3RKXA 4KJNA 3M3YB 2R7ZB 1UUPA 3D6CA 3IAYA 3OYIA 1PDQA 4DXFA 3KXTA 3X3NA 4QVZA 3MZ5A 4FIBA 3GD7A 5D3DA 2R5AA 1JOQA 1CHPD 2EJFA 5C0XG 3RZOB 1DM0B 2C9OA 2K04A 3K7AB 4J83A 2K5FA 1VQ6A 4HCSA 4LDXA 3OS5A 1WJSA 1JJ2S 3JAML 5CAIA 2K05A 1RTNA 2LTOA 1LT4D 3RUZA 1WTRA 4TVRA 1E2WA 2XDDA 4MDXA 1Q81U 1QOHA 3LGFA 1SE4A 2VYTA 1HQRD 1YHQT 4RG2A 4DQ2A 3V7RA 1HXDA 3L1AA 1LO5D 5JPMC 3GTLB 3GTQB 5ELEA 1RF2D 3T4AC 4C3HG 4WFN3 3JCMX 4HCCA 2D2CC 1G3TA 3L2ZA 3LW5E 1N27A 2IJ0A 2D9TA 3UI2A 3CC2A 1ZHIA 5GAMe 5KNBA 5IOCA 2EY6A 4NL3A 2NBFA 2RI5A 1IREB 3A8LB 5GMKl 3WVDB 4PJOD 1VIFA 3CCMT 2ID0A 1B9MA 4A3IB 1JOOA 4LD9K 2E2HB 1UGRB 2PZWA 4C5HA 3BW1A 1YIJT 4BY6B 1GUNA 4C8QE 3WDNA 1IHZA 5FU6C 3KUFA 3GNGA 3I8ZA 1S72T 1H9MA 4M7DD 3S1MB 4M75C 1NPPA 1P92A 2IVWA 2L89A 3J81E 1S5DD 1W2BA 3W2DA 2CW0D 2I2LA 1EQVA 4RGTA 1H9SA 1UGQB 2DTOA 2E70A 2E2IB 4LD6A 3VJPA 4K6LA 3RESA 2LCCA 2G3RA 4OGCA 3CD6T 1O7ZA 3FPUB 3QIAA 3JCMQ 4KKSA 1OXXK 2RSOA 1VQLT 1D6EC 4DFAA 4C92C 1UEAB 2FHTA 1MI2A 2JA6B 1A3TA 3EROA 4XXEA 3M4YA 1K8OA 1LTSD 4PJOB 4PKCC 4C0DB 4C5IA 1EZ6A 1SNMA 3RMSA 4C1NI 1HTPA 3INZA 2RI3A 4Z02A 2FL7A 3BDLA 4RMOA 3GTPB 2F03A 2HDMA 1EIHA 1S5BD 1M1KC 5FU7B 5CK9A 1WD0A 1N6AA 2BA0A 3Q0AA 1TQOA 2ZPFB 3HKZB 4E47A 3WVEB 1RDPD 4JRPA 3X24B 2L0CA 5HY6A 4N9PA 3GP8A 4RCCA 1G6ZA 3A55A 3L2RA 5L8RE 1M90C 4J1MA 5M9OA 1BUVT 1LTBD 2AQ3B 1KTKA 1SYBA 3H09A 4LJZC 3DWPA 4E7HA 3X20B 3DMUA 1J8IA 4LDWA 1M5Q1 3IKJA 3VYHB 1Q86U 2LS01 2Y4XA 2X4WA 5BN3A 1EY8A 4NKLA 1LT3D 1Q1EA 5CV7A 5GAMh 1N8RU 1OYXA 2E65A 2YLBA 1ZEQX 2EY5A 4Z9CB 2GQVA 1CQVA 1ET9A 2PZUA 3NWTA 1IKMA 2LT4A 1HFNA 1LV9A 1BI3A 2KVMA 5C44B 1G2SA 4G7ZC 4BE1A 2K2VA 2KVQG 1WTWA 4L6TB 2CZ0B 3TREA 3S1RB 1WGSA 3SVMA 1Q7YC 4X3UA 5CMDA 2JA5B 1PTOH 1UGSB 1KHIA 3V8LA 3S3MA 1VQ8A 5CV6A 5M3FB 4WRDA 3LWEA 1MGQA 3OYKA 3P75A 1IYUA 3VYTA 4M1UB 1GUTA 2CZ6B 2XKOC 4C2MB 3QJYA 4GLKA 2EJFC 5ELFA 1D1KA 1MBYA 4NOYA 1VQ7T 1WTOA 4FXKC 1SSOA 4BD3A 2RM4A 1EQTA 5I2XA 2NVXB 2EWNA 4M7DG 2F4IA 3OMCA 2FINB 1QP2A 3CCEA 4CI0C 1SNOA 5EBDA 1KD1C 4ZK9B 2DD4A 4DK0A 2P0PA 4FSXA 1KQ1A 1YJWA 1SMYD 3D6WA 4M75F 2TSSA 5CR2A 3GTMB 1G3WA 2DXBA 1XTDA 2JVVA 1O80A 3L2QA 1M1FA 1BXTA 4JK1C 3C4SA 4BDZA 2YRVA 1EWCA 5GAOl 1RHPA 4DNTB 4XT3B 5A0DA 1LTGD 2X4YA 3BDCA 3SD4A 1VQ6T 1H9JA 2DTIA 3CPWS 1JCKB 3D4WA 1DD2A 1U1TA 3G7ZA 4ZGEB 1SBBB 2E1HA 2EQMA 5D6WA 4C92F 3QYHB 4AYBB 2F0LA 1AZPA 4ULLA 4UDUC 4DA2A 2R61A 3E9GA 2C5CA 2E5QA 1I4XA 1G2TA 1H9RA 3M85A 1STGA 2WSFE 5EKIA 2LMCB 5JVH3 3MO8A 2CKKA 4J5YA 2OTLT 4OO1G 2WP8J 2QKIC 1SE2A 1BIAA 3CC2T 1G5VA 3LLRA 4J8QA 1FR3A 5GAN5 4ABNA 4A3EB 4X3SA 2KY9A 5DAUA 5A35A 3HOZB 5IAYA 1CT1D 3N5BB 1OZ3A 4OL7A 1TWHB 2K28A 2EJGA 2M0OA 1M8VA 2RHYA 4DNRB 3JB9I 2JOYA 3MEWA 5C5LA 1UAPA 5KIXA 3JAME 4QVCA 1U4PA 4A3KB 3M57A 3S6WA 3CU7A 5KNLA 2L11A 3UPUA 2M00A 3KBGA 5DM7R 5CC4A 3C1EA 2MPMA 3OBYA 3GV6A 3S1QB 4XTUA 2NN6I 3QZ5B 3AB9A 2JEBI 3GO5A 3AHUA 1QW1A 4MMKA 1Q82U 4KI0A 1TH7A 3AU7A 2DXTA 3L42A 4M8AA 2OEOA 3OPOA 1C48A 4A3FB 4M75D 4M7AG 3MXGA 4PNYA 1FNVA 5J26A 5IGFA 1SYGA 1S4ZA 2MP1A 4Q5WA 3HGBA 3A5ZB 2EKOA 1EY7A 5JEAJ 1EYDA 4HSPA 2PYKA 2EVBA 2QILA 2PMZB 4G57A 4F7UG 1ZXTA 3MEVA 1OZ2A 4C92D 1Y1WB 2RHXA 2TMPA 4RGOS 5J1ZA 3E5SA 4IQZA 4PMBA 4B08A 3SEBA 5GMKj 4ZN3A 3CXCS 3D8GA 1YI2T 1MSGA 3WOFA 2QA4T 5I2MA 3MA2B 3NQIA 2NYZD 4OMFB 3SB2A 5IGGA 1FWZA 4OP0A 3I56A 3CEYA 4BB7A 5FU6B 4IUVA 4M7AA 2SNMA 5KCOA 2B8GA 2EYLA 5JOBA 1ONLA 3BYYB 3M53A 3FIFA 3I70A 1WTVA 4M75B 4QVDA 3NP8A 1KC8C 4DF7A 3SK4A 1AHJB 3BYTB 5GANf 5IN1A 4EQPA 3M54A 3ONAB 2ENBA 3HRSA 5K5PA 4LDYA 2J0TD 4OIJA 3U9SA 5GAOp 1KLUD 2BDNA 4F7UA 3OYDA 5JEAG 3D4DA 2ZPIB 1WQ7A 3J81L 1QILA 4C92B 4E7KA 1Q90A 2J7ZA 2YHTA 1QJOA 1YJ9T 2R58A 5FK9C 1R4PB 4NMZA 1MSHA 5C4ZA 3R93A 4JUVA 2HAXA 2OF1A 2B63B 1TS2A 3A7AB 4BDYA 4PL6A 2JEAI 1B44D 3A56A 1YNJC 1BI0A 4IFDJ 4CKEA 4FNFA 1NJIU 1TIID 5EKLA 3CCMA 2PW5A 5FKAC 4ZAIA 3L7ZC 3WOEA 4F8MA 4BE0A 1GJXA 3ZEHA 3V8KA 1BDOA 4XU1A 4FXDA 3QB3A 3QZ9B 3I4LA 3NXWA 3A7LA 4KK7A 3FVQA 4CJ1B 5TSSA 2X4XA 4BS9A 5LJ3f 1S72A 3CCET 4EMKC 5D14A 1OXUA 4BWGB 1STYA 5C4JB 1QVFS 2VXWA 2QF7A 2VXEA 1H3ZA 3OW7A 2WKCA 3Q23A 5I4DA 2XDPA 5I21A 4B9WA 2NVTB 2RHZA 1RL2A 4M75G 5EPKA 4O5VA 1R4QB 4C5EA 5ELCA 1LNXA 3SK5A 3PFSA 3CD6A 4U673 3VYGA 4OO1H 2Y0SB 1HHVA 1K8AU 5IT9E 4IFDG 3RERA 2L5QA 1B2TA 1CI3M 4Q5VA 4XAXB 1VQNT 3GTOB 2L4NA 3NTKA 3R6OA 5GMKm 2M16A 2C06A 3T51B 1NZ9A 2QXFA 2JN0A 2EE1A 1V1PA 2RBMA 2DAQA 2ZPBB 2OAUA 1G3YA 4ZUJA 2NTTA 5F2DA 3WXMB 4BI4A 2QCPX 2Y4YA 4K2LA 2RJFA 4XTVA 3SWNA 5HGTA 3GLXA 2VGMA 3JCMb 4ME5A 4BUGA 5EJWA 1LT6D 2ZPHB 4M77A 4BA1I 3VR2A 2IX1A 4DOVA 1OI1A 2B8FA 3F70A 2NVYB 2B2WA 3OHXC 1JOKA 3IFTA 1I8FA 3HKSA 5G3LF 4HN7A 4IKFA 5KE3A 3SHLA 4TQUS 4R8NA 5GAN6 3EQLC 3PO2B 2KMTA 1XTCD 2B2UC 1N9RA 2YYZA 3OY9A 2WIIB 2VXFA 3PIO3 3QYGB 1K73C 2GCXA 2E6NA 2F3WA 4A4FA 4JJNK 3K5OA 3V05A 2MJ8A 3G4SA 3NPPA 2BDOA 4K8JA 2HDLA 1TY2A 4QIWB 4K2KA 1PFMA 1TWFB 1D5XC 3A8HB 3CMEA 2ZXOA 4EVOA 2K33A 3G6JB 3A8JE 4RKLA 5LHY1 2EYQA 1EWHA 3X28B 1B53A 4LK1C 2JA7B 3A8GB 5LJ3g 1QVGS 5GAMj 1VQ4T 5GMKh 3OS0A 5A0LA 3H6MA 2OXPA 2DY7A 2E41A 2JXMB 2RD1A 2V8KA 2K3XA 3OSSC 3S14B 1C4QA 2V8JA 5GMKi 4ZGDB 3M58A 4PNOA 2QEXA 1YJNA 4KUIA 3CCUT 4XTCS 1Y07A 4Y91A 4C8QF 5A0GA 4M78A 1WTPA 3I56T 4RA8A 3RKWA 1FNUA 5LJ5f 1EY6A 3GTKB 1RKNA 3HPWA 1EOTA 4F88A 4KY6A 4DOWA 1YITA 1NPRA 3O13A 4IUTA 4FF1A 3HP9A 4II2A 4FVMA 3CCVT 3OIQA 5G3LD 2DN8A 1LOJA 3EFSA 2BCOA 1LT5D 1PXUA 4HSVA 1VUBA 3NTIA 5AYFA 1STBA 2IT1A 3I90A 3FDTA 5I2YA 3QXEB 4R8IA 2J4XA 4K6DA 5DEHA 4FM4B 2XRSD 4R56A 4QUCA 1S5CD 4FL6A 3VYSA 1N8RC 1SAPA 2KEDA 4IUNA 1QB5D 5IGCA 2Q8TA 4PMCA 4N4HA 3SE0A 4C0GA 3BDOA 2PQWA 4XU3A 4H7BA 2X35A 3TP7A 3T9NA 2OTLA 1TWGB 4PMWA 2K7VA 2E2DC 3MXPA 4KJOA 2BKDN 3MC0B 3I72A 5EKKA 2XVSA 1QE6A 2VC8A 2K57A 3PNWC 2OTJA 1PRTC 2WSCE 5M5XB 5EGTA 3JCMf 5DM73 1VF7A 3OWFA 4C0FA 4A93B 4WF2A 3Q24A 3JB9F 3MHBA 4MN3A 3FJPA 2KCCA 4BA2I 4G7OC 3FC3A 4OGQC <