5FLXE

Mammalian 40s hcv-ires complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
257
structure length
257
Chain Sequence
ARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
molecule keywords 18S RRNA
total genus 36
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00467 KOW KOW motif
E PF00900 Ribosomal_S4e Ribosomal family S4e
E PF08071 RS4NT RS4NT (NUC023) domain
E PF16121 40S_S4_C 40S ribosomal protein S4 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5flxE03
2.40.50.740 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5flxE02
3.10.290.40 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A 5flxE01
1VQ4T 1VQPA 3A5ZB 1Q86U 1M90C 3CC2T 1S72T 5J3BA 3DB4A 1N8RU 1VQ8T 3KBGA 3CCJA 1VQ5A 1KC8C 3CMAA 1M90U 1Q86C 3G4ST 1KD1C 1EIFA 1Q81C 3CD6A 1XNIA 1M1KC 3CXCS 1YIJA 2L3RA 1KD1U 5DM7R 2G3RA 4ZN1A 1KQSA 1BKBA 2JUFA 4TVRA 1N8RC 1M1GA 1Q81U 1JJ2S 1VQ7A 4YTLA 3DB3A 3CCUT 1YI2T 2EIFA 1W2BS 1KC8U 2IG0A 3CCQT 1YJWA 1VQKT 3OW2A 1UEBA 5HY6A 3CCVA 2JOYA 1YJWT 3CC7A 1VQ4A 1YJNT 1VQMT 2QEXA 1VQ5T 1VQ9T 2MWOA 3CC7T 5A2QE 2KDSA 1Q7YC 1K8AC 1VQ7T 3LH0A 1YITA 4QQDA 1SSFA 3DLLA 3CC2A 2E70A 1VQPT 5J26A 1YJNA 1W2BA 1K9MC 3CPWA 3CCJT 1RL2A 1QVGS 2E6ZA 3JAME 1S72A 3TREA 1IZ6A 3PIPA 3CC4T 1KHIA 3J81E 3CCRT 1VQKA 3CCLA 1NJIU 5LL6S 1K73U 3CCMT 1K9MU 1VQMA 1JJ2A 3CCUA 3CXCA 2LCLA 3OYYA 3I55A 1NJIC 1QVFS 2CKKA 3LGFA 3CCVT 1YITT 1KQSS 1Q82C 2LQ8A 1QVFA 2QEXT 3CMAT 3I56A 2MI6A 2XHCA 1QVGA 1NZ9A 5DLQE 2KVQG 3ER0A 3PIOA 1Q7YU 3HKSA 1K8AU 1YJ9T 4X34A 2DO3A 4CRIA 3CCQA 1K73C 3CPFA 5FLXE 1Q82U 5IAYA 1YI2A 3G6EA 2OTLT 2JVVA 3J7AF 1VQ8A 3CMEA 3I55T 1YBYA 1YIJT 3G6ET 2OTLA 3J80E 5IT9E 3LGLA 3CCEA 3CCMA 2MWPA 1VQ6T 3CCET 3CCST 1VQLT 2JNGA 3G71A 2QA4A 1VQOA 1NPRA 2OTJA 3G71T 2LVMA 2QA4T 3OW2S 1VQOT 1YHQT 3CD6T 1XTDA 1VQNT 3CPWS 1X6OA 3G4SA 3P8BB 1YJ9A 4RG2A 1VQNA 1NPPA 1VQLA 3CCLT 3CCRA 3CC4A 1YHQA 3CMET 4ZN3A 2OTJT 1VQ9A 3I56T 1M1KU 3CCSA 1VQ6A
chains in the Genus database with same CATH superfamily
4RA8A 1FX7A 2BA0A 3I4NB 2JYOA 3F2DA 2NVYH 3FVQA 4NXND 2IX3A 2LJ1A 4MMLA 4QQGA 1WJQA 4RUGA 1FGBD 2D8HA 2IHEA 1RLQC 4EGVA 1N33D 2B8AA 3KBGA 3QJYA 1TU2B 4YY3L 2F4IA 4APVA 2ZM6L 4PJLA 3QG1A 4MN3A 4PFPA 5LJ5j 1C1AA 2ZPIB 5GJWB 4HIOA 1Y1WG 1B9NA 1A3TA 5GAN8 4TQUS 2CP6A 2HCCA 4X64D 1A15A 1VMPA 1B7TA 2VY3A 2KHIA 4OO1I 4JRIA 4JZ3A 3JCMW 1GUWA 5HCKA 5GAOr 1N8RC 1PFNA 2DN8A 1L0XB 4DBRA 3T51B 4IJLA 4GOPA 3UF4A 1I81A 4NL2A 3NSWA 3PUXA 1I6HB 1H92A 3KK7A 2LFNA 3QDRB 1G2SA 5KCOA 3NXWA 5C5MA 2EPBA 4XAXB 8AT1B 5IY0A 2FPFA 3OY9A 4YWKA 5LMNW 4AYBB 4FT4A 5M3FB 1Y8NB 2XG8D 3J81i 2R93G 2M0YA 1B2TA 1IHVA 4LK1C 4K2LA 4PFOA 4XTCS 3D31A 4ZNXA 3S24A 2YUNA 4X1VA 2PTKA 3K57A 1YHQQ 1BQQT 4XT3B 2CSIA 3J7ZC 4DV7Q 4HVUA 5IGFA 2YDLA 2E70A 3J7A5 3BU2A 2P4TA 1N9WA 2VZAA 2YLCA 1CHPD 3L2ZA 5CKHA 5LJ5e 3CMAQ 3L7ZC 5ELNA 4ZK9B 1AE3A 4KY7A 2EXZA 5JEAH 1S72A 2P84A 4BY6C 4BI3A 3JCMc 1IYVA 1VQKA 4M78A 5M3MH 5GAN4 1XNRL 1YJWQ 3VUBA 4LJZC 4JI3D 1K73U 3IAYA 1E6HA 2F4VL 1SYBA 3EGXB 1EUJA 2HIXA 2DGYA 1AP0A 1EY6A 4M7DG 2J7ZA 1G5VA 3EFOA 1UDLA 5EAYA 1H8KA 2A74C 4M78D 2VYTA 2MO1A 1W3SA 2NTTA 1YNJD 3S2HB 1QVFA 1G6ZA 2UUAD 2RSNA 2YUQA 2EZVA 2FXQA 4R4IA 2ZCFB 4P2CB 2KE9A 4OIJA 3BZKA 2HL3A 3OSOA 4V0BA 3UI2A 4A3IH 3CQTA 4II2A 2FFKB 4M7AE 1K8AU 4B3ML 1Y57A 4E7JA 1HR0D 2EWNA 1E24A 3J7AF 3H0GG 2GQIA 3SDZA 4IALA 3JV3A 5IODA 4C5EA 5D6WA 4JBJA 5I21A 1T9HA 1VQLT 4X9DA 2BE9B 5CKFA 3GNGA 3AMUA 3RKXA 1PFSA 3H0HA 2XD0A 1ZXTA 2KI7A 3I7FA 3BE3A 3PO2H 1HK9A 1RI9A 3KDFB 4KV6A 2OX7A 1PHJA 1GCQC 3T1HD 3PUZA 4J15A 4OIKA 2UUAL 2X9HA 3RIRA 1GVPA 4M1UB 3NP8A 3S3OA 3PF4A 2ESWA 3CKIB 3GQBA 4L5RC 3GD7A 1PTOF 2UXCQ 2E1HA 4L8JA 4X9CA 1PYBA 4CKBA 2LQWA 2J6FA 4DAYA 4X64Q 2YTXA 3H6MA 3O13A 4H0LC 5F2DA 2RH2A 3JCMh 2K7VA 4RGOS 5COYA 3K5MA 1M8VA 4DV1Q 4UPAA 3RMHA 1I1JA 1O7LA 5GAOm 5IIFA 1ZHIA 4X62L 4JV5L 2DIGA 4QVZA 5FRNA 4NKLA 1EIFA 3M0TA 1KQ1A 3X25B 4C1NK 1H95A 2JA8B 5I2MA 1UUPA 2PW7A 3F8TA 2DD4A 4K14A 4BA1I 2QDBA 1BKBA 4ORZA 2AKWB 1NEGA 1FNVA 2QILA 5DEHA 1IW7C 4KN4C 3FPPA 2O2LD 1KNAA 5NUCA 4CKCA 4DUZQ 1HR0W 3PO3B 2JN0A 1A0NB 3ONAB 4ZYSA 4LF5Q 1X75C 1Q81U 4JZ4A 3U9SA 1G2BA 1S40A 1J5ED 3CCUT 5CC4A 1EFNA 2XDDA 2C35B 3LWIA 2K05A 2MNAA 1S5DD 3RKWA 2LTOA 1HCZA 2E2JB 2EY6A 2F0FA 4HCKA 4MZMA 2ALYB 2F0PA 3PMIA 3OYDA 2VXWA 3SK8A 3L2PA 4JI0D 2EYMA 4RCNA 1IBMQ 5FLXL 5IYCH 1PH6A 2B8FA 1UJ0A 3NHHA 1PH4A 1NR4A 4O1NA 3W1GA 5C6SA 1X54A 1AT1B 1MMAA 2EGEA 2UXBD 1YITA 4A76A 1Y71A 3CC2A 3L9AX 1RF2D 1VQPT 1S4ZA 4X66Q 2CUBA 1LOJA 3EGXA 5GAN3 2NWMA 1YIJQ 1V76A 3RERA 4PJOD 2NZHA 3OIPA 5CKEA 2JTFA 1FKAD 2Z1CA 4BDYA 4DR5Q 1D0YA 3CC4T 3CCLA 2Z9HA 3NFCA 3DM1A 3TRZA 4EMGA 3OW7A 4NXNQ 1NJIU 4NXMD 3CCMT 1SRMA 3KUFA 3QYHB 1P92A 3WVDB 1EQRA 1OI1A 2PVOB 3LYIA 4B3RQ 2LCLA 4XU1A 2KHSA 2L4NA 5KYIA 3HOVG 3MA2B 3EGDA 2SNMA 4DUYL 1T0JA 3F2UA 2JEAI 4IN3A 1IXDA 4L6TB 2BE5C 3JCMe 3M4QA 1KNEA 4ELZC 3RR5A 2D6FA 1H9RA 3T4AC 2KJXA 1LJOA 1VYUA 1GFCA 2B2UC 5FWCA 1LM0A 2RNAA 1WX6A 1PCXA 1PRMC 1FL0A 3J81c 2UXBL 1C6VX 5FLXE 2DNCA 3VR5A 1YI2A 2E5LL 2CH4A 1ICFB 4JI5L 3RLNA 2UU9Q 2DILA 2JA7H 4JI4D 4EVOA 5JAVA 4DV4D 4P71A 2QYZA 4A3LH 3J80E 2RQUA 2G5DA 1PYSB 3JAML 2F3WA 4DN4M 2HHHQ 2IX1A 1VQCA 3HOVH 2KTLA 4XT1B 4JI5D 2JNGA 1YI2Q 2L9HA 2JT4A 2PZWA 5ELEA 5GAOl 1Q82R 4RTZA 2OTJA 1U4MA 2LKVA 4AQYD 2DL5A 3OW2S 5AYFA 3PVQA 4HXJA 3JCMX 1TWAH 2EY2A 1UGPB 1Y0MA 2D2CC 3M0QA 4GN3B 4Y91A 3LWUA 3QOJA 2KBNA 4BB7A 4ILWA 1OO9B 2JE6I 4HN7A 1F9RA 2F1LA 4OO1H 1FJGD 2K9GA 2MPXC 3C94A 3PCOB 1VQ9A 1R9TB 2CVRA 2QASA 3X26B 1D1KA 3P20A 3CCSA 4F8MA 5LL6X 2K5VA 1P9KA 1IXRA 1C0AA 4HSVA 2KCNA 4YHHD 2MJ8A 4DOVA 5GMKh 3PMFA 4DR3Q 3REBB 3M56A 2MPMA 1NY4A 4AFQC 5KNLA 2KRNA 3CCJA 1LTTD 4WRDA 5D6XA 1HUNA 2Y4XA 2GVAA 4J7FA 2DF6A 5KH6A 3CRKC 1AEXA 1J5EQ 1TWFB 2UUAQ 2EPDA 4RTTA 1YIJA 2HT1A 2E2JH 2RK1A 2ROTA 3K59A 1ENFA 1K8OA 2G3RA 4F7UF 3FJPA 3H91A 1RUWA 2WSEE 3NWSA 4ATOA 2IPKD 3NWTA 1O9SA 3M4PA 5ELOA 1BOSA 4O0AA 4BA2I 1U8RA 5KNBA 1VQ4Q 4C5GA 3V8KA 2HIVA 3DB3A 1SHGA 4DV0L 1ZBJA 1XX8A 2UXDQ 2LJ0A 2RJFA 3OYIA 4XQ3A 2HSEB 2CGHA 2WSCE 1KC8U 1VIEA 1U4PA 2CP3A 2A6HD 2DJGC 1RD9D 2BCOA 1VQKT 2JM8A 3GIBA 1UEBA 3S16H 1MNEA 1Y8RB 1OTCA 4DV7L 4F7UA 1VQ4A 3PO3H 2PQWA 4B6MA 3JRZA 3OQ5A 5GAOn 2IPOB 4H02A 3ZJYC 2HSPA 1E6GA 3QXEB 1Q7YC 3HOZB 3LH0A 5M5WH 1Y14B 3R2IA 3S1QB 4TSSA 4E6IA 4B3TD 2ENMA 5JVG3 1CZGA 2JA6G 4GN4B 1FXXA 4ZKCB 2ZPHB 3S1QH 2VW9A 4HCZA 4N0AC 3JB9D 1D09B 2EY1A 4J9DA 3A8IE 1XJVA 4RTYA 2J6KA 2MYSA 1VQMA 5GAN7 3QOLA 5I2XA 3J81L 4ME3A 4GOPC 1WHJA 4CC3A 3UA6A 1NBWA 1G8ZD 1MMGA 2MP1A 1S1NA 4JJDA 1PNJA 1GXDC 2V1QA 1KSWA 1V8QA 2R5AA 2KECA 2N49A 2ROLA 3A8KE 3N52A 2YRDA 3TP8A 3M4OB 1NUCA 4C2MB 2NVQB 5CR3A 1SSOA 1GUSA 3NQTA 1RHPA 4CKEA 4HIDA 2ES2A 1PD1A 2BIVA 2ENBA 5CKDA 2HHHD 2KVQG 2W10A 2CQOA 4E7HA 1GM5A 3JCMb 4KULA 3SD4A 2X3XD 5ELBA 1TWAB 2EQIA 1TWHH 1SFOB 1EY4A 4C3HG 2J05A 1SN8A 2EJFA 2ECZA 3M59A 4PMBA 1Y1WB 2F0JA 3RD4A 1I5FA 2EJGC 1GRIA 1YIJT 4RTWA 3LGLA 1L0YB 2LXKA 4JRKA 2Y4YA 2KEAA 1X3GA 1N33Q 4F87A 4C92G 1KDAA 4XQNA 1QWEA 3CCST 3DWQA 3S1MH 1C06A 3MXGA 3WOFA 4KI0A 5JEAG 3HOZG 2JA5G 1RI0A 1B50A 3A1PA 3S15H 2R92B 1MV0B 1VQNT 1ZLMA 2VXEA 3GTOB 2IVWA 2EYJA 5C4JB 3GTMB 2DJQA 3JCMJ 1BXTA 1BVSA 4X64L 1VYTA 1PH2A 4AG2C 2DLPA 3CU7A 2OT2A 1KRSA 1LT6D 1IO6A 3GOXA 1VQ4T 2B2WC 4C0DB 2R7ZG 2AK5A 4MDXA 3A55A 1NLOC 3CCJQ 2PZ1A 1TWGH 2AUKA 4OXPA 3URYA 5CBEE 4JI2D 5L23A 1UTIA 4R4QA 4J6WA 2MGSA 1HJPA 4LF7D 3FEOA 1KC8C 1EY8A 4J1MA 4JBKA 1ILPA 2KYBA 4MZPA 1O78A 3E0EA 2EYLA 1ET9A 1KD1C 1TXQA 3DKMA 1VQ9Q 1Y8OB 5C3EH 1STNA 5EBDA 3W2DA 3SEMA 1D3BA 4DV3Q 5KEEA 1IBKL 2K5QA 3JC66 2EJ9A 2YLBA 4IUUA 4RCCA 2AKLA 5ELFA 3A8JE 1GCPA 1N32Q 2V26A 3A0JA 4DXGA 1CZWA 3G7LA 1E7OA 1TWFH 2CZ6B 3ULRB 5C3EG 2EBPA 3WOEA 3H94A 1CSPA 2ZPGB 4LF7L 4PJOB 2H5XA 1WDXA 2E2DC 1C4QA 1Z47A 2CS7A 4MNOA 3LX0A 3HSBA 4OL7A 4XIGS 4C0FA 2CP5A 5CCAA 1HXYD 2V8KA 4LFAQ 4JI8L 4JI2L 1RAGB 4IPGA 5C0XH 1Y1VH 2FYKA 2LZ6B 1WTVA 1FMKA 1O7YA 3ND9A 4RGTA 3M85A 4PJJA 5FKAC 1PYWD 4KK7A 1L1OA 3MZ5A 1NYFA 1LTBD 3L2VA 3J80i 2OAUA 1JB3A 4DR5L 1FJGQ 5C4XG 2VB3X 1LPLA 4AQYL 4ZKBB 1ZSZB 1W2BA 2ZT9C 3KLSA 5IP9H 5C6AA 2B63B 1NSNS 3META 4XYOA 5D3IB 1S5CD 2PUKB 1R77A 3GLXA 2ZM6Q 2A19A 3K7AH 3HOZH 4PLIA 1EFID 3CMEQ 2Q8RE 2OQ0A 3D7SB 2OQKA 4DGZA 4C5HA 2HL5C 1D1CA 2AIRB 1YWOA 4A4GA 4DR7D 3KFVA 1FYNA 4WCIA 4FU6A 4OB1B 5C44G 3FKIB 1KQSS 1WD0A 5CBAE 1JR0D 1M2OA 1SYFA 2EJFC 4OF1A 2EE1A 1KHCA 4FYWB 1YNNC 1BI1A 1X3EA 4M75G 3V05A 3OYHA 2ISTA 3FMCA 1Z9ZA 3L2WA 3ER0A 2VL6A 4OGEA 4FF2A 1OXSC 1SYDA 1X27A 5FROA 3OYCA 1MMDA 5C4XH 2SEMA 2VQFL 4NL3A 3G6EA 2K52A 5C44B 4LN2A 2CHBD 2F0KA 4QMGA 3BJUA 2FEIA 3I55T 2GBQA 4LUDA 5IT9E 1HZCA 4FM4B 3CCEA 4BDZA 3OB9A 4JI6D 2J7IA 1DCZA 3PIP3 5BN3A 2H3JA 4PZ7A 2COZA 1WXUA 4EMHA 1AZGB 2DL4A 1YHQT 1TKWB 4G7ZC 5LMND 4AYBG 1XTDA 2PQEA 5KYWB 3SHLA 2UUCL 1WQWA 1AHJB 3EG1A 4RG2A 1QCOA 4A4FA 3RR6A 4HTHA 3M4GA 3DM3A 1ONLA 4A4IA 4X65Q 1WYXA 1GCQA 2AZVA 3UE0A 3WXMB 2LXJA 1NE8A 1PTOB 4X3UA 1WXBA 1WHGA 2A68D 4K0KQ 2O88A 2QXFA 2NN6I 5CV4A 4AH6A 2PVGB 1B70B 2H3EB 4C92C 2FJ2A 4KKUA 1D2BA 4LUEA 2R92H 4XU0A 1I5OB 2PU9B 1LV9A 4DV3D 2EYWA 5AJ3L 1J5EL 4RTVA 3OS0A 5C4JH 4JI7L 3JSCA 1IRXA 4PJOG 1DJRD 3UE1A 2E2IB 2A5HA 1WXTA 1AZPA 1I4K1 2IT1A 1IL2A 2LP5A 1F77A 1Q81C 3VYTA 3S2HH 2NN6H 1KD1U 1M4ZA 1ZQ1A 2VGMA 5CO7A 5DM7R 1M30A 3PUWA 4KT0E 1I94Q 1PH3A 4N4GA 1T5XD 4C3IH 4GLXA 3GTJB 4QQBX 5KYUA 2DL3A 2RQTA 3T16A 1SJHD 2L5TA 3GTQB 5IYBH 5FU7B 3G71Q 1U9RA 2GTOA 2QGGA 4N4HA 4YTLA 2PZTA 2MIOA 2FG0A 4QT7A 3V7SA 4F14A 5FU7C 1FD7D 2EIFA 1W2BS 2F52A 2ID0A 2E4HA 2IG0A 3H6ZA 4FL6A 4KGXB 3CCQT 4CC2A 2CP2A 3IFDA 5KYYA 2ZPEB 2PMZB 4FDBA 3OIQA 1CKBA 1UEAB 2M16A 4M78F 1EY9A 4B08A 4A3GG 2JS0A 4AMCA 4RKBA 2VS1A 3CRLC 5JJZA 3SFMA 4J5YA 1CHQD 3DWPA 4PJOE 2JA9A 3G4SQ 1Q81R 3HOYG 1PRTD 2YV5A 3M0UA 1F2MA 5ISRA 5GAEC 2F0TA 1XWEA 1YJNA 3FKIH 1OXXK 4JCVE 3CPWA 1O7ZA 5IWAQ 4JI0L 3KLWA 4LAAA 1FNWA 2C9OA 1VQMQ 4OB0B 1OXTA 3TREA 2B86A 4E7IA 1D1IA 2QGFB 2V4DA 4JI2Q 3TDQA 1KLGD 3UDCA 1MJEA 2R6GA 1BCOA 4X3KA 1PRTF 4Q5WA 4F7UG 2CW0C 4C3JB 2WACA 3CCUA 1IB8A 2Z6KA 1ESFA 4FW1A 5C4XB 2X35A 4A3CH 4J7IA 2ZGWA 2CKKA 2KROA 2RCNA 3C46A 4LFBQ 2JA8H 3OPOA 2YT6A 4AQYQ 2RHQB 3H3VH 4DV6L 4LF5L 1W6KA 1WI5A 5DLQE 1FWZA 4M7DA 1LYLA 1UWVA 4IPDA 5EKKA 1BIBA 3P1HA 5M3FG 2EQJA 1QE6A 3NENA 5IP9G 1Q82U 3K58A 1PH8A 3I90A 3E0JA 1BU1A 1LT3D 1N33L 1UE1A 3I91A 2RK2A 4IKFA 3VUZA 3IL8A 2DXUA 1PH7A 3SHWA 1FNUA 3DEOA 5C0XI 4E2FB 4A3LG 2EYHA 1K9MR 5LHY1 1QJOA 4XU2A 3OOCA 1QZHA 1PTOH 3HOWG 2VB2X 2K33A 4M77E 3DHQA 3MXUA 2WIIB 1VMCA 1V9PA 3G71A 3CXCP 5CKBA 1QNKA 3BG3A 2FINB 2QA4T 2LVMA 1N34Q 1M3BA 3I5SA 4C8QA 1L2FA 1NMGA 3RLOA 3CQZB 4FYDA 4LNPA 1AZQA 2KT8A 2TMPA 1YJ9A 3ZFJA 2RI3A 1VQAA 5C0MA 3L42A 4NXNL 4OMMA 3C1EA 1L1OC 2KYMA 4ZGJB 1PFBA 3GV6A 2XTIA 5GAHC 1CUKA 3E9GA 2KCCA 3VS7A 1N9SA 1TWCH 2G9HD 4P5NA 4ZQ3A 4JI3Q 4LF8L 5GAN2 2DNEA 3KBXA 4XDXA 1TXYA 1UE9A 3I5RA 5CR2A 3BVMA 2ED0A 4A3EH 1JJCB 4B3SQ 4KH1B 3KOJA 1QNUA 4H44C 3THKA 2ZXPA 2H1EA 4PMWA 4MTNA 1GFDA 3S2DB 2VGNA 3M9QA 4LFCL 3RUZA 3M58A 3QSUA 3NGPA 3NBIA 1W70A 4GS3A 3S9WA 4N8X1 2M9VA 3C4SA 4OMNA 3UT1A 3SE0A 4JYAQ 4DR2D 4PJMA 3BW1A 2PO4A 2RBMA 4TRDA 5LJ5f 3U23A 1ZEQX 3E9IA 1MJCA 2B2WA 1H3HA 2HD3A 4XQQA 1SMYD 4Q5VA 4JI6Q 3H8ZA 2DM1A 2DEUA 1GD7A 4BY1H 4GKJQ 2JTMA 4RMOA 3I2ZA 3SXHA 1XMQL 3HOWB 2CSQA 2DTIA 2RI5A 3M3YH 3BYTB 1VQMT 4JJBA 4ZUJA 3A8LB 1VQ7T 1HH2P 3MVVA 5FLMG 1JB0E 3F2CA 4OX9L 5I9PA 3I4NG 4X65D 1RAAB 2EQMA 1K3BC 4QIWB 1PKSA 4DU9A 4NPSA 2ZPFB 2L55A 1OZ3A 2KQWA 2RM4A 4RGNA 4C0DC 2CDTA 4BBSG 3PO2G 3ULJA 1NAPA 3EROA 1ENCA 4BE0A 2DYBA 4QY7A 4RG1A 3I73A 3OYFA 4R9WA 1S72T 2L3PA 3ZBDA 2XU8A 1BYMA 2DBKA 4XTVA 3I55A 4QVCA 1RJTA 2HKQB 5C0XJ 1HZBA 1PLFA 1BDOA 4X6AH 3OYMA 3WDNA 2EQUA 2JQOA 1AH9A 3PVLA 2NUZA 1EZ8A 2D8JA 1U1TA 3TP7A 3HOUB 1YITQ 5G3LF 1Y8XB 5DNFA 1A62A 3HFZB 5IP7G 2Q2IA 1BK2A 2EGAA 1EU4A 1WCMH 4RCBA 1AEYA 3HZXA 4PJOC 1GBQA 1XNRD 1LUZA 3TQYA 1D3BB 4NS5A 1II3A 4YHHL 4OB3B 3FRNA 3HP7A 4HKEA 5G3LD 1AWXA 5GANg 1B53A 3ULLA 1VA7A 3KUPA 2LQKA 3S16B 2KXCA 1T3SA 4JK1C 4R4OA 1RLPC 4A3BH 2KMTA 1XPUA 2F4VQ 2JJQA 4A3DH 2B2TC 1NTGA 1Q8IA 2M2LA 1M9SA 5D6YA 1C9OA 2A69C 2WB1G 2VKNA 2COWA 1IL8A 1YHAA 4JLGA 2Z6KC 3SGIA 2OI3A 4X66D 2HZYA 3LLRA 4M77D 4R56A 3CCRA 1TUCA 3V7RA 1VQIA 4A3EG 4ABNA 5CQYA 2QAZA 2KCTA 3HFOA 3BYYB 1WD1A 1HNZQ 1DONA 2PW5A 4QCLA 2ZXOA 3TZUA 1K4US 2JA6B 1RAEB 5IHKA 4JBWA 1I6HH 1GUNA 1SF9A 1H9KA 4NXMQ 1OYXA 2F5KA 5HGTA 3CQZH 1VQBA 1MSGA 2A6EC 3L0OA 3TBIB 2K04A 1VQ8Q 4C92A 2B39A 3F2BA 1N32D 1UJYA 1YFNA 1HZ9A 1Q86C 2RCFA 2FZCB 2RD1A 2RQRA 3LH5A 5KYWA 2XN9C 2ZJPA 1H641 1JRIA 1JO8A 3CXCS 4XYQA 3R2TA 4HJ5A 5CQXA 1EWHA 3CEYA 5FO8B 3K0XA 4C8QD 2RMOA 3GBQA 2IL8A 3K5LA 1C05A 5FU6B 1XMOD 2EGCA 4J9GA 2ZJRA 3TS2A 2WKCA 1TVXA 3L3OC 3EH2A 1NM7A 1E0BA 2WAQG 2MF2A 2P0QA 3TQ7P 4F04B 4KHPD 2R58A 1VQOQ 1VQ7A 1H9SB 1JORA 1RTNA 1I4HA 2D0PA 1PD0A 4ANJA 5IHNA 2L2PA 4PJOF 1MHWC 1TT2A 3BDLA 2N3SA 4OMLA 4YIJA 4A3JG 4YY3D 2ZM6D 3KF6B 1F9SA 3MFYA 4LF9Q 1KAWA 2ZTCA 2E2HH 3HHTB 1XNQL 4IURA 3PQIA 5CIUA 2I5LX 4DR1L 2OWOA 4RG8A 1PM3A 4KH0B 1ZYRC 3EJIA 2ZPBB 1R0BG 2DZ9A 3HFNA 4F17A 4I7ZC 1WJRA 4KHVA 3O5ZA 1DOMA 3GTOH 2YRVA 5A2QE 1SNOA 2QCPX 1MKHA 4L5TA 3GTGB 5GAMj 5FQ2B 4NDXA 3DLLA 1B3AA 5IOCA 1SPKA 2E5KA 3EGUA 1U4LA 1JC7A 2OF1A 4DV4L 4N9PA 4GLVB 1M8MA 2DZCA 4KMUC 2XI9A 2XNAC 1NNXA 4UDUC 3I4MH 1HR0Q 1WTOA 1W1FA 1IZ6A 1A3UA 1KHIA 2EQSA 4JYAD 2F0LA 3H09A 1K9MU 1GHJA 3OMGA 2K5NA 1LTSD 2K6PA 4WJ4A 4BXXG 3QDFA 1SNCA 1HFNA 4KY5A 1UECA 3FJ5A 5BR8D 4RAUC 3S1MB 2KUMA 3ERQA 3ICEA 2MO0A 4W5VB 2K2VA 1RDPD 2LQ8A 5GAGC 5GANe 4X65L 4HAEA 1D7QA 1WFWA 4J6HA 1IKLA 1IBLD 3TZDA 4ESRA 1HNXD 1X32A 1RKNA 2EOTA 3QB3A 4CHTB 3EBEA 4ZGEB 1TU0B 1STHA 4MMKA 2GF7A 1EWCA 4NB3A 1VQHA 4A3DB 3BVZA 2KENA 5GMKl 1YJ9T 2DO3A 1W2BP 3CW2C 4KD3A 5I22A 4DKAC 3PFSA 2RQXA 1JJ2P 2XRSD 3FIFA 1Q86R 4P73A 4RHSA 3JCMQ 2I0QA 4Z9CB 4OMQA 4M75E 4QKUA 1EZ6A 3ZYYX 2I5HA 4C1NI 3N6RA 3A54A 3JCMV 1VQPQ 3CCMA 2FPDA 4BBRG 3L2UA 2F03A 2O5IC 4FYXB 3A56A 3MJXA 1J9OA 3PT9A 1GXIE 3AFQA 2JK8A 2XSCA 3NTKA 4HEDA 3S3NA 3ITPA 1OX8A 5C3WA 4PNYA 4FF1A 4L63B 1SG5A 2DY8A 1VQEA 5A2QL 3C0CA 1Z7TA 5FOBB 5IP7H 2WKDA 4DUYQ 2YWWA 3SEBA 1MGSA 3S1RH 1I94D 3SK4A 3M0RA 1GL5A 3MWYW 4LF8Q 2QK0A 4XTZA 4RKUE 1AN8A 1YZ6A 3VS3A 1WNLA 3BFMA 4KN7C 3CCUQ 5KE3A 2UUBL 2L11A 1Q8KA 4Z8AA 4ELYC 1VQ6A 1JICA 4BI8B 3G6JB 3X3NA 5DM73 2D0NA 3OHXC 2JA7G 3A8HB 2GN5A 4E7ZA 1ML0D 1XMOQ 3FDRA 2QI2A 1FVIA 1N8RU 3I72A 3V96A 1U0LA 1HA6A 4Z89A 1VQ5A 4IIOA 3CMAA 2HCIA 4A93H 1TOVA 5ECAA 4LFCQ 3VDYA 3E9FA 2TSSA 1RCVD 4QQ6A 2JA6H 2COYA 1JXMA 1RTOA 1E3PA 4NOYA 2R7ZB 4ZN1A 2DY7A 2L15A 3JCMd 4RCOA 5FRMA 4FF3A 2P0PA 4GBQA 4TVRA 1SE3A 2YSQA 1GO3E 1JWUD 1I8FA 4CC7A 3GTQH 4B3SD 3PNWC 3PO3G 1CSQA 1UB4A 1Y96B 4DNIA 4IJHA 3JCMg 4DV2L 3TN2A 2RDGA 4JV5D 1VF5C 2LY7A 2YU9B 3D3RA 3HOUG 2RHUA 3X3MA 3M7NA 4IUQA 2ATWA 2JA5B 4DAPA 1N36L 1OPKA 3EGDB 3SK5A 5IYDH 1X6GA 4U68A 1HQRD 2HMAA 4C92B 4C8QF 4FT2A 4KUDK 4B3TL 4M75F 4HIKA 3G1JA 2J4XA 4B9XA 4WJWA 3TS0A 4PL6A 1KQSP 1CI3M 4IQZA 2MWOA 3HOYH 4LFBD 1SAPA 3QO2A 1KIXA 4B9WA 5I4DA 3QBYA 2PZUA 1TS4A 1M2VB 2K5LA 2EFIA 3URGA 2F3VA 2DK3A 3D4RA 4RKLA 2NVTB 2J6OA 3NBHB 5C4HA 2DETA 2A36A 2VUMG 4HJ7A 4DV5D 2QKIC 1YNXA 2BZ8A 5GANd 3HS0C 4QB4A 3RBBB 5AJ3Q 4OUDA 4A3DG 2XIWA 3PIPA 4OONA 3JB9F 1BI3A 1SR3A 2CWAA 2N8NA 4FVMA 1ZA2B 5GROA 4FXKC 2VUMH 1BCPC 3RMQA 4IPCA 4QGUA 3GTGH 2YTYA 1JJ2A 1LABA 3RN5A 4A3MH 5IYBG 2I1SA 3S1NH 3UA7A 6AT1B 1EZZB 4YWMA 3HTRA 2LQ7A 4BE2A 3S3MA 3CHBD 3Q1JA 4UHVA 1OOTA 2UXCD 4BXXH 2XICA 2YYZA 4ZGDB 4JPBW 1EIHA 1K83B 1Y8PB 2MI6A 1QVGA 2K57A 4LMQD 2KRSA 1QCFA 1NJIR 2A69D 2GFUA 2E3HA 5I6WA 4A93G 2ICIA 5LJ3e 1KSKA 1EWIA 2A1AA 1IGUA 1IBMD 1Y8QB 1G2TA 2A08A 5GAOp 2IX0A 2Y0SE 1TQOA 1VQ8A 2AHJB 3VS0A 4C92D 3J7YW 2UXBQ 2PQAA 1B4OA 4LF8D 3J81j 4DUZD 4M7AF 3PF5A 3E6ZX 2L8DA 2O9VA 3SWNB 2L3SA 3M4YA 2D9TA 2L3QA 3K6OA 4JG2A 4EQNA 1E22A 2MFIA 4DV1L 2HHHL 4DR4Q 3MKDA 3STBC 4M7DE 5KRUA 5K36H 2A6HC 3RESA 4JJCA 2FZKB 1M1FA 3RNJA 2EAYA 4HCCA 1V1PA 4CBVA 4A3JB 4JI0Q 3AEVA 4YCUA 4C56C 1A2TA 4LF6Q 3GTPH 3PTAA 2E74C 3MHBA 4M7DD 2RDHA 2Y90A 4JOIC 2EVRA 1VOMA 2QDLA 1QOHA 1QWYA 2KCMA 1PKTA 4Y28E 3KDFA 4X3TA 5T1IA 1Y07A 1Q86U 2XWBB 5LMUQ 4C3JH 4EPCA 2UXDD 2DJZA 2VQFD 1UUEA 4M77A 2SOBA 2DXBA 4R4TA 2KA7A 2DRKA 3P75A 4QF4A 4R55A 3FN1A 2HNIA 1C7YA 3EQLC 2SRCA 2CUDA 3EG9A 3PIO3 2IW3A 4OWTB 3MEAA 4C92E 3G4ST 2PMZE 4PZ8A 4BY7B 2JA5H 2MCNA 1AW7A 3EH1A 2NUCA 2CW0D 3S2DH 1Y96A 2D0QB 2B8GA 2G9DA 1OEBA 4LDYA 3KF6A 4JBMA 4DR7L 5EQ0A 1I3QB 2VQED 1TTHB 1TS3A 1STGA 2NUTA 3E1SA 3P7JA 2VWFA 4HJ8A 3Q0AA 4A93B 1JT8A 4A3GH 2C0OA 2CREA 4M7AB 3KJOA 1JJ2S 1Q90A 3P8DA 5IXBA 4X3SA 5EPJA 5JEAJ 1XNQQ 5DM63 4LD6A 1PVOA 2X4XA 5E4XA 3KYCB 1LCKA 4JS5A 1XJWB 4PQXA 2R61A 1AOJA 3INZA 3CCLQ 3OW2A 1LLRD 4JI1Q 5I2YA 1AFPA 3CCVA 4RTXA 1EY5A 2EYQA 2EW3A 2DL8A 3B6YA 3T1YD 3H41A 1E2ZA 2QEXA 3HG9A 5LMNQ 4KHPQ 3M55A 3GP8A 1VQ9T 2Q2TA 4JI4Q 3K80C 4DV4Q 3EHQA 4C0GA 4FSSA 2NVXB 3G7ZA 1QUQA 5GAOq 5BN4A 5M3MB 4YHHQ 3CBMA 3J80c 1CM9A 2JMAA 2P5ZX 1MMNA 3MXNA 2QG9B 1IBLL 5GANj 3CCJT 1ESRA 1TY0A 1W4SA 3R8BA 1SNDA 4EQPA 2HCKA 1YHBA 2EJGA 3HOYB 2HDLA 1IBKQ 2GFAA 4ME5A 4A75A 4XQJA 2PNHA 3AB9A 5CVIA 2OJ2A 2F0HA 3EAEA 2I07B 3A7AB 1BBXC 2NZ1D 4O6JA 1WJJA 4EDUA 3H3VI 1SE8A 1XXGA 1G291 2UUCD 1QZGA 1IKMA 5IGDA 4GLMA 4JI8Q 1HNZL 1K76A 1NBEB 2I0NA 1GUOA 3J80L 5M5XB 4O5VA 4LDWA 4M7AA 2F2WA 3GTMH 5HKCA 1BUVT 4CJ1B 4JRQA 1S5FD 1WCMB 1TS2A 3PIOA 2JEBI 2JP1A 2X4YA 2FO0A 2HKNA 2A0FB 2WINB 3H9NA 1T0HA 3OYLA 4UP9A 3VA7A 1PMRA 4JI6L 3A8OB 3I9QA 3OYGA 3GPLA 1X55A 2AQ3B 5EC7A 1A0IA 3VR2A 4OMPA 1TWGB 1XMQQ 2CZ7B 5GAMh 1BO0A 1TWCB 2EJMA 1UE7A 4RWSC 1BB9A 3DWAA 4BY1B 1H3FA 1KK7A 4LF6D 2YRCA 2GA4B 4M75A 2NWGA 1CA5A 1HA5A 2K6DA 3H0GH 2RQWA 4EQOA 2DTHA 3S17H 3OYKA 3K5OA 3O8VA 4OVAA 4KKTA 1HNWD 4HJAA 4OWXB 2LT4A 1STYA 2CT3A 3MXNB 3FB9A 3H0IA 3TEHB 1M1KR 3P8BB 4C8QE 5KNCA 1WYDA 3CCLT 3CC4A 2LS01 5E1FA 1UNSA 5AFWA 2VNUD 5KYLA 4HT9A 5D65A 1V1PB 1X6BA 4LF9L 5FWBA 2YHTA 1EYDA 4AYBE 3EG3A 1Q1BA 3JCMP 2ZZDA 3U58A 1PRLC 1WA7A 5DAUA 1C0MA 1U1SA 4UAIA 5HK3A 5JOBA 4LF9D 1CKNA 4K6DA 2K4YA 1S5BD 1N8RR 1VQJA 2MQHA 4HJ9A 3RN2A 4LGTA 5EKLA 3OW2P 2F0MA 5IGCA 3CD6A 1QP3A 2RB6A 3HOUH 4DNRB 3IQLA 2VB6A 3IKJA 4D8DA 1H9MA 4JI1D 4C3IG 1G8XA 4EX5A 2K3BA 3PGGA 3OSVA 4LW1A 4DV2Q 5JPMC 4RH6A 2F0IA 3SVMA 3JCMf 1R4PB 3E2UA 1M1GA 2HEQA 1SROA 2R7DA 4ALPA 2BTTA 1N32L 5GMKm 2NVUB 3FC3A 1RODA 2LX9A 2D0OA 4PMCA 2LX7A 1I4PA 2K2MA 3VYRA 2KRMA 1E7ZA 1SJED 4LNQA 3BVGA 3RZOB 5IE8A 1YJWT 2F2XA 4MHEA 3TP5A 3ONHA 4DR7Q 3BS1A 1R4QB 4R1JA 2A8VA 3A74A 4D6WA 4K2KA 4ZCKA 1IBKD 2DFUA 1SHFA 2KT1A 3F70A 1YJ9Q 5D14A 3OTOQ 2FRYA 2M02A 1QMCA 3QIIA 1SSFA 2KEEA 1BCPF 1EOVA 2XWJB 2ED1A 1KQ2A 4K5XA 1V29B 3HOVB 2K5IA 3HP9A 1UGVA 2K4KA 3MO8A 4NXML 4BWGB 2Q2UA 3L2QA 2Y0SG 1F9PA 5EPKA 3M9BA 1MV3A 1XOVA 2EQKA 3R3OA 2FRWA 4JI8D 1LACA 1KDCA 2LMCB 3M0PA 3J81E 5D3DA 1ZSGA 4JDSA 3Q24A 2BH2A 2PQAB 2F0DA 4KHPL 3REAB 1D6EC 1XTCD 5IGEA 5FU6C 1NJIC 4CGYB 2LNHB 5GAMf 4RMFA 5EGTA 3QZ5B 1R9TH 1WVLA 4LXCA 3VS1A 1K3RA 1KLUD 1X3PA 4H13C 4UY8C 3OBYA 4A3BB 4A3CG 1V43A 4WTOB 2KVMA 3K7UC 1WTXA 1PTOD 1PFMA 2LCCA 4EIKA 1WFQA 1D5XC 1BF4A 1BIAA 1AVZC 3I56A 2LRQA 4NNJA 1KABA 2PUOB 2HQXA 2K50A 3EG0A 2NZOA 3JB9H 1I0CA 2NTSA 3DUZA 5I9OA 4LFAD 4A54A 3HL8A 4HCBA 1K73C 1UE6A 1LTRD 3PUYA 3HOXH 4FF4A 1XNQD 1VQ5Q 2Q8TA 1PZID 1J3TA 3QPHA 5IH2A 5IT9c 2BKDN 2E2HB 4N4IA 5JJKA 4GKKQ 1Y7XA 1VQ6T 2AWNA 4DQ2A 2E5LD 1QCNA 4PFZA 2IY5B 2YXYA 1Z9QA 3NMZC 3VS6A 8ATCB 2QA4A 3FP9A 5IYCG 1EQQA 4LFCD 4PKCC 1WHMA 1VQOT 1D5ZC 3AFPA 2ZXRA 1B3QA 2EVBA 2QQ9A 2D5DA 5GADC 1JB7A 2ASBA 2L89A 4C3IB 5LJ3j 3KYDB 4L5SA 2CP7A 4XTWA 4ZN3A 2OTJT 1X01A 2A73B 3S17B 1GUTA 2KBTA 1KDBA 2VXFA 4TKOB 1JCKB 3OWEB 1VQPA 3NELA 1MI2A 4DV7D 5M5WB 2UXDL 2WB1B 2JMCA 2JTEA 2DEQA 3QZ9B 1Q12A 4J9FA 1JOKA 5LJ3f 5CV9A 2OAWA 1K8AR 2L0CA 4DK0A 3G6EQ 5K36G 1SBBB 2XDPA 2DJFC 5C4ZA 1B34B 2ZTBA 2QW7A 1EY0A 1IHZA 2F0NA 4GLKA 1AWJA 1XNIA 2JZ2A 1QWFA 4F88A 1PRTB 3OBWA 5CMDA 5L37A 4DOWA 1HYOA 1V1OA 3RZOH 5FW9A 4F7XA 1Y69U 1HRJA 1DXMA 2JUFA 5AT1B 3T1YL 2A37A 1ABOA 1N34L 4M7AG 2K5DA 1X69A 1KC8R 1KL9A 1X3QA 2EKHA 1CQFA 3I4MB 3OTOD 3OS5A 1XMQD 3SWNC 1JE5A 4VUBA 2F0GA 1P16A 1OV3A 1IREB 1MNDA 3AT1B 3NUCA 3UDXA 1ABQA 2HAXA 5HURA 5I2SA 4J9BA 1HNWQ 3OMCA 1B8AA 2B29A 1VQ5T 3LNNA 4BY6B 1NMFA 3CC7T 2KDSA 2F0SA 4QQDA 3K8AA 1AD5A 3QIAA 4U673 4PJNA 1M5Q1 1YNZA 5GAMg 5EPLA 1RL2A 4JI7D 3DH3A 1ASYA 2DIQA 2BZXA 1U5SA 5IT9L 2FL7A 1DM9A 1IBML 2N55A 3C3LA 1EIYB 4E47A 4M75B 1YVCA 3R93A 1MGQA 2BH8A 3I3CA 2RDFA 5LJ5g 4M78C 3WWVA 3Q22A 2PI2E 3OYYA 2NYZD 2K3YA 5GAN5 4II3A 1PDQA 4KRTA 1O75A 2DRMA 1BCPB 4UC4A 1GOZA 1I4GA 4M4ZA 2K32A 2FHDA 4ZUIA 5IGGA 3AQQA 2QEJC 3HRSA 1IHWA 1QVPA 4AT1B 1JE4A 1UE5A 4X66L 2RKSA 1SFOH 3MC0B 4OB2B 1VF7A 2FMCA 2XHCA 5KNDA 1JEGA 4DV1D 5CV6A 4LFBL 4YCWA 5M3MG 2R93H 9ATCB 1IYJB 5IYDG 4CI0C 2NVQH 3M4OH 2DPPB 1SYCA 3GO5A 2NYSA 3LW5E 1G51A 2F1MA 3OSSC 3ONGA 1SNMA 1CT1D 2KNBB 1PRTC 2AQ2B 2GNCA 3A98A 2B3GA 3BZCA 5C3EB 1JWSD 4YY3Q 2KAFA 4IOAA 2LNVA 3PMTA 2YTVA 4NW2A 2D1XA 2LMJA 2HQLA 4AFZC 3MEFA 4DK6C 5KGUA 4DXFA 1PH5A 3VKIA 5GAN6 4G4KA 2KXDA 1N6AA 5GANh 3CC2Q 2BUDA 3EG2A 2BE7D 1I4QA 1VQFA 1Y1VG 3PSIA 3P8HA 4DK1A 2JS2A 1IW7D 4BE1A 1SYEA 2XDBA 2N78A 1SEBD 1W6JA 5GMKj 2RF0A 3G4SA 2X69A 1U5KA 2UXCL 4A4HA 5LJ3d 3CP0A 1QP2A 3A7LA 1WTPA 1R8OB 3QWYA 4M77F 1H3ZA 2V1RA 1DOKA 1VS0A 2AMCB 2NUPB 1OU9A 2RSOA 3I56T 2WAQB 4FNFA 1YEZA 3NEMA 3S15B 3A8MB 4GKKL 2RHXA 4F16A 2JXMB 1HTPA 3CC2T 5H1SE 1K1ZA 3SK6A 5JJLA 3RDVA 1UGRB 4K11A 1ZUYA 2F69A 2QQBA 1N5ZA 2L5QA 3DB4A 3X24B 4IUVA 1VQ8T 2E75C 5E4WC 3VYSA 4JI4L 2RHYA 4WF2A 1JMCA 5IWAD 2XKOC 1G3SA 4IIMA 1KFZA 4LF4Q 1LO5D 4DR5D 3Q23A 4PK4A 5LJ5d 4BY7H 5EBCA 2X51A 1KTKA 2GQVA 1K83H 4O2DA 4DEXA 1IBLQ 2J0TD 1VYVA 1SE2A 1DD2A 3E5SA 2GCXA 1M3CA 4PJOA 3HPWA 3MAQA 1A3VA 4N8FA 5KYUB 1F1BB 1NEBA 3M5AA 4I7AA 1VDZA 4C8QG 1QQJA 4JUVA 1KSLA 2Z0SA 1YP5A 2QA4Q 4HA8A 3C1FA 4OMFB 2EKOA 2V8JA 5GMKe 1Y1VB 1B9MA 2SDFA 3NK9A 3NPPA 4C3HB 4IFDI 3FLGA 2CZ0B 5CV8A 4Q0FA 2GGRA 1O7IA 4A3MB 2K03A 3DMUA 3MP8A 2MHVA 5EG2A 3UDIA 1XPOA 1NYGA 2C0IA 3M0SA 5C44H 3TEEA 1B1ZA 1X3FA 1LT5D 3UATA 4KJNA 2B63H 1JU5C 4GNXC 1SKUB 4FXDA 5GAMd 4OO1G 4DUYD 2LCSA 3RKYA 3GTPB 5C0XG 1Q3LA 2F3IA 4K6LA 2Q8IB 1G3TA 3VU3C 4FP5D 4GNXB 1XYIA 2CCZA 2M9UA 2MK5A 1L0WA 1FMWA 3CBOA 1EYGA 4YCVA 2P4RA 3KF8B 5FO9B 4B3RL 1WI7A 1L1OB 1WTHA 3IFTA 1WHKA 1WZOA 3NTHA 2GTJA 4J83A 4MIUA 5ELCA 3U50C 1ZSZC 1YCSB 4K8JA 5LL6S 1SNPA 4KY6A 2AZSA 1B44D 1EOTA 2EY5A 1QKXA 4M7AD 4DAVA 3LX7A 2M00A 1F2ZA 3LGFA 4N0AA 4P74A 1Z6HA 1UG1A 2LJ3A 3CBPA 3CC4Q 1G91A 3K0YA 2EYFA 2KGTA 2RVLA 2A7YA 3OS2A 1V1QA 2LT1A 3D6WA 3I8ZA 3CF5A 3QR8A 4DBQA 4DR3D 1RADB 5J39A 3V7CA 4EMKB 3PGZA 1PZJD 2DVJA 2R3ZA 2N88A 4LUZA 4A3JH 1E2VA 1Q7YU 4M8AA 1TS9A 1KXLA 2VC8A 3CCQA 1I4XA 1HNZD 1D1AA 2W0ZA 3S14B 3IRBA 1K28A 1E2WA 1AWOA 2PYKA 2C5CA 2C0TA 3HRTA 1G83A 2OTLA 1LT4D 1M27C 4L6V5 1HR0L 2XRQD 1NR2A 2DAQA 2NUTB 4GLAC 3CCQQ 4JI3L 3HP3A 4S3SA 4DR2Q 3C12A 1U3OA 2ZAEA 4PNOA 4E7SA 5C3XA 2M51A 2QQSA 2B2VA 3FPUB 5KIXA 4HIMA 4A3MG 3Q8DA 1N27A 1N36Q 4BS9A 2I2LA 2L12A 1HXDA 2KY9A 4J9EA 2CWPA 3EVQA 3Q6SA 2NVXH 5DLOA 5M5YH 1ZX6A 3GV3A 3V2TA 3CPWS 4B3SL 3K7AB 3NBHA 4KD4A 5K5PA 1OU8A 4DV5Q 1VIOA 1SYGA 3JAMi 1G3YA 1I50B 4PLLA 3CMET 3EFRA 1ENAA 4LD9K 4LF4D 4ODGA 4M78G 1QLYA 3QHSA 4L59A 1M1KU 1U4RA 3V8JA 1B7YB 3RNUA 4Z88A 3A8GB 2I5MX 1VQ6Q 3MEWA 5J3BA 1EYCA 1HUMA 2R5MA 3I70A 3TMEA 1DJ7B 1ILQA 5CV5A 3ZEHA 2I46A 5FK9C 4QJFA 2F0UA 1TY2A 1EL0A 1OULA 1K0RA 1RIPA 3GNFB 4HCSA 1YJNQ 3SR1A 3X20B 4BUGA 3U9OA 3KFUA 2E6NA 1KQSA 1D5MC 1JQYD 1SNQA 1C8CA 3UDFA 1TH7A 3R6OA 1MSHA 5JJIA 2HD0A 2NN6G 2ABLA 1VQDA 2VVKA 4DAMA 4QIWE 5LJ5h 2DD5A 3QWXX 4FCYA 4RHRA 3CCVQ 5I6YA 2FHTA 1KG1A 1VQLQ 3NQIA 3JAMc 3C2PA 4LF4L 2BDOA 2UUBQ 3H15A 1KRTA 3E19A 3BZDB 5HY6A 1CKAA 3EA6A 2JOYA 5IN1A 3UDGA 1JWMD 1MIUA 5BR8Q 2Z6BA 2VV5A 1MBYA 3ZL7C 3K81C 4HCEA 1XMOL 4DV6D 3AYHB 1YJNT 3AU7A 1KD1R 1PZKD 5EJWA 4E7KA 4DFAA 3EFSA 4DR4D 4DR6D 1UAPA 1SXTA 1TG0A 4KJOA 4A3FB 2HBWA 3OYNA 4A3KB 4B3MD 2DMOA 2R7FA 3QUIA 1EFWA 2ZJQA 1HNXL 2NLUA 1E1TA 3DEPA 4DR4L 4LF7Q 2DKGA 1K9MC 4BBSH 2PVDB 2RJDA 3RZDH 1X43A 4EQ5A 2E2IH 2HBPA 5I11A 1SE4A 4C0ZA 5LMUD 3JAME 3KXTA 2E65A 2B2TA 4X62Q 2RHSB 3EN2A 2G6FX 1G3WA 3I4NH 1D1BA 3MHXA 2JXBA 2HUGA 3GP7A 3GTJH 4GY5A 1GKHA 2E76C 4OELB 2RN8A 2JJ9A 4ZTFA 5T1GA 1UGSB 2B2YC 4PZ6A 1I6VC 4DPGA 1A6XA 2MMPA 3H0GB 5CV7A 3SWNA 1AE2A 1EEFD 4V190 4D8KA 3BDUA 5IXFA 1JQQA 3CAMA 3D4WA 3FEWX 5ELDA 4CJ0B 4HMJA 2Z4HA 1WHLA 4BY1G 4IOCA 2XIDA 1DGSA 4B3TQ 3M57A 1PH1A 2O31A 4GN5A 5J22A 4II1A 3CMMA 1HSQA 1WLPB 4JC0A 2LSSA 3HKSA 3FDTA 2B2VC 1OX9A 1SRLA 1AWWA 4FW2A 4BD3A 3LGJA 2AQ1B 3FKIG 2XMFA 4HSPA 3LWEA 2QTVA 2OTLQ 5FLXc 1GHKA 1A8VA 4M7DF 3D8GA 1EU3A 1QVFP 2V1CC 7AT1B 3M7GA 2DL7A 2O01E 3EFOB 2MWPA 1OXUA 4QUFA 4IUPA 2FPEA 1ZA1B 2E8GA 2RHIA 2E41A 1YN8A 3GF5A 1PSEA 1NPRA 2E12A 4C2MH 4HVWA 1EY7A 4IFDH 1T3LA 1DZ1A 2NUPA 4JI1L 1JOQA 1SSHA 3CD6T 2BDNA 2HDMA 5FJ8H 2MAMA 1KAAA 3QWNA 4DBFA 4IPHA 5BN5A 3HOWH 3L1AA 3OYJA 2KR3A 3N5BB 3E3XA 1BCMA 1NG2A 1YWPA 2F0EA 1TSFA 4C8QC 5GQOA 4JLIA 1CTMA 3VJPA 3HGBA 4O42A 4DR2L 1Y1WH 5M5YB 2DX1A 1YNND 1G6PA 3KJPA 1LNXA 3VYHB 4RTUA 4B3RD 3C95A 1BBUA 1PH9A 1M90U 2RHZA 4J8QA 4Z02A 4XTUA 4G57A 4ULLA 2X6GA 2UUCQ 3VR3A 3GTLB 4OX9D 2PCFB 2KK4A 3HKZE 2L3RA 4DR1Q 3BY7A 1BCPD 4A53A 3LWHA 3HKZB 2A28A 3R6NA 4LDVA 3MEHA 1X9NA 3HOXB 5GMKi 1QG7A 2JN4A 1D8LA 5JPNC 1VQGA 4AIMA 2FZGB 4FYVB 4JI7Q 1WTQA 2K79A 3M3YB 4JRPA 3EIVA 3U4VA 3VRZA 1H9SA 4B3MQ 1VUBA 2UU9D 1CFMA 3VYGA 1YJWA 3VS4A 1OXVA 2K28A 5LJ3h 3S1NB 2IIMA 1BBWA 3OS1A 3NHNA 4DV0D 2JM9A 2ZTDA 3TCJA 3QO3A 3ASKA 3VR4A 3W1BA 4DA4A 1FJGL 1WQ7A 4DF7A 2JANA 4K0KD 5KCHA 2NBFA 1CKNB 2VQEL 3OYEA 1K8AC 1H3EA 3PO2B 4H7BA 4CDFC 2AWOA 5CYUA 3MFGA 3QJ6A 4DA2A 4ZTJA 1IGQA 1MUZA 1KIKA 2WAQE 3H3VC 2K5FA 3I55Q 4DR3L 2OCEA 2X6LA 2EDGA 4KBMB 1FMVA 3TSSA 3OA6A 3TP6A 2VUBA 3F1ZA 2DXCA 1QVCA 5GANf 2K5HA 1WJSA 2AT1B 4HMIA 4NP5A 4POFA 2K3XA 3UPUA 1RACB 1HFGA 3HRUA 4BI4A 4AG1C 1QUQB 1NLPC 2K7AA 1N9RA 4E6RA 1HJDA 1NE3A 1J8IA 1JH3A 1QVFS 2H8HA 5J1ZA 1Z9FA 4J6YA 5HK0A 3CCVT 4BBSB 1TS5A 1IYUA 4I65A 5IGBA 3T1HL 1Q82C 4AFUC 1BBZA 1T5EA 4XXEA 3K5NA 4V2SA 4PG3A 3WVEB 2QEXT 3UWNA 1ACMB 5A0GA 4JV5Q 4FO2A 4IZ8A 2M0OA 1NZ9A 4Y7NH 2BOSA 4DNTB 4PV1C 2E10A 2KOLA 5LMNL 2R93B 5KYYB 2B2YA 2ZTEA 4XTXA 4CRIA 2DA9A 2KEDA 1GJXA 2Z4IA 4JVZA 3CPFA 3E9HA 2CQAA 5IAYA 4A3BG 1CKMA 2JVVA 4MDWA 1ASZA 4FIBA 1QCBD 4A3FG 4A3KG 1FR3A 1K8MA 1JJGA 2WB1E 3VV0A 2C06A 2OXPA 1CA6A 2SEBD 2DUDA 1PXUA 4DV6Q 1Q46A 1HHVA 1BR9A 4A4EA 3HEJA 3QYGB 1PWTA 1X2QA 4QVDA 5JVH3 4DV5L 1DOLA 3A5UA 1B34A 2CP0A 4Y92A 1SMYC 3PV0A 2IWHA 3MPUB 1ZBXA 4HT8A 1X6OA 4MZTA 2RJEA 1VQNA 4OGCA 1I3QH 2PNIA 2K5WA 1PSFA 2DNUA 1YHQA 1K0XA 4M78B 4R8IA 1NCVA 1QB5D 2KQ3A 3CCMQ 1WTWA 3I35A 4J9IA 1W6XA 2F0WA 3GTLH 3OTOL 2LC4A 2JSOA 1S5ED 2DE0X 2JA7B 1N36D 3A5ZB 4LF6L 1M90C 4YWLA 4ZAIA 3MP1A 3QKJA 1DYQA 1WGSA 2VASA 3HRZC 5LMUL 2K1BA 2LDMA 2CYZB 4A4KA 2ICEC 2KHJA 2MUYA 4HR7B 2AKKA 2O9SA 4RFBA 1LTID 2O4XA 1R0CB 1V1CA 3M53A 4IFDG 3DLMA 3MP6A 4BBRH 5C5LA 5KYNA 2FMMA 1HPCA 2L0AA 1UHFA 2EYOA 3NTIA 4P75A 2F0OA 3HOXG 2CFMA 3RLFA 1SDFA 1YI2T 3S6WA 1HQMC 1WPYA 1O80A 3CCSQ 3CCEQ 1EQTA 2CT4A 2OEOA 1AZEA 4BACA 5FJ8G 2EXDA 2E5LQ 2LQNA 5IHIA 1EX4A 1KJWA 2RPNA 4MTKA 3CC7A 1VIFA 1ZYRD 3T9NA 1VQNQ 4A63B 1SLJA 3KLRA 5KE2A 4POGA 4J9CA 5GAMe 2Q2HA 2K6AA 1K8GA 1TR5A 1Q1EA 4JOIA 2D62A 1VCIA 3PUVA 5M5XH 2HQHA 2VQFQ 3G48A 3M54A 2M1HA 3JB9I 5J26A 2F5TX 1F2LA 2HDAA 3VRYA 1QILA 4LF5D 2V8IA 2PNRC 4M78E 3CC7Q 3AHUA 1GUGA 1BI2A 3GDEA 1STBA 2E6ZA 1ARKA 4DR6Q 3CCRT 3MTSA 3TVTA 3KF8A 4ZRZA 2IJ0A 3VA5A 3VR6A 4DUZL 4C5IA 5A0DA 1I5LA 1X2KA 1ZSZA 4L5GA 4LDXA 2Y0SB 2KSSA 4F7UB 4FSXA 3CXCA 3MXPA 4FXGC 1D0XA 1TWBA 5CAIA 2WSFE 2WV6D 4JW0A 2VQEQ 2CZ1B 1UGQB 2MOXA 3VS2A 4OX9Q 3CCRQ 2CKZB 2WFWA 3H0FA 4M7AC 1OQKA 4XU3A 1WOCA 2AHOB 1M90R 3FRPB 4LUOA 5TSSA 2HQEA 3RUXA 2X4WA 2A6ED 2E64A 3T53B 1X65A 4GZYC 4K0KL 5KYXA 4ID6A 4OWWB 1CK1A 3TSZA 1PG5B 3ERSX 4X34A 4M75D 5D7UA 4AFSC 4DBHA 4CJ2C 4CC4B 4J8OA 3GTKB 1CSKA 4ME7A 4C3JG 3T1YQ 3PE0A 4M77C 1RAFB 1UHCA 1K0SA 4UP8A 2R7ZH 3CMEA 4JJNK 1TIID 1PA6A 1WTRA 1LVKA 1YBYA 1EEID 3T1HQ 2B63G 2JA8G 1WHHA 4EMKC 2QTXA 1VQKQ 2RI2A 1HTLD 4IUNA 4Y7NB 1S72Q 2DTOA 4DV0Q 3EHRA 3CCET 4DAYB 5KYXB 1TUDA 1RABB 4M77G 3MCAB 2DERA 1MD2D 1PC0A 2ATCB 3V8LA 1VQOA 2EYYA 1VQ7Q 2IHFA 4OEMB 1I94L 1KSVA 1LTAD 4L5QA 5E3FA 3MEVA 3I56Q 5FO7B 3U4ZA 1STEA 2PI2A 2NVYB 4IUTA 2OTJQ 1U06A 1EQVA 1DM0B 3KYHC 1NPPA 4XK8E 5A35A 5CGKA 1FGUA 4LUVA 1I07A 2QGQA 4OMOA 4Y52H 2QF7A 1S3OA 4QUCA 2FB7A 1ZUKA 2DYIA 1SMXA 2RO0A 1EYAA 1JXOA 1FYCA 1XPRA 3D6CA 2SNSA 4KLKA 3FHWA 1XQHA 4C3HH 5HGQA 3DXJC 1M3AA 4BY7G 1ICWA 2QDYB 2BE5D 2K75A 4R4CA 1Q7YR 3T13A 2UUBD 2UU9L 4JI5Q 2JW4A 3CPWP 2WP8J 1ZKOA 2O2OA 3VYUA 4KGZB 1CQVA 2O5JC 1QW1A 1N34D 2F0VA 4WORA 4F7UE 4C8QB 4C92F 1M1KC 2Z8LA 1HNXQ 3ULPA 2RF4A 4JYAL 2FVUA 4XTYA 2X3WD 1LTGD 1LTLA 2XK0A 4JS4A 2AUJD 4CDCC 4GOPB 5E7NA 2B2UA 3D0FA 5CORA 4FYYB 4QW2A 4M7DC 5DY9A 2DBMA 1GBRA 3S14H 4R8NA 4LE9A 2QEXQ 4N9TA 2K01A 1ZUUA 4J9HA 1M4VA 2X4JA 4NMZA 4GKJL 3ME9A 1TWHB 4OGQC 2E3IA 2RA2A 2F4VD 4X62D 4BBRB 1RAIB 3TSWA 2BA1A 3J7AV 5A0LA 2DVEA 1M8AA 3VS5A 4A3EB 4LWCA 4K8IA 2R57A 3EG9B 1WCMG 1D0ZA 1E1OA 4K5WA 3S1RB 1XNRQ 4RGMA 4G7HC 4M77B 4J6XA 3MEUA 3KLSX 1B07A 2BZYA 2F0QA 2EYXA 3ND8A 3OWFA 2R92G 1BNZA 4KHZA 2Z0WA 2O4XB 3OYAA 2QQRA 1MHNA 4A3FH 4A3KH 4UP7A 1QKWA 1I50H 3TU4K 1H9JA 5M9OA 1F9QA 1YNJC 4CDEC 5M3FH 2F2VA 2GVBA 3NPFA 1SEMA 4KUIA 4M75C 3I4OA 1M2VA 1QVGS 1WIEA 5GJVB 2E5QA 4LDUA 3OYBA 4TVAB 1HD3A 1OPLA 1QVGP 2XGTA 2CH4W 4G7OC 1BI0A 1EIGA 4KTAA 1X56A 2RJCA 3JB9J 1STAA 4P72A 4GKJD 2YUOA 3X28B 2L1BA 4A3IB 1K73R 1HZAA 4KKSA 1K9AA 3SB2A 4CDDC 4DV2D 4GKKD 4HVVA 1F2YA 1P8LA 4QL5A 1A63A 1ET6A 1YITT 5FLMH 4OHJA 3BDOA 4KGVB 1OZ2A 3I4LA 3W3AA 2K14A 5EKIA 3BDCA 3CMAT 1A2UA 1PTOC 2YUPA 2YU9H 1HNWL 4EMKA 2PPBC 4DR6L 1PV4A 4OP0A 4A3IG 4K5VA 1TUGB 1C48A 3L2RA 1J6QA 4ZLTF 4IFDJ 2OTLT 2XVSA 4DV3L 5LJ3g 1CKOA 3EFXD 3HKZG 4WJ3M 1JBMA 2EYPA 5BR8L 4M7DB 2RQVA 4DEYA 1RAHB 3G6ET 2J06A 2A68C 2NB0A 2P0KA 1SRUA 2NVTH 3T56B 4DK3C 4R0KA 1I4RA 3RMSA 4A3GB 3NE5B 2QQAA 3GTKH 3G71T 2D9UA 4LFAL 4GNXA 3D4DA 3JB9G 3STBD 1YCYA 3W5OA 3I4MG 5IWAL 2EYZA 1Q95G 4MZ9A 2VUMB 4DR1D 1UFFA 4E7LA 5L8RE 1PHTA 2A3LA 1JOOA 2RA4A 4WFN3 3RZDB 2H4OA 2DXTA 5CK9A 3CD6Q 4IO9A 1VQLA
chains in the Genus database with same CATH topology
4RA8A 1FX7A 2BA0A 3I4NB 2JYOA 3FVQA 2IX3A 4MMLA 4QQGA 1WJQA 1FGBD 4EGVA 2B8AA 3KBGA 3QJYA 1TU2B 2F4IA 3QG1A 4MN3A 5LJ5j 2ZPIB 1B9NA 1A3TA 5GAN8 4TQUS 2HCCA 1A15A 1VMPA 4OO1I 4JRIA 1GUWA 3JCMW 2DN8A 5GAOr 1N8RC 1PFNA 1L0XB 3T51B 1I81A 4NL2A 3NSWA 3PUXA 1I6HB 3KK7A 2LFNA 3QDRB 1G2SA 5KCOA 3NXWA 5C5MA 2EPBA 4XAXB 5M3FB 3OY9A 4AYBB 4FT4A 1Y8NB 2XG8D 1B2TA 4LK1C 4K2LA 4XTCS 3D31A 3K57A 1BQQT 4XT3B 5IGFA 2E70A 2P4TA 2YLCA 1CHPD 3L2ZA 5CKHA 5LJ5e 3L7ZC 4ZK9B 4KY7A 2EXZA 5JEAH 1S72A 4BY6C 4BI3A 3JCMc 1IYVA 1VQKA 4M78A 5GAN4 4LJZC 3VUBA 1K73U 3IAYA 1SYBA 1AP0A 1EY6A 4M7DG 2J7ZA 1G5VA 2A74C 4M78D 2VYTA 2NTTA 1YNJD 3S2HB 1QVFA 1G6ZA 2RSNA 2EZVA 2ZCFB 4P2CB 4OIJA 3UI2A 3OSOA 4V0BA 4II2A 2FFKB 4M7AE 1K8AU 4E7JA 2EWNA 3J7AF 3SDZA 4IALA 5IODA 4C5EA 5D6WA 5I21A 1VQLT 4X9DA 5CKFA 3GNGA 3AMUA 3RKXA 2XD0A 1ZXTA 1HK9A 4KV6A 3PUZA 4OIKA 3RIRA 4M1UB 3NP8A 3S3OA 3CKIB 3GQBA 3GD7A 1PTOF 2E1HA 4L8JA 4X9CA 4CKBA 4DAYA 3H6MA 3O13A 4H0LC 5F2DA 2RH2A 3JCMh 2K7VA 4RGOS 5COYA 3K5MA 1M8VA 3RMHA 1O7LA 5GAOm 5IIFA 1ZHIA 2DIGA 4QVZA 5FRNA 4NKLA 1EIFA 1KQ1A 3X25B 4C1NK 2JA8B 5I2MA 1UUPA 2PW7A 4K14A 2DD4A 4BA1I 2QDBA 1BKBA 1FNVA 2QILA 5DEHA 1IW7C 4KN4C 3FPPA 2O2LD 1KNAA 5NUCA 4CKCA 3PO3B 2JN0A 3ONAB 4ZYSA 1X75C 1Q81U 3U9SA 3CCUT 5CC4A 2XDDA 3LWIA 2K05A 1S5DD 3RKWA 2LTOA 1HCZA 2E2JB 2EY6A 2F0FA 4MZMA 2VXWA 2F0PA 3PMIA 3OYDA 3SK8A 2EYMA 4RCNA 5FLXL 2B8FA 3NHHA 1NR4A 4O1NA 5C6SA 1YITA 1Y71A 3CC2A 3L9AX 1RF2D 1VQPT 1S4ZA 1LOJA 3RERA 5GAN3 3OIPA 4PJOD 2JTFA 5CKEA 2Z1CA 4BDYA 3CC4T 3CCLA 3DM1A 3NFCA 4EMGA 3OW7A 1NJIU 3CCMT 3KUFA 3WVDB 3QYHB 1P92A 1OI1A 2PVOB 3LYIA 2LCLA 4XU1A 2KHSA 2L4NA 5KYIA 3MA2B 2SNMA 3F2UA 2JEAI 4IN3A 4L6TB 2BE5C 3JCMe 1KNEA 4ELZC 2D6FA 1H9RA 3T4AC 2KJXA 1LJOA 2B2UC 5FLXE 2DNCA 3VR5A 1YI2A 4EVOA 5JAVA 3J80E 3JAML 2F3WA 4DN4M 2IX1A 4XT1B 2JNGA 2L9HA 2PZWA 5ELEA 5GAOl 1U4MA 2LKVA 2OTJA 3OW2S 5AYFA 3JCMX 2EY2A 1UGPB 2D2CC 4Y91A 3LWUA 3QOJA 4BB7A 4ILWA 1OO9B 2JE6I 1F9RA 4OO1H 3C94A 1VQ9A 1R9TB 2CVRA 3X26B 3P20A 1D1KA 3CCSA 4F8MA 5LL6X 4HSVA 2KCNA 2MJ8A 4DOVA 5GMKh 3PMFA 3M56A 2MPMA 5KNLA 3CCJA 1LTTD 4WRDA 5D6XA 1HUNA 2Y4XA 4J7FA 5KH6A 3CRKC 1AEXA 1TWFB 1YIJA 2RK1A 3K59A 1ENFA 1K8OA 2G3RA 4F7UF 3FJPA 3H91A 3NWSA 2WSEE 4ATOA 2IPKD 3NWTA 1O9SA 1BOSA 4BA2I 1U8RA 5KNBA 4C5GA 3V8KA 3DB3A 1XX8A 2RJFA 3OYIA 4XQ3A 2CGHA 2WSCE 1KC8U 1VIEA 1U4PA 2A6HD 1RD9D 2BCOA 1VQKT 3GIBA 1UEBA 4F7UA 1VQ4A 2PQWA 3JRZA 3OQ5A 5GAOn 3QXEB 1Q7YC 3HOZB 3LH0A 3R2IA 4TSSA 4E6IA 5JVG3 1CZGA 1FXXA 4ZKCB 2ZPHB 4HCZA 4N0AC 3JB9D 2EY1A 3A8IE 1VQMA 5GAN7 3QOLA 5I2XA 3J81L 1G8ZD 2MP1A 1V8QA 1GXDC 2OT2A 2R5AA 2KECA 3A8KE 3M4OB 2NVQB 3N52A 3TP8A 1NUCA 4C2MB 5CR3A 1SSOA 1GUSA 3NQTA 1RHPA 4CKEA 2BIVA 2ENBA 5CKDA 2KVQG 4E7HA 3JCMb 4KULA 3SD4A 5ELBA 1TWAB 1SFOB 1EY4A 4C3HG 2EJFA 3M59A 4PMBA 1Y1WB 2F0JA 3RD4A 2EJGC 1YIJT 3LGLA 1L0YB 4JRKA 2Y4YA 4F87A 4C92G 1KDAA 4XQNA 3CCST 3MXGA 3WOFA 4KI0A 5JEAG 1RI0A 1B50A 2R92B 1VQNT 2VXEA 3GTOB 2IVWA 2EYJA 5C4JB 3GTMB 3JCMJ 1BXTA 3CU7A 1LT6D 3GOXA 1VQ4T 2B2WC 4C0DB 4MDXA 3A55A 2AUKA 3URYA 5CBEE 4J6WA 2MGSA 3FEOA 1KC8C 1EY8A 4J1MA 1ILPA 4MZPA 1O78A 2EYLA 1ET9A 1KD1C 1Y8OB 3DKMA 1STNA 5EBDA 3W2DA 1D3BA 5KEEA 2K5QA 2EJ9A 2YLBA 4IUUA 4RCCA 5ELFA 3A8JE 4DXGA 1CZWA 3G7LA 2CZ6B 3WOEA 3H94A 2ZPGB 4PJOB 2E2DC 1C4QA 1Z47A 2CS7A 3LX0A 3HSBA 4OL7A 4XIGS 4C0FA 5CCAA 1HXYD 2V8KA 5C0XH 2FYKA 1WTVA 1O7YA 3ND9A 4RGTA 3M85A 5FKAC 1PYWD 4KK7A 3MZ5A 1LTBD 3L2VA 2OAUA 1JB3A 2VB3X 4ZKBB 1W2BA 2ZT9C 3KLSA 5C6AA 2B63B 1NSNS 3META 4XYOA 5D3IB 1S5CD 2PUKB 3GLXA 4PLIA 1EFID 2Q8RE 4DGZA 4C5HA 4A4GA 4FU6A 4OB1B 1WD0A 3FKIB 1KQSS 5CBAE 1JR0D 1SYFA 2EJFC 4OF1A 2EE1A 1KHCA 1YNNC 1BI1A 4M75G 3V05A 3OYHA 3FMCA 3L2WA 3ER0A 4FF2A 4OGEA 1OXSC 1SYDA 5FROA 3OYCA 4NL3A 3G6EA 5C44B 2CHBD 2F0KA 4QMGA 3I55T 5IT9E 4FM4B 3CCEA 4BDZA 3OB9A 1DCZA 3PIP3 5BN3A 2H3JA 4EMHA 1YHQT 1TKWB 4G7ZC 1XTDA 2PQEA 3SHLA 1WQWA 1AHJB 4RG2A 4HTHA 4A4FA 3M4GA 1ONLA 3WXMB 1NE8A 1PTOB 4X3UA 2A68D 2QXFA 2NN6I 5CV4A 2PVGB 4KKUA 4C92C 1D2BA 2FJ2A 4XU0A 2PU9B 1LV9A 3OS0A 3JSCA 4PJOG 1DJRD 2E2IB 2A5HA 1AZPA 1I4K1 2IT1A 1F77A 1Q81C 3VYTA 2NN6H 1KD1U 1M4ZA 1ZQ1A 2VGMA 5CO7A 5DM7R 3PUWA 4KT0E 4N4GA 1T5XD 3GTJB 3T16A 1SJHD 2L5TA 3GTQB 5FU7B 1U9RA 4N4HA 4YTLA 2PZTA 4NDXA 4HN7A 1FD7D 3V7SA 3SEBA 5FU7C 2EIFA 1W2BS 2ID0A 2IG0A 3H6ZA 4FL6A 3CCQT 3IFDA 2PMZB 2ZPEB 3OIQA 1UEAB 2M16A 4M78F 1EY9A 4B08A 4RKBA 3CRLC 5JJZA 3SFMA 4J5YA 1CHQD 3DWPA 4PJOE 1PRTD 1F2MA 5ISRA 2F0TA 1XWEA 1YJNA 1OXXK 3CPWA 1O7ZA 4LAAA 1FNWA 2C9OA 1OXTA 4OB0B 4V190 3TREA 1D1IA 4E7IA 2V4DA 3TDQA 1KLGD 3UDCA 2R6GA 4X3KA 1PRTF 4Q5WA 4F7UG 2CW0C 4C3JB 2WACA 3CCUA 1ESFA 5C4XB 2X35A 4J7IA 2ZGWA 2CKKA 3C46A 3OPOA 1W6KA 5DLQE 1FWZA 4M7DA 5EKKA 1BIBA 3P1HA 2EQJA 1QE6A 1Q82U 3K58A 3I90A 3E0JA 1LT3D 3I91A 2RK2A 4IKFA 3VUZA 3IL8A 2DXUA 1FNUA 3DEOA 5C0XI 2EYHA 5LHY1 1QJOA 4XU2A 3OOCA 1PTOH 2VB2X 2K33A 4M77E 3DHQA 3MXUA 2WIIB 1VMCA 3G71A 5CKBA 1QNKA 3BG3A 2FINB 2QA4T 2LVMA 4C8QA 4FYDA 3CQZB 1AZQA 2TMPA 1YJ9A 3ZFJA 2RI3A 5C0MA 3L42A 3C1EA 4ZGJB 1PFBA 3GV6A 2KCCA 3E9GA 4ZQ3A 1N9SA 2G9HD 4P5NA 5GAN2 2DNEA 3KBXA 4XDXA 5CR2A 3BVMA 1QNUA 4H44C 2ZXPA 2H1EA 4PMWA 3S2DB 2VGNA 3M9QA 3RUZA 3M58A 3QSUA 3NBIA 3S9WA 2M9VA 3C4SA 3UT1A 3SE0A 3BW1A 2PO4A 2RBMA 4TRDA 5LJ5f 1ZEQX 2B2WA 4Q5VA 4XQQA 1SMYD 3H8ZA 2JTMA 4RMOA 3SXHA 3HOWB 2DTIA 2RI5A 3BYTB 1VQMT 4ZUJA 3A8LB 1VQ7T 3MVVA 1JB0E 5I9PA 2EQMA 4QIWB 4DU9A 2ZPFB 2L55A 1OZ3A 2KQWA 2RM4A 4RGNA 4C0DC 1NAPA 3EROA 1ENCA 4BE0A 3I73A 3OYFA 4R9WA 3ZBDA 2XU8A 1BYMA 4XTVA 3I55A 4QVCA 1RJTA 5C0XJ 1PLFA 1BDOA 3OYMA 3WDNA 2EQUA 1EZ8A 1U1TA 3TP7A 3HOUB 5G3LF 5DNFA 1EU4A 4RCBA 3HZXA 4PJOC 1D3BB 4NS5A 1II3A 4OB3B 3FRNA 4HKEA 5G3LD 5GANg 1B53A 3KUPA 2LQKA 3S16B 4JK1C 2KMTA 2B2TC 1Q8IA 2M2LA 1M9SA 5D6YA 2A69C 1IL8A 4JLGA 3CCRA 3LLRA 4M77D 4R56A 3V7RA 3S1QB 4ABNA 5CQYA 1WD1A 1DONA 3HFOA 3BYYB 2PW5A 4QCLA 2ZXOA 3TZUA 2JA6B 4JBWA 1GUNA 1H9KA 1OYXA 2F5KA 5HGTA 1MSGA 2A6EC 3TBIB 2K04A 4C92A 2B39A 1Q86C 2RD1A 2XN9C 1H641 1JRIA 3CXCS 4XYQA 3R2TA 5CQXA 1EWHA 3CEYA 5FO8B 4C8QD 2IL8A 3K5LA 5FU6B 2WKCA 1TVXA 3L3OC 1E0BA 2MF2A 2P0QA 2R58A 1VQ7A 1H9SB 1JORA 1RTNA 1I4HA 4PJOF 4YIJA 1TT2A 3BDLA 1F9SA 3MFYA 3HHTB 4IURA 5CIUA 4RG8A 3EJIA 1ZYRC 2ZPBB 3HFNA 2DZ9A 4I7ZC 1WJRA 4KHVA 1DOMA 2YRVA 5A2QE 1SNOA 2QCPX 3GTGB 5GAMj 3DLLA 1B3AA 5IOCA 1U4LA 1JC7A 2OF1A 4N9PA 2DZCA 4KMUC 2XI9A 2XNAC 4UDUC 1WTOA 1IZ6A 1A3UA 1KHIA 2F0LA 3H09A 1K9MU 1GHJA 3OMGA 1LTSD 1SNCA 1HFNA 4KY5A 4RAUC 3S1MB 2KUMA 3ERQA 2K2VA 1RDPD 2LQ8A 5GANe 4HAEA 4J6HA 1IKLA 3TZDA 1X32A 1RKNA 2EOTA 3QB3A 4CHTB 4ZGEB 1STHA 4MMKA 2GF7A 1EWCA 4A3DB 3BVZA 5GMKl 1YJ9T 2DO3A 4KD3A 3PFSA 2RQXA 2XRSD 3FIFA 4RHSA 3JCMQ 4Z9CB 4M75E 1EZ6A 3ZYYX 4C1NI 3N6RA 3A54A 3JCMV 2O5IC 3CCMA 3L2UA 2F03A 3A56A 1J9OA 3PT9A 1GXIE 2XSCA 3NTKA 4HEDA 3S3NA 3ITPA 5C3WA 4PNYA 4FF1A 4L63B 5A2QL 2DY8A 1Z7TA 5FOBB 2WKDA 1MGSA 3SK4A 3MWYW 4XTZA 1AN8A 4RKUE 1WNLA 3BFMA 4KN7C 5KE3A 2L11A 3X3NA 4ELYC 1VQ6A 1JICA 4BI8B 3G6JB 5DM73 3OHXC 3A8HB 1ML0D 2QI2A 3FDRA 1N8RU 3I72A 3V96A 1HA6A 1VQ5A 3CMAA 2HCIA 3E9FA 2TSSA 1RCVD 4QQ6A 2R7ZB 1RTOA 4NOYA 4ZN1A 2DY7A 3JCMd 4RCOA 5FRMA 4FF3A 2P0PA 4TVRA 1SE3A 1JWUD 1I8FA 3PNWC 1UB4A 1Y96B 3JCMg 3TN2A 2RDGA 1VF5C 2LY7A 2YU9B 3D3RA 2RHUA 3X3MA 3M7NA 4IUQA 2JA5B 4DAPA 3SK5A 4U68A 1HQRD 4C92B 4C8QF 4FT2A 4KUDK 4M75F 2J4XA 4WJWA 4B9XA 4PL6A 1CI3M 4IQZA 2MWOA 1SAPA 3QO2A 4B9WA 5I4DA 3QBYA 2PZUA 1TS4A 2K5LA 3URGA 2EFIA 3D4RA 2F3VA 2DK3A 4RKLA 2NVTB 5C4HA 2QKIC 3HS0C 5GANd 4QB4A 2XIWA 3PIPA 3JB9F 1BI3A 4FVMA 4FXKC 1BCPC 3RMQA 1JJ2A 1LABA 4BE2A 3S3MA 3CHBD 3Q1JA 2XICA 2YYZA 4ZGDB 1EIHA 1K83B 1Y8PB 2MI6A 1QVGA 2K57A 4LMQD 2A69D 5I6WA 2GFUA 2ICIA 5LJ3e 1G2TA 5GAOp 2IX0A 1TQOA 1VQ8A 2AHJB 4C92D 3J7YW 1B4OA 4M7AF 3E6ZX 2L8DA 3SWNB 3M4YA 3K6OA 2D9TA 4EQNA 4M7DE 5KRUA 5K36H 2A6HC 3RESA 4HCCA 4CBVA 1M1FA 2EAYA 1V1PA 4A3JB 4C56C 1A2TA 3PTAA 2E74C 3MHBA 4M7DD 2RDHA 2Y90A 1QWYA 1QOHA 4Y28E 5T1IA 4X3TA 1Y07A 1Q86U 2XWBB 4EPCA 2DJZA 4M77A 2SOBA 2DXBA 2KA7A 3P75A 4QF4A 4R55A 2HNIA 3EQLC 3PIO3 2IW3A 3MEAA 4C92E 3G4ST 4BY7B 1AW7A 2NUCA 2CW0D 1Y96A 2D0QB 2B8GA 2G9DA 4LDYA 5EQ0A 1I3QB 1TS3A 1STGA 3E1SA 3P7JA 4A93B 3Q0AA 4M7AB 1JJ2S 1Q90A 3P8DA 5EPJA 4X3SA 5JEAJ 5DM63 4LD6A 2X4XA 5E4XA 4JS5A 4PQXA 2R61A 3INZA 3OW2A 1LLRD 5I2YA 1AFPA 3CCVA 1EY5A 2EYQA 1E2ZA 2QEXA 3HG9A 3M55A 3GP8A 1VQ9T 4C0GA 2NVXB 3G7ZA 5GAOq 5BN4A 5M3MB 3CBMA 1CM9A 3MXNA 5GANj 3CCJT 1ESRA 1TY0A 1W4SA 3R8BA 1SNDA 4EQPA 2EJGA 3HOYB 2HDLA 2GFAA 4ME5A 4XQJA 3AB9A 5CVIA 2F0HA 3EAEA 2I07B 3A7AB 2NZ1D 4O6JA 4EDUA 1XXGA 1G291 1IKMA 5IGDA 3J80L 1GUOA 5M5XB 4O5VA 4LDWA 4M7AA 5HKCA 1BUVT 4CJ1B 4JRQA 1S5FD 1WCMB 1TS2A 3PIOA 2JEBI 2JP1A 2X4YA 2WINB 3OYLA 3VA7A 1PMRA 3A8OB 3OYGA 3GPLA 2AQ3B 3VR2A 1TWGB 2CZ7B 5GAMh 1BO0A 1TWCB 2EJMA 4RWSC 4BY1B 3DWAA 2GA4B 4M75A 2NWGA 1CA5A 1HA5A 4EQOA 2DTHA 3OYKA 3K5OA 3O8VA 4OVAA 4KKTA 2LT4A 1STYA 3FB9A 3P8BB 4C8QE 5KNCA 3CCLT 3CC4A 2LS01 5E1FA 1UNSA 5AFWA 2VNUD 5KYLA 4HT9A 5D65A 1V1PB 2YHTA 1EYDA 1Q1BA 3JCMP 2ZZDA 5DAUA 1U1SA 4UAIA 5HK3A 5JOBA 4K6DA 2K4YA 1S5BD 5EKLA 2F0MA 5IGCA 3CD6A 1QP3A 2RB6A 4DNRB 3IKJA 1H9MA 4C3IG 3PGGA 3OSVA 5JPMC 4RH6A 2F0IA 3SVMA 3JCMf 1R4PB 1M1GA 5GMKm 3FC3A 1RODA 2LX9A 4PMCA 1I4PA 3VYRA 1SJED 3RZOB 3BVGA 1YJWT 4MHEA 3TP5A 3BS1A 1R4QB 4D6WA 4K2KA 3F70A 5D14A 3QIIA 2KEEA 1SSFA 2XWJB 1BCPF 1KQ2A 4K5XA 1V29B 3HOVB 2K5IA 3HP9A 3MO8A 4BWGB 3L2QA 1F9PA 5EPKA 1XOVA 2EQKA 3R3OA 1LACA 1KDCA 2LMCB 3J81E 5D3DA 4JDSA 3Q24A 2F0DA 1D6EC 1XTCD 5IGEA 5FU6C 1NJIC 4CGYB 5GAMf 5EGTA 3QZ5B 1WVLA 1KLUD 1X3PA 4H13C 4A3BB 3OBYA 1V43A 2KVMA 1WTXA 1PTOD 1PFMA 2LCCA 1D5XC 1BF4A 1BIAA 3I56A 2LRQA 4NNJA 1KABA 2PUOB 2HQXA 3DUZA 3JB9H 2NTSA 5I9OA 4A54A 3HL8A 4HCBA 1K73C 3PUYA 1LTRD 4FF4A 2Q8TA 1PZID 3QPHA 2BKDN 2E2HB 4N4IA 1Y7XA 1VQ6T 2AWNA 4DQ2A 2QA4A 4PKCC 1D5ZC 1VQOT 2ZXRA 2EVBA 2QQ9A 2D5DA 2L89A 4C3IB 5LJ3j 4XTWA 4ZN3A 2OTJT 1X01A 2A73B 3S17B 1GUTA 1KDBA 2VXFA 4TKOB 1JCKB 3OWEB 1VQPA 1MI2A 5M5WB 2WB1B 2DEQA 3QZ9B 1Q12A 1JOKA 5LJ3f 5CV9A 2L0CA 4DK0A 5K36G 1SBBB 2XDPA 5C4ZA 2ZTBA 1B34B 1EY0A 1IHZA 2F0NA 4GLKA 1XNIA 2JZ2A 4F88A 1PRTB 3OBWA 5CMDA 4DOWA 1V1OA 4F7XA 1Y69U 1HRJA 1DXMA 2JUFA 4M7AG 2K5DA 1X3QA 1CQFA 3I4MB 3OS5A 3SWNC 4VUBA 2F0GA 1IREB 3NUCA 2HAXA 5HURA 5I2SA 3OMCA 1VQ5T 3LNNA 4BY6B 3CC7T 2KDSA 2F0SA 4QQDA 3QIAA 4U673 1M5Q1 5GAMg 5EPLA 1RL2A 2DIQA 5IT9L 2FL7A 2N55A 3C3LA 4E47A 4M75B 3R93A 1MGQA 3I3CA 2RDFA 5LJ5g 4M78C 3Q22A 3OYYA