5FLXE

Mammalian 40s hcv-ires complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
257
structure length
257
Chain Sequence
b'ARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
total genus 36
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00467 KOW KOW motif
E PF00900 Ribosomal_S4e Ribosomal family S4e
E PF08071 RS4NT RS4NT (NUC023) domain
E PF16121 40S_S4_C 40S ribosomal protein S4 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5flxE03
2.40.50.740 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5flxE02
3.10.290.40 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A 5flxE01
3P8BB 1XTDA 3I55A 1XNIA 1VQ7A 3CCMA 3LGLA 1YJWT 3CCJT 3CMAT 4RG2A 1W2BA 2CKKA 4QQDA 2JNGA 1M1KU 1JJ2S 3G4ST 3CC4T 1QVGA 1K9MC 1KD1C 1VQKT 1VQLT 5DLQE 2QEXT 1YJ9T 3LH0A 1KC8C 1VQOT 1NPPA 3CCST 2G3RA 3CXCS 3CPWA 1EIFA 1QVFA 1NZ9A 1M1KC 3DLLA 2LVMA 1M1GA 1M90U 2MWPA 1YJNA 5IAYA 1VQPT 2LQ8A 3CCRA 1S72T 3CC7T 3DB4A 1NPRA 3OW2S 2QA4T 2JUFA 1UEBA 1S72A 3G71T 3I56T 1KQSA 1NJIU 1M90C 1YIJA 1N8RU 3CD6T 3A5ZB 3JAME 5FLXE 1Q82U 1YJWA 3I56A 3CMAA 3CCJA 1K8AU 3CD6A 1VQ8T 1YHQT 2OTLT 3G4SA 3CC4A 1VQKA 1VQLA 2JOYA 2QEXA 3CCLT 1W2BS 1NJIC 2LCLA 1YJ9A 5J26A 1RL2A 1N8RC 1VQOA 1JJ2A 1Q82C 3PIPA 3CCSA 2KDSA 1YI2T 1K8AC 3J80E 2IG0A 3CC2T 2DO3A 1IZ6A 1YITT 1K73U 2E6ZA 3G6ET 3CCUT 1VQPA 3CXCA 1QVFS 5DM7R 4TVRA 2KVQG 3J81E 3CPWS 5IT9E 3ER0A 1VQ6T 1YITA 3KBGA 3CC7A 1X6OA 2MI6A 3CCUA 3J7AF 3CCVT 5A2QE 2QA4A 3OYYA 4CRIA 3G71A 3HKSA 1K73C 3OW2A 4ZN3A 2JVVA 1VQ5T 3DB3A 1VQ8A 2E70A 1YHQA 1KQSS 3LGFA 2OTLA 5HY6A 5LL6S 3I55T 4ZN1A 3CMET 1Q86U 1QVGS 1VQ5A 3CCMT 3CCLA 2OTJT 3CCQT 1VQ9T 1VQNT 2L3RA 1BKBA 3CMEA 1YI2A 2OTJA 3CCQA 1VQ9A 3CC2A 1VQNA 4X34A 3PIOA 1Q81U 1Q86C 3G6EA 1VQ6A 3CCET 1VQ4T 3TREA 3CPFA 2XHCA 2EIFA 1SSFA 1Q7YU 5J3BA 3CCVA 3CCEA 1YJNT 1VQ4A 1YBYA 1VQMT 3CCRT 1Q81C 1VQMA 1K9MU 1KD1U 1VQ7T 1KHIA 4YTLA 1Q7YC 2MWOA 1YIJT 1KC8U
chains in the Genus database with same CATH superfamily
1EZZB 3GTPH 3M56A 1O7YA 3K5LA 2QASA 2M0OA 3A8KE 4DV3D 2R93H 3CCJT 5EKLA 2EQIA 2CKKA 2B3GA 5ELNA 3SK6A 3I4NH 1LT4D 3TMEA 3GTPB 1I94D 2R93B 1J3TA 1S5CD 3I4NB 1C0MA 3RKWA 1S40A 2KSSA 2A69D 1RIPA 3T1YQ 3H6MA 4GOPA 2FHDA 2WAQG 5GANe 3M53A 3BG3A 3V7RA 3AMUA 1UAPA 2A08A 3NTHA 3DM3A 1LTRD 4BBRH 3EFRA 3VR6A 2LY7A 4A75A 2JJQA 1HNXD 3Q22A 4RCOA 3G7ZA 3MO8A 3OBYA 2A6EC 2BE9B 2X4XA 3MZ5A 1S72T 2EGCA 1ZSGA 2KECA 3KYHC 4LF4L 4DF7A 2JTMA 3OA6A 2K28A 4MZTA 2E4HA 1WTPA 2YV5A 4C8QA 4C3IB 3R6OA 2DUDA 2QGQA 5LJ5j 2O4XA 4R4OA 1B50A 1GJXA 4PFPA 4OO1G 4DFAA 3NWSA 4FYWB 4C1NK 3JAME 4DR1L 5I22A 1R77A 1XNRQ 1VQAA 1MHNA 1VQEA 1NEGA 5DLOA 2R7ZG 1HR0D 1W6JA 1NYGA 1I5LA 3QDRB 5AFWA 3HFNA 4LN2A 4DBFA 3FC3A 4AIMA 3SDZA 2DBMA 1HZ9A 1YVCA 2E5LQ 1VF5C 2HD3A 5IHKA 1N8RC 3NSWA 3CU7A 1KLUD 3U50C 2J0TD 5BN3A 1Q81R 1EWCA 3CC2T 1K3BC 3GQBA 1GBRA 4Y92A 4G4KA 5LJ3h 1SAPA 4ULLA 3OYIA 5ELOA 4IFDG 2X35A 2A3LA 2E6ZA 1HQMC 1QVPA 4LF6L 2KTLA 3CPWS 3QIIA 3OB9A 2V1QA 2CP2A 1VQ6T 1FR3A 4DV7D 3ZL7C 2JE6I 4CJ0B 3ONHA 4M75G 4ZGJB 1RAFB 3UF4A 4QMGA 4CKCA 3OYYA 4R1JA 4J9CA 4EDUA 1HR0Q 4ZN3A 2OT2A 4JS5A 1CZWA 2XTIA 1BBZA 1YHQA 3I9QA 1OXVA 1CQFA 2O5JC 3LGFA 1FXXA 2P4RA 4IJHA 3I55T 4ZK9B 1ILQA 2KCNA 2EKHA 1MBYA 1WTXA 1X01A 1D0ZA 2DL4A 1O7IA 5IP9G 2GA4B 2DFUA 3VA7A 2LT1A 4OMOA 1AWOA 3DEOA 5I11A 3A8OB 3W2DA 5IYCG 1CI3M 1PFBA 1WI7A 2D0QB 2DEQA 3H41A 3HS0C 4N8X1 4LK1C 2GGRA 4CDEC 2F2WA 2QGGA 4C8QC 4X65Q 2K5WA 4LW1A 2F0LA 4DV2L 5D6YA 4B9WA 1HJPA 4LDWA 2DERA 4JI1L 2F4VQ 2NUPB 4LF4Q 4RFBA 3U58A 4FSSA 2AHJB 2E74C 3CCRT 4K5XA 4R4QA 2L5QA 4GZYC 2RHQB 3A8GB 2L15A 1VOMA 2JA6H 1ZEQX 1H9JA 2EXDA 1N5ZA 3A55A 1EY9A 2QKIC 5C0XG 5KNBA 3H0GH 4G7ZC 1U4RA 2XGTA 5IGCA 1WCMH 3BYYB 3LGLA 4DR2L 3EGDB 2AQ1B 1UG1A 3M58A 4KLKA 1XMQL 1WHMA 1WCMB 4PK4A 4DV6L 2L11A 4A3LG 2PW5A 1UJYA 5JPMC 4ZKBB 2MYSA 1HR0W 3FHWA 5C0MA 1Q1EA 3PF5A 2LCCA 1H3EA 3RDVA 4P74A 2QI2A 4AQYL 3CCST 3RZOH 2CREA 3NWTA 1EIFA 2OF1A 1H9SA 2XI9A 3RZOB 1M1GA 2I1SA 4KKSA 1M5Q1 3C4SA 1BCPB 4GN4B 1AZQA 4B3SL 4FYDA 1S4ZA 4D8DA 4RHSA 3L9AX 3GBQA 4ELYC 3BVMA 1UB4A 5LMUD 3M0PA 2RA4A 3M9BA 3P75A 3MP8A 3OSOA 5KYUA 1WTQA 2LFNA 1B9MA 5IWAQ 2KYBA 2QK0A 1JRIA 3MXUA 1K8MA 5GAOr 4HIMA 4DV4L 4A4FA 2EYJA 2JANA 4Z89A 2C5CA 3KYCB 1YJWA 1D2BA 2EBPA 2WIIB 3O8VA 2Z1CA 3NK9A 5C6AA 2FHTA 1WD1A 4LFBL 1HA6A 1ESFA 2IT1A 1PD0A 4QVCA 1VQLA 1LTLA 2K33A 2KENA 2JOYA 3UPUA 1PHJA 3S1RB 1ASZA 3TSWA 1X3QA 2A37A 1FMKA 5CR2A 1YJ9A 2Q8TA 1LTID 3HOVG 2KYMA 3IKJA 2DE0X 6AT1B 4E7KA 2KDSA 4X9CA 3DXJC 4MZ9A 4J7IA 4ATOA 2P84A 1Z9ZA 2H3JA 2ZPBB 3V8LA 3BVGA 3JB9D 4JI3L 5I2YA 3L2PA 2JN0A 3AT1B 4O0AA 5T1IA 3G6ET 4KGXB 3NPFA 4TVRA 4BUGA 4XQ3A 2LZ6B 4M77B 3Q0AA 2RM4A 4Y28E 2R6GA 1E6GA 3RR5A 1ASYA 4B3TL 4DUZD 4PLIA 4FT4A 3D4WA 2EJMA 3TSZA 1IBKL 1E7ZA 1PH5A 9ATCB 3ULLA 3OIQA 2PPBC 1QOHA 3STBD 2R93G 3CCUQ 2Z6KC 1EUJA 1CKNB 2PO4A 3VYTA 5KH6A 3I4NG 3H3VC 1NNXA 1VA7A 3G71Q 4YCVA 4A3GH 4QVZA 4IUTA 2EYPA 3PMIA 4DV5L 3HOWH 2KQWA 4A3GB 3CCLA 1SE4A 1V76A 4JJDA 2IY5B 4JBJA 1TS4A 1XJVA 1PCXA 5FLMH 1RTOA 4KK7A 4BBRG 1M8MA 4CC2A 3IFDA 4K8JA 2W10A 2DD5A 2AZSA 4X1VA 1EWHA 1MIUA 2PI2A 4ALPA 3T13A 2KEDA 1Q81U 1YI2Q 2HQHA 1ICFB 3GP8A 2EXZA 1N27A 3X26B 2F69A 4DR4D 3EFSA 4DR5L 5KGUA 2FMMA 3TQ7P 3CAMA 5J1ZA 4IUNA 2EQJA 5LJ5g 4A3KH 2ES2A 2RHSB 1KJWA 4JI4Q 2DJFC 4JZ4A 4YHHD 4GLXA 1WTHA 2K2VA 1EY6A 2SOBA 2EPBA 3E2UA 4C92D 2VW9A 2RI5A 1VQFA 4F14A 4MMLA 3J80i 1WX6A 5DEHA 1DOMA 4R4CA 5GAN3 4GY5A 3KUPA 3CCMA 2JS2A 3JCMP 2K5DA 5D6WA 2AT1B 4QQDA 3HOYH 2EGAA 2RDHA 1JEGA 1X55A 4UPAA 2V1RA 4JDSA 3UWNA 3RLNA 4C3JH 2GTJA 3HOYB 2RBMA 4PJMA 2NTSA 4RGMA 1EQVA 2IWHA 2JQOA 2UUAQ 1FWZA 4EMHA 1CKOA 1TWAH 1X3EA 3A1PA 3PNWC 4M78D 3OS1A 1WD0A 1VF7A 2B2YA 3T1YL 1B53A 1TWAB 2VYTA 3LX7A 4RA8A 2ZTCA 4YHHQ 2E1HA 1GBQA 3I7FA 5JVG3 4DR7D 1LJOA 2BIVA 1G6PA 5LJ3f 3TEEA 1CKNA 4WTOB 2XWBB 3JSCA 3QDFA 5M5YH 4JBMA 1N36D 2E2HH 4JG2A 4K2KA 3BDCA 5CBAE 5M5YB 4RTYA 4PMCA 1DCZA 1SSHA 4A63B 1V1PA 2B29A 4L5GA 4KHVA 1SE3A 5FROA 3OS0A 4M7AF 1PRLC 2C0IA 3S15H 1M2VB 1WZOA 1RADB 2BCOA 1XNRL 1A0NB 4HCZA 3M9QA 1ARKA 3LWHA 3S15B 4C5GA 4O6JA 1RI0A 5J26A 3AU7A 4H02A 3KDFB 3CC4Q 2UXBQ 4N0AA 1EZ8A 1Y8PB 1I8FA 2VQFQ 4C0ZA 1PA6A 2QDLA 1TWHB 5E3FA 3E5SA 1I0CA 1A15A 1PH9A 3TP7A 4PJOD 4RWSC 2I0QA 3J7YW 2KVMA 1IBMQ 4KHPD 2N88A 1L0WA 2FL7A 4A3JH 4EGVA 4J9BA 4XQQA 1VQPQ 2B86A 2VGNA 2QA4A 1U8RA 2DYBA 3KFVA 3H0GG 3LWEA 2R92H 2E2JB 1Q46A 1WCMG 1KD1R 2R92B 2K6AA 5C5LA 1TS2A 4LUDA 3MEUA 2MUYA 2DXCA 3A8MB 2NYZD 4TQUS 4M4ZA 3F2CA 2D1XA 1PKSA 1UECA 3DWPA 3NELA 4QUCA 3WOFA 1HR0L 2BTTA 2YLCA 2YWWA 4DAYB 1IYUA 1O9SA 5KEEA 2DNUA 2E75C 2Z4IA 2NUZA 4CKEA 3F8TA 2EYQA 2KGTA 2V8JA 4C0FA 3N52A 4BA2I 3HZXA 4B3MD 2LX7A 2K7VA 5KIXA 5GMKm 3CBOA 4JI0D 2EJGC 3JB9H 1LCKA 2QAZA 4JBKA 3MHBA 2M16A 3J7A5 4KHPQ 1SFOH 4XTCS 3MXNA 1MGQA 2JTEA 4KH0B 2WINB 3EG3A 1CQVA 1I3QH 5C5MA 3KLRA 5IN1A 1B44D 1GKHA 4DV7L 2RHYA 1PD1A 1I3QB 3CCEA 5CMDA 1H92A 2HDLA 2DYIA 3ERSX 4OHJA 3SD4A 3KYDB 4QQGA 5EGTA 1H9MA 2F4VL 4M75D 1VQJA 4JI5D 3AEVA 1ET6A 1JOOA 4N0AC 1KHIA 1X69A 4PNOA 1RDPD 4H0LC 4M7DF 2BZ8A 4LMQD 5LL6X 2Z0WA 4KTAA 1JR0D 3LYIA 1VQ7A 1G3TA 1AW7A 4Y52H 4NB3A 1BB9A 2DVEA 1Y14B 3KDFA 4JI0Q 1M1KU 4RH6A 1BXTA 3ZEHA 1JJ2S 1QVGA 1MMAA 4C2MB 1IB8A 1EFNA 4M77G 4PJLA 1V8QA 1PYBA 1FVIA 2XKOC 1RKNA 1SMXA 4F7UB 2CFMA 4OIKA 3SHLA 3U4ZA 3TZUA 5BN5A 5DAUA 2LX9A 1JE5A 3CP0A 4C3JB 2F0OA 2B63B 4P2CB 5GAN6 2OJ2A 2Z8LA 4JLIA 5IH2A 4LNPA 2EYWA 2ISTA 1I4HA 1VQKQ 3MAQA 1HNWD 3S17H 1YJNA 4R4TA 3MTSA 2XU8A 3UDFA 1B9NA 1UGVA 2AKKA 2EY1A 2FJ2A 3S17B 4E2FB 1D3BB 4FXGC 2KT1A 2O01E 4JI5Q 2K2MA 3CC7T 1CSKA 2D62A 2EYHA 4MDXA 1PSFA 2F3VA 4A3GG 4QIWE 3UDCA 3UE1A 3TBIB 5CKEA 4PQXA 1KDBA 3JCMg 4C92B 2RCFA 3PUYA 1X6GA 4DAYA 1OXUA 4GKJQ 2BE7D 2NLUA 1F9SA 5FLMG 4NW2A 2PI2E 3CKIB 4IQZA 3CCJA 1UGSB 3QR8A 2NVUB 4NXMD 2ATWA 1RF2D 1K1ZA 1KC8R 3F70A 2WSEE 3CMAQ 2D8JA 1GRIA 4NS5A 5G3LD 3L42A 5I2SA 3PO2B 2K50A 1RL2A 2F52A 4GLKA 1MUZA 5KYXA 2IPKD 1Q82C 4OGQC 2Q8RE 4AH6A 4J6XA 1HNWQ 2Z9HA 1YHAA 3J80E 2F5TX 4YWMA 4RTZA 4A3KG 1LYLA 1BIBA 1WTWA 4M78B 2HSPA 4PLLA 3REAB 1S5DD 4TKOB 4WJ3M 2F0FA 1CKAA 3GTGH 2NTTA 5LJ3e 3OTOQ 4A93B 1J5ED 1JH3A 1P92A 3VRZA 3S3MA 2R5AA 1ZA1B 3ITPA 5CK9A 3GTGB 1PTOF 2ZPIB 2G9DA 5IGDA 2ZAEA 1SF9A 2K04A 4DNIA 3BVZA 1DOKA 4J1MA 3GTKB 4BY6C 1PH4A 3HOYG 3K5MA 4A3FH 4FYXB 4LUEA 1O78A 1LO5D 3S3OA 2DN8A 2NUTB 2EKOA 3HKZB 2RSOA 1NMFA 2KOLA 3FIFA 2L1BA 4O2DA 2HAXA 5C4JH 4J9DA 1K0XA 3MEHA 4H13C 3INZA 1X3GA 2VZAA 1HK9A 1N9RA 1K4US 3RZDH 4QQBX 4F7UA 4DNRB 2I5LX 4OIJA 2OTLQ 3G7LA 4JI8Q 4B9XA 1K76A 1IYJB 4IPHA 3CMEA 1VQ5Q 2E2IH 3VS6A 5C4JB 1VQ9A 2DM1A 4IO9A 1EYGA 3CC2A 1A0IA 4MTNA 4P72A 4J83A 3I5RA 4EMKC 3E6ZX 4HJAA 1J5EQ 2QTVA 1GXIE 3UE0A 2DXTA 4ME3A 5GAN4 2MNAA 3MCAB 4AMCA 3EVQA 1FMWA 2F1LA 2MOXA 1VQ6A 4PJOB 1G83A 3CPFA 1D3BA 1JJCB 2KA7A 2Y0SE 5ELBA 4RTWA 5IT9L 1Z9FA 3LNNA 3BS1A 1I4RA 2CWPA 2CWAA 1VQ4A 1IXRA 1CKMA 3TS2A 4J9GA 2N3SA 5L23A 5EC7A 1CT1D 1HFNA 3E19A 2AZVA 4AYBE 4K5WA 4DR2D 1G3WA 1KD1U 1B7YB 3H3VI 5GMKh 5IODA 2PQEA 3SFMA 1XMQD 1UE7A 5H1SE 2MWOA 1DXMA 3P8BB 2V8KA 1RAAB 5L8RE 2FPFA 3I55A 3HRTA 1BDOA 2KR3A 1LTSD 1Q90A 1T0JA 2N49A 3TP8A 2WSFE 4CKBA 3HOXH 2KRSA 2VXFA 2R7ZB 5CV4A 4AQYD 1MHWC 5CCAA 5EJWA 3MPUB 4GKKQ 1D09B 2MCNA 2D8HA 5D14A 2K7AA 3GNFB 3LH0A 3JAMi 1H95A 2K03A 4KI0A 3H0IA 5LJ3j 3GPLA 1K73R 1FJGD 3CXCS 1CHPD 4GNXB 2R92G 2ZXPA 5IT9c 3JCMd 4DR4L 1JB0E 4C0DB 1SJHD 1M90U 2A36A 1R4QB 1ML0D 1KRTA 2QDYB 3TSSA 1WTVA 2UUAL 5IAYA 2BDOA 2IW3A 3GV3A 1GCPA 3QJ6A 1Q12A 5CGKA 3CCRA 1X9NA 1AZPA 2F0WA 5EPJA 1YNNC 2ZXOA 3E0JA 1MI2A 1M30A 4KT0E 2L12A 4YHHL 1U1SA 1KFZA 2Z4HA 1STAA 2WP8J 2A7YA 1SSOA 1PRTF 3META 4HAEA 3GTJH 5GAOm 2BA0A 1SNCA 2ABLA 1IGQA 2F0NA 2RB6A 3OPOA 5GADC 4UHVA 1Q86R 4J5YA 3AFPA 5CORA 5CC4A 1XOVA 2BA1A 3RIRA 3V7SA 3JB9G 2JM9A 4DK6C 1DJ7B 1EYCA 3RNJA 2E5QA 2K32A 2RF4A 3DM1A 4JI3D 3J81c 1FJGQ 4MNOA 1A3UA 1Y7XA 3KF8B 3HSBA 2ZZDA 5KCOA 3SWNB 5AJ3Q 3CCSA 2PUOB 3VR2A 3Q23A 2H3EB 2QEXQ 2VQED 1SRMA 1MD2D 3W3AA 2R7DA 1Z9QA 3VKIA 3QWYA 3D4RA 1NG2A 2VQFL 4GS3A 1IBKD 4X64Q 2XRSD 3H94A 2P4TA 1WYDA 4DR7L 3M4OB 3A7LA 4QF4A 3RMSA 2F0QA 2JSOA 2HDMA 4NDXA 4DPGA 1MNEA 1DM9A 1SXTA 2EYZA 2FVUA 4LWCA 1EOTA 1N36L 1JU5C 2N78A 2F0VA 5FJ8G 1EX4A 4K0KQ 1H641 1G3YA 4M7DC 3SK8A 4DV5D 4MDWA 1NTGA 3JAML 2B2TA 1M27C 1BI0A 2LSSA 4F7UG 3THKA 1WHGA 4HIOA 4OB2B 1D5ZC 2E8GA 2L9HA 4C3JG 1Y1VH 1AWXA 2V8IA 1SKUB 1EIYB 1XX8A 3RD4A 5GAHC 5I6WA 1Y1VB 1UHCA 2XK0A 5KYWA 1Z6HA 3GDEA 3ND8A 5IIFA 2VQEQ 1PH7A 4AG1C 4GNXA 2YT6A 2XDDA 2RMOA 2XN9C 2MO0A 3OWEB 2LTOA 3EFOA 2M2LA 4L8JA 1BNZA 2HBPA 2OTJQ 3OOCA 2AMCB 4KKTA 1GCQA 3G6EA 3CCET 2J05A 4BI3A 3TREA 1HFGA 4C92G 3LGJA 3RR6A 4KHPL 3EHQA 5CBEE 3VS4A 4ZGEB 1DYQA 2A6HD 3VS7A 2P0KA 4LD6A 4M75A 3HTRA 4CC3A 2HNIA 5GAN8 1G8ZD 1ICWA 2JA7H 1RAHB 4DEXA 5DNFA 3S1QH 3CCVQ 2L55A 1LTBD 2KRNA 3NQTA 4M1UB 2JA7B 3JAMc 1WYXA 1PYWD 1K9MU 4LF8D 3M0UA 1L1OA 3PO2G 3S1QB 5ELCA 3DKMA 1VQ7T 2MP1A 4J15A 4M7AE 3ZJYC 3Q24A 1K8AR 2DMOA 2PYKA 2K6DA 3M4YA 2QQSA 3I8ZA 2DIQA 3QWNA 3MEVA 1I4PA 3DHQA 4BB7A 1NY4A 1PH1A 2HHHQ 4X62Q 4JRIA 2WSCE 4M78G 3SWNA 3EG9B 1ZA2B 1EZ6A 1M8AA 4A4IA 2VB3X 5FRNA 2VB6A 3VS5A 5GAMg 4A93G 2YTVA 4KD3A 4N8FA 3T1YD 1X75C 4JI0L 3EN2A 1BYMA 2JN4A 1STNA 2IX3A 3KJPA 4DUYQ 1G51A 5C3EH 4ME5A 2Q2TA 3REBB 1NSNS 1PH3A 3NMZC 4H7BA 2ESWA 4RTVA 1SYFA 2B2TC 1ZYRD 1I6HH 2B8FA 2W0ZA 3QKJA 4ZGDB 2H1EA 2R7FA 4K14A 3HKZG 2VB2X 3CF5A 2B2VA 1UGRB 4OELB 1I6HB 2EY2A 2QF7A 3OW7A 1QVCA 2DNEA 1Q7YR 3RESA 3MXPA 4RTUA 3FEWX 2DL7A 2LRQA 3C1EA 3G71T 1JICA 4JI5L 4GLAC 2F3IA 2VXWA 3S2HH 1G2BA 1PMRA 3JCMQ 4DGZA 4DBRA 1Y71A 1RAGB 1XNRD 1GFCA 1LTAD 3S2HB 1CA6A 3HFZB 2F0DA 1BBWA 2N55A 5A0GA 1HJDA 3OYHA 2QCPX 3T9NA 1YIJQ 4IJLA 2SEBD 3H9NA 4PJOG 3I56Q 5HCKA 2E5LD 1CTMA 1DM0B 3OW2P 3VUZA 3K80C 3K0YA 4IN3A 3OYLA 2F0KA 3ERQA 2RNAA 4JJCA 3G4SQ 2XIWA 2JA5H 2QQBA 5FU7B 1YI2T 3DH3A 1TUDA 3UDIA 2XDBA 3KJOA 3G1JA 4BBRB 4M77D 2JA5B 3QZ9B 2Y4XA 2DL8A 1VQOQ 1I4QA 1K73U 1L1OC 2DK3A 2JMAA 3CCLQ 1QWYA 2AQ3B 1WJRA 2QTXA 3VYHB 1YN8A 2FZGB 4IUQA 1HTLD 2YUQA 1MGSA 1DGSA 3U4VA 2YDLA 3NQIA 4HMIA 1O7ZA 1QG7A 5A2QE 1KSKA 5KE3A 5HURA 3OTOL 4UP7A 2AIRB 4Z8AA 4M7DE 3QJYA 4IPCA 3RBBB 1WHJA 3HOXG 1HZAA 2JVVA 4WF2A 2KCTA 2ZXRA 1SMYD 3EG9A 2HMAA 1N8RR 4WFN3 1PVOA 2VY3A 4DK0A 1Q86U 3CMET 4NXML 1AVZC 1VQ9T 4ABNA 4A3CG 3BDLA 5LJ3g 3E9IA 4R8IA 1B2TA 2DXUA 1PKTA 3CCQA 4QY7A 3L7ZC 1VQNA 4PZ8A 1KAWA 4X3UA 3MP1A 1HZCA 1QKWA 3SGIA 1W6XA 5KYLA 4X65D 3SE0A 4CC7A 1RLQC 1UUEA 2ATCB 4HCCA 2DLPA 2L89A 2XDPA 3BZCA 1EL0A 2O31A 1VQ4T 4RCCA 3OQ5A 1QB5D 1BCMA 1J5EL 2UUCQ 4JI7Q 2E41A 2F4VD 2BZYA 2FXQA 3C95A 5J3BA 3K5OA 1X3FA 2QQ9A 4JPBW 3N5BB 3VYRA 2BE5D 2NZHA 2ALYB 1QUQB 2I07B 1PRTC 1Q81C 1PFNA 4GOPC 1XNQD 1JOQA 3KLSX 3GV6A 1NJIR 1OV3A 5GAMd 4FT2A 3R2IA 2DL5A 1QWFA 2QGFB 3JC66 1BCPF 4RCNA 4J7FA 3KXTA 5GANj 1VQMQ 5AYFA 1X56A 2EZVA 3NHNA 2GQVA 4FYVB 1GUOA 1XYIA 3CC4T 1GUWA 4BI4A 5FU6C 4QCLA 3OY9A 3E9FA 2K3YA 4OGEA 1JB3A 4CDCC 5DM63 4DEYA 2CVRA 3MEFA 2IJ0A 1W1FA 1VDZA 3EH1A 5J22A 2RA2A 1JB7A 3L1AA 2RK2A 3OMCA 2EE1A 1XNQQ 3TCJA 1E1TA 1VQPT 3CMMA 1SRUA 3A7AB 2RDFA 2JA6B 1S1NA 4PZ7A 1N34D 3QYGB 1Y0MA 4PKCC 1Y1VG 3NBHA 5IWAD 4OWWB 2VUMH 2HKNA 2K52A 3H0GB 3T1HD 2PU9B 5CYUA 2PZ1A 1I5FA 2YXYA 1UFFA 2JW4A 1Q95G 1K8AU 1AHJB 1LTGD 2VXEA 3CD6A 3LX0A 4JI2Q 1ZXTA 2BH8A 1HH2P 1FYCA 3A74A 4KN7C 1F2YA 3J7AV 1P16A 1QMCA 2DEUA 4XXEA 2LJ3A 2HQLA 2G9HD 1GO3E 1WXUA 2LQWA 2SRCA 4APVA 1PZKD 2CUBA 4DR3Q 3D6CA 4RKBA 1X2QA 1K9AA 2A19A 4JV5D 4C5EA 3G48A 1K28A 3ZBDA 4JCVE 1FJGL 1MKHA 2JA7G 2K05A 5AJ3L 5CO7A 3BDUA 1KAAA 2L4NA 3FLGA 3M5AA 1YITA 1WJSA 4HKEA 1JE4A 3E3XA 3CC7A 4CJ2C 2EQMA 4FXKC 3T1HQ 3CRLC 2G5DA 4BWGB 3A8IE 4LDVA 1SLJA 2H4OA 3CHBD 1NYFA 4J9HA 3M4QA 3SHWA 2ICIA 2VC8A 3O5ZA 1L2FA 1ZBJA 1KK7A 1GL5A 1EOVA 1LM0A 4P75A 1EY4A 4HCEA 4K0KL 3V8KA 1SPKA 1ZBXA 4FP5D 5BN4A 4KRTA 3GTLH 2RHUA 4RG8A 2F0PA 1OZ2A 5NUCA 2J7ZA 5JEAJ 2L8DA 4XDXA 3GTLB 2VL6A 2C0OA 1VQ8Q 2QG9B 5FO9B 1VMPA 4JV5Q 2UXCD 3VJPA 2NUPA 1M2OA 3HP3A 4EIKA 4FIBA 3IRBA 5JPNC 2VQEL 5A0DA 2KMTA 2JA8H 3VYUA 4EMGA 2E3IA 1FL0A 2F0TA 1KIKA 1OI1A 2EYLA 3BFMA 2ICEC 2RDGA 3FMCA 5GROA 3SXHA 5LHY1 2JA8B 2K5QA 1VQDA 4EQOA 4POFA 5FOBB 2COZA 4FXDA 1TU2B 4II2A 1R9TH 4JI4D 1V1OA 2UU9D 3EGDA 1G3SA 3J7ZC 2O88A 2JS0A 1EYAA 1V9PA 2VS1A 2WB1E 2Q2UA 2KCCA 5FWCA 4AT1B 3NUCA 1BF4A 4DA4A 2KBTA 1F9RA 1XPUA 4HA8A 5IHIA 3QIAA 1CSPA 5D7UA 3HOWB 5GMKe 1D6EC 2YRVA 1KNEA 2JA5G 2UXCQ 1AH9A 3CMAT 2PQAB 1W2BA 1R4PB 3VYSA 4VUBA 1WDXA 3OS2A 4DR6D 2K5FA 2NVXH 4C8QE 2C9OA 1D1BA 5DLQE 4DK1A 1JWUD 1Z7TA 2XG8D 5LMNQ 2UUAD 2O2OA 1LT3D 4IUPA 3I5SA 1QVFA 1DONA 2Y0SB 1F2LA 1M1KC 4KY7A 1NE3A 2UU9Q 4DUYL 4IIMA 2QXFA 1SEBD 1CK1A 4A3KB 5J39A 1KLGD 4JYAD 4UP8A 2X4WA 3QO3A 3A56A 2RH2A 3ICEA 3TRZA 4UDUC 1TS9A 1OULA 3EBEA 2MK5A 3KLSA 4LDYA 1TS5A 4AYBB 4POGA 2RKSA 4LF8L 1IBLQ 2VVKA 4O5VA 4RUGA 1NJIU 2LKVA 2O9VA 3A5ZB 2CW0C 1WIEA 1YNJD 2NN6I 4L5QA 1S72Q 4ZYSA 3S9WA 4DR6Q 4X3KA 2MHVA 1UGQB 1TIID 3EHRA 5KYNA 5C44H 4JW0A 2OTLT 3HRUA 1OU9A 3CW2C 2VV5A 1UE6A 1Y96B 5C44B 3S2DH 1XXGA 1CHQD 1NBWA 5D3IB 4M77A 2DL3A 3PMTA 1CSQA 3ASKA 4IURA 2AK5A 2E10A 1JJ2A 1EEID 5EQ0A 3A8LB 1SYBA 2VQFD 3ZYYX 3V7CA 2J06A 2FYKA 2Z0SA 3KOJA 4AFQC 1IHZA 2A68D 1IHVA 1TR5A 2DO3A 4GLMA 5IHNA 1STEA 4FVMA 4JYAQ 4LF7Q 1F9QA 4CGYB 2PVDB 1IBMD 2YTXA 2RPNA 2FRYA 3UT1A 1LLRD 2E2HB 1W2BP 2NZ1D 1DOLA 3CC2Q 4E6IA 5LMNW 1ZSZB 2L0CA 4A3DH 5GANg 4KV6A 1BCPC 5HGTA 1WTRA 3JB9F 5GMKj 2L3SA 4XT1B 1X6BA 4HEDA 3OYKA 1LT6D 4A3DB 1OZ3A 4IOAA 5CAIA 3PUWA 1V1CA 3P20A 4L6TB 4HIDA 3HRZC 1ENCA 1MMDA 1QVFP 3V96A 3D6WA 3JCMc 3PUXA 1RHPA 3EIVA 4Y91A 4XQJA 4RHRA 2B8AA 3CCQT 4A54A 4JOIA 2DETA 1VQNT 2QDBA 2E5LL 4JS4A 5CV9A 2UXDQ 1UNSA 1BKBA 2ED1A 3BE3A 1Q8IA 4KKUA 3RUZA 1PC0A 3J80L 2VKNA 4QW2A 2OQKA 2RJFA 2PZTA 2JA6G 3I55Q 2LQKA 1SHFA 5F2DA 4BA1I 3RUXA 5FO8B 5ECAA 4A3JB 1D5XC 2K5IA 1FNUA 2A69C 2BH2A 2VUMG 1IRXA 5FO7B 2F0UA 1EIHA 3JCMJ 2IVWA 2GFUA 4AFZC 1YBYA 4PFOA 4YCWA 4F7UF 3S1MH 4P5NA 1A2TA 2ENBA 3GD7A 1WNLA 2HD0A 4R55A 4ZNXA 2KEEA 2DILA 4FYYB 1D5MC 4JI7L 4A3IG 1K0SA 3S1MB 3QHSA 2OQ0A 1RUWA 4UAIA 2B2YC 1UHFA 1AZGB 2F0HA 2K75A 3EG0A 2KHSA 3C94A 2E65A 1M8VA 5LJ5d 5KNLA 1U0LA 4C0GA 4UP9A 2X6GA 4K8IA 2C0TA 3R2TA 2RI2A 1ZHIA 2B2UA 4DAMA 3E9GA 1KD1C 4MHEA 2COYA 1CUKA 3J80c 2QEXT 1QWEA 3VS3A 1SFOB 2EJFA 2IPOB 3L3OC 3I73A 4X65L 2K5LA 1SMYC 2KJXA 5IOCA 5C0XI 2OAUA 1PSEA 4NXNQ 3GTMH 4WJWA 2CP3A 1K83H 4BBSH 1BCOA 1ZSZA 4X3TA 1VIFA 4KH1B 4IUUA 2GCXA 4R0KA 5HK3A 1E0BA 2F0SA 3GTMB 4BBSB 2RN8A 5ISRA 1XNQL 4ZTJA 1M2VA 3P8DA 1KNAA 1UEBA 1E6HA 2MF2A 4GKJD 4M78F 1JQQA 2K6PA 3FB9A 1AEYA 4M7AB 1M90C 4J8QA 4II3A 3CD6T 2A28A 2ZT9C 4XTVA 4WORA 1QCFA 1AOJA 1TU0B 1KDAA 1M1FA 1WFWA 2A5HA 2DY7A 2PNIA 4FU6A 2HBWA 3RERA 1TS3A 2EW3A 4IOCA 4HT8A 4HJ5A 2JA8G 1EQTA 1B34B 4OMMA 3VR3A 4BY1H 1O75A 1LPLA 1OX8A 3TVTA 1EY7A 5M3MH 3PIPA 1P9KA 1S5ED 1Y57A 3K81C 3MFYA 4RGOS 2F4IA 2A6ED 5M3MB 5GANd 1T0HA 3C3LA 2DZ9A 4UC4A 3TP5A 1YITT 1YWPA 4DR3L 1XTCD 1HHVA 3M7NA 4FL6A 4RMOA 3OTOD 4CDFC 3CXCA 4HSPA 4O1NA 3HOWG 2DY8A 2DD4A 1OXTA 3CCUA 1X43A 1AN8A 3CCVT 2K4KA 4PFZA 2HKQB 3C12A 1IO6A 2F0IA 4QL5A 3S16H 3G71A 1AFPA 4NMZA 2K3BA 1FNVA 2B2UC 2X69A 5IWAL 5EPLA 5M3FH 3NPPA 2SNMA 3S16B 3T1HL 4PJOF 5C3WA 4DN4M 5M3FB 4OP0A 3LWUA 2EJFC 2JZ2A 4KGVB 2RVLA 5E4WC 1QW1A 4QT7A 2KBNA 1V29B 3VS1A 3LWIA 4JVZA 1Q82R 2Y0SG 1CFMA 3ONAB 4JI8D 2VGMA 1LABA 2PTKA 3I72A 5CVIA 4CHTB 1GUNA 2VWFA 4C5HA 3X24B 1YI2A 2MJ8A 4U68A 4R9WA 3K57A 1WQ7A 2JXMB 4OMLA 1TVXA 5CKFA 4K11A 2X9HA 1OOTA 2DTOA 3JCMh 4UY8C 1J6QA 4NL3A 5D6XA 1VQGA 4JV5L 1WI5A 4AYBG 1GVPA 4Y7NH 2FPEA 2Y90A 3KUFA 4PNYA 3T4AC 3X20B 3ULPA 2XHCA 1QVGP 2DX1A 4OL7A 1M4VA 2KUMA 4Q5WA 1QJOA 2LMCB 5CQYA 3TEHB 2GBQA 2DPPB 2ECZA 1KQ2A 1UEAB 1D8LA 1FGUA 2OWOA 4RKLA 5BR8Q 3C46A 3D4DA 4A3FB 2Z6BA 5C44G 2RHZA 2SDFA 3SB2A 1JBMA 4ZKCB 3K0XA 3K7UC 2NVTH 4E47A 1RTNA 1E22A 2LJ0A 3OBWA 1Y8QB 1YIJT 2X4YA 3EG1A 1YCSB 1D1IA 4DR1Q 3RZDB 1SROA 4HIKA 4CJ1B 4F87A 1EWIA 3TDQA 2E12A 4C3HH 3OYGA 2LT4A 2E2IB 4C8QD 1TUCA 1K3RA 2LCSA 3G4ST 1K9MC 4M75F 2AUKA 4GKKD 1KSWA 2UXCL 4C3HB 3URGA 2X3XD 3NTKA 4R56A 3KLWA 2ASBA 1B4OA 2CH4W 5LJ5f 4QVDA 2EPDA 1VQOT 1NPPA 1P8LA 1W6KA 5FW9A 3JCMb 3RMHA 5CKHA 3VS2A 1A63A 1SYCA 1ABOA 4OMPA 4K5VA 1OYXA 1BVSA 3L2UA 3J81j 4C92A 5LMNL 3JV3A 1FD7D 1LUZA 4A3DG 1TQOA 2MWPA 3R6NA 3I4OA 4NP5A 3FRNA 1E2ZA 1RJTA 5M9OA 4XYQA 1C8CA 2EAYA 1C7YA 5JAVA 1SYDA 2GN5A 3Q8DA 4JI4L 2UU9L 3RN5A 1PLFA 2M51A 4P71A 1E24A 2AQ2B 4A3MH 3GTQH 1SG5A 2NN6H 1SEMA 1KQSA 4A3MB 3GTQB 1WPYA 4XU3A 4ZUIA 3OS5A 3HOXB 5HKCA 1IBLL 2MPMA 1A6XA 1JT8A 1AZEA 1SBBB 3STBC 4TSSA 3PO3H 5KYYB 1SYGA 4M78A 1WFQA 3CC4A 2JT4A 3EGUA 2PZUA 2HL3A 4A3JG 2P0QA 3PO3B 2O2LD 4DR6L 1W4SA 1D0YA 3OYNA 4AFUC 1NAPA 2SNSA 2J4XA 4BE1A 5K36H 4LFCQ 1QCBD 5IGBA 5EKKA 3UI2A 1BI2A 1IL8A 2IHFA 2BOSA 1PTOH 4E7ZA 1EY5A 4R8NA 3OYEA 1VQPA 1PTOB 1AD5A 2CP6A 4JC0A 4XYOA 4DV2Q 4X64D 1RI9A 2NUTA 2CZ7B 5G3LF 4QGUA 1F77A 2KHIA 5FQ2B 4JYAL 3BW1A 2YU9H 3J7AF 3TQYA 3S14H 4LF7L 4E7HA 1GM5A 4NOYA 2V1CC 1M3BA 4K0KD 2YU9B 3S14B 4B08A 3GTJB 2KROA 1K73C 3FDTA 3NHHA 2KXDA 3ND9A 4FCYA 1NR4A 3X3MA 4BXXH 1D1AA 1RCVD 2RO0A 4HCKA 1HYOA 3RKYA 1MNDA 1HUMA 4G7HC 3A5UA 3F2UA 5C4XH 4ZN1A 1XPRA 3A0JA 3QO2A 4C92C 4PJOA 2FZCB 4RGTA 2HL5C 1YHQQ 1N9WA 2PNRC 5C4XB 5GAGC 4DV6Q 3RMQA 1C48A 2YLBA 2CS7A 2KAFA 1S5BD 5CQXA 2UXBL 5KNDA 3I70A 4GBQA 1WHHA 1ZUUA 1L0YB 1VS0A 3RLFA 3K5NA 1T3SA 1B70B 4BBSG 1N9SA 1XQHA 2UXDL 3SEMA 4DV0D 2HEQA 4J8OA 1Y8NB 4PZ6A 1K8OA 4Z88A 1KQSP 1Q86C 4ILWA 4ZQ3A 2E5KA 2LS01 1KABA 3HP7A 2DTHA 3HOUH 4M7AG 2JTFA 1Y8RB 2XMFA 1VQCA 1IBML 5GAOq 4B3SQ 2CUDA 3WXMB 1B3QA 3HOUB 1Y1WH 5A2QL 3PIP3 4OEMB 2YUPA 4M78C 1Y1WB 1X27A 4FO2A 4PMWA 2D0PA 1EYDA 4KY6A 3FKIH 2AWNA 1AWWA 3X3NA 4B3RQ 1JXOA 1IHWA 5FJ8H 2E6NA 1JMCA 4OMFB 1MSGA 3P7JA 1ZQ1A 2YRCA 1F1BB 2HIXA 2M0YA 4MMKA 1KC8U 2P0PA 1BO0A 4BY1G 1D1KA 2HHHD 2F0JA 5M3MG 2ZPGB 1ONLA 1AP0A 2JMCA 1G6ZA 2PMZE 1OPKA 4X62D 2NWMA 4RG2A 4LNQA 1C06A 3OSVA 2JNGA 1HSQA 3R93A 4XQNA 2FEIA 4DV0Q 1OTCA 1LT5D 3WWVA 1EY8A 3S1NH 4PJNA 4K2LA 1ZUYA 2J6FA 3GIBA 1I07A 4TRDA 4DUYD 2HQEA 3S1NB 1CKBA 3PVQA 4F16A 1SNDA 4L5SA 2LJ1A 2NVYH 2G3RA 1NM7A 3CPWA 1QILA 2HT1A 5CV5A 3MFGA 3VR4A 4I65A 3OYCA 2NVYB 1FMVA 2Y4YA 3I4MH 5M3FG 3D31A 1EQRA 4X9DA 1T5EA 2JK8A 1K0RA 4KN4C 2OAWA 1E2WA 1F9PA 4A3LH 1D7QA 2FB7A 4HSVA 4OX9Q 1AE3A 4NXNL 5DY9A 4GOPB 1NPRA 4PJOC 5E4XA 1IL2A 4Z02A 2WB1B 3HG9A 1TSFA 5EKIA 1WQWA 1HNZD 4NNJA 4LJZC 1V1QA 4B6MA 3KF8A 4G57A 1N33Q 2CH4A 3AHUA 5JOBA 3CMAA 2F2XA 1VQ8T 1D0XA 4FF2A 1NEBA 1GHKA 2ZJRA 4LUVA 1YJWQ 3M57A 1QP2A 4C8QB 4E7LA 2MGSA 5T1GA 3SR1A 4L5RC 2VNUD 3R3OA 4XIGS 2EFIA 5JEAH 4LDUA 5C3EB 1JC7A 2B8GA 1VQLQ 4U673 1K8AC 4BE0A 4ZTFA 2EGEA 2CT3A 1AT1B 1I4XA 1WHKA 1YJ9Q 2J6OA 4A3FG 3U23A 4YCUA 1JOKA 4BS9A 3CCUT 2XWJB 2CCZA 2ZPEB 2LXJA 3JCMf 3CQTA 4F7UE 5GJVB 3J81E 1SR3A 3ER0A 4KD4A 2NUCA 3KBGA 4JRQA 1H9KA 1PFMA 3FPPA 1HNZQ 4QQ6A 3M0QA 5GAMh 4GNXC 4CI0C 1F2ZA 3NE5B 3QUIA 2FMCA 3K58A 4C0DC 2ZPFB 4HCSA 2ZM6Q 1GCQC 4GKJL 4HVWA 4ODGA 4C3HG 2IIMA 2CYZB 1QNKA 3DWQA 3GNGA 4KUDK 1OXSC 4JZ3A 3QBYA 3R8BA 3CPWP 2OTLA 2GNCA 3DWAA 2ID0A 4RGNA 4X3SA 4M75C 5LL6S 1VQ5A 3VRYA 2L2PA 2EQKA 3OHXC 4V2SA 7AT1B 1YNXA 2C35B 3CBMA 1T5XD 5FRMA 2ROTA 3OSSC 2EVBA 5JJZA 3KFUA 3NTIA 2KCMA 3PIOA 2AWOA 2M1HA 2HCCA 2UUBQ 1BBUA 4OONA 5A0LA 3RN2A 3K7AH 4P73A 5IYDG 1UUPA 1DD2A 4OXPA 5D65A 4AFSC 8ATCB 3HP9A 2MO1A 2Q2IA 3GO5A 3K7AB 4KMUC 3SWNC 1SSFA 4A3MG 1XWEA 1N34Q 2UUCD 2NN6G 4JI6D 4JI7D 2CHBD 1EFWA 5M5XH 3M59A 1PHTA 2DXBA 3T16A 4M78E 3MWYW 5M5XB 1DZ1A 1NR2A 3JCMX 3OIPA 2BKDN 3NP8A 1IXDA 2WV6D 3AFQA 3PO3G 3SVMA 1BR9A 5L37A 3QZ5B 2K3XA 3Q6SA 1NLOC 3FJ5A 4YTLA 3N6RA 4C3IH 5I4DA 3C2PA 1I50H 2F5KA 5BR8L 1AE2A 2B2VC 3RNUA 3D0FA 1I50B 5K36G 1I4K1 4DV3Q 3OYBA 3JCMW 1PG5B 2LP5A 2OEOA 4JI8L 3F2DA 1I94Q 2GTOA 1IGUA 1ET9A 3CCMQ 3HKZE 4HMJA 2ZTBA 3EH2A 1C9OA 3FEOA 4J6YA 5FWBA 4YY3D 3H0FA 4X66D 4JI6Q 3CEYA 8AT1B 3KF6B 2ZCFB 1N32D 5DM73 2K5VA 3DLLA 4QB4A 4G7OC 3W1BA 3H3VH 1SHGA 4IFDJ 3M7GA 1HQRD 1HNXQ 2V4DA 2A8VA 3PQIA 2PVOB 1Q3LA 1U5SA 1B3AA 2K1BA 4BXXG 1HTPA 2R5MA 4PJOE 1E2VA 1F2MA 4MZPA 3OW2S 2WAQE 4Q5VA 5C4XG 1H9SB 4BY7H 4LFAD 1RLPC 2QYZA 2RJEA 5FLXE 2DTIA 4MZMA 1BQQT 2GVBA 3UA7A 3K8AA 4IPDA 4BY7B 2BDNA 3I90A 3BYTB 3MVVA 4JI2D 5HK0A 2UXBD 5C4HA 1ABQA 2KXCA 1TG0A 4QUFA 5I9OA 4YY3Q 4E7JA 5KYUB 2EYXA 2QEXA 4GKKL 4N9PA 4PMBA 1NJIC 4A4HA 1TWBA 5LMND 2RHIA 1PV4A 3HOUG 4DR3D 4A3BH 1N32Q 4V190 3VV0A 4FW2A 1U06A 1SE2A 1Y1WG 4RTXA 2MIOA 4FNFA 4A3BB 2PUKB 1ENAA 1NCVA 1C4QA 2FPDA 2PCFB 4JJBA 4LFCL 5IE8A 2FZKB 3M0RA 4GN5A 3FKIG 4DK3C 4DV7Q 1PZJD 4DAPA 2DAQA 2MPXC 3HGBA 1X6OA 2MI6A 3QXEB 1GOZA 3JB9I 5K5PA 3U9OA 1EQQA 4LFAQ 1QZGA 2VUMB 3PFSA 2I0NA 2YUOA 3L2QA 3HPWA 3PTAA 3HKSA 4M77F 3QSUA 3UATA 2QA4Q 2DJGC 1C6VX 5GAOn 2I46A 5EPKA 3K59A 1QNUA 1PWTA 5IXFA 3HRSA 1WHLA 1B7TA 1T3LA 1ZLMA 3OYJA 3EFXD 3IL8A 5C0XJ 1TXYA 3IFTA 1BK2A 2YHTA 4M75E 3RKXA 1I4GA 3LH5A 4OB1B 1OU8A 2E2DC 1STYA 5CKDA 4EVOA 2F03A 2AUJD 4K6DA 3WOEA 4XK8E 2OTJA 3D3RA 3KF6A 2OI3A 5KYIA 3I4MG 2R58A 4C5IA 1LOJA 3ULJA 1QUQA 2RCNA 3FDRA 2R61A 2WB1G 1I1JA 2Z6KA 4LF5D 3JCMe 1BUVT 3LLRA 2RJDA 4QIWB 1X32A 4X64L 2DRKA 2HDAA 5FU7C 4ZUJA 1Q7YU 5KNCA 3M55A 5LJ3d 2B2WA 3CCVA 4N4IA 1R0BG 1MSHA 3H0HA 3MP6A 2BZXA 3CCEQ 1PM3A 1ENFA 3BZKA 4C8QG 1H8KA 3QOLA 4HJ9A 4R4IA 3T51B 2QILA 4KHZA 2F0MA 2MQHA 4L63B 5C3EG 2EY5A 1WVLA 5I2MA 1XNIA 5JEAG 4HN7A 1MMNA 4B3RL 2ENMA 3KK7A 2K01A 2KY9A 3BY7A 4W5VB 1VQ7Q 1VQKT 2QQRA 1X3PA 4LF5Q 3H15A 2WFWA 3S1RH 2VASA 1R8OB 2DJZA 1KDCA 1VMCA 1O7LA 4DV0L 1G2SA 1E7OA 2M02A 1HD3A 1H9RA 3WVDB 1OX9A 2PVGB 2A0FB 5I21A 3S3NA 1LACA 4KJOA 4XTXA 2SEMA 1S5FD 5IYDH 1R9TB 1UTIA 4QKUA 3ZFJA 1JWSD 3TP6A 1RODA 4RCBA 1IREB 4KBMB 4M7AD 1L0XB 3SK5A 5C3XA 5IYBH 3PIO3 1YJNQ 5LMUQ 2ZGWA 2EVRA 5IGGA 1TUGB 4NKLA 1IBLD 4ZCKA 1OQKA 3RLOA 4OX9L 1R0CB 1YIJA 1N8RU 5GAMf 2HUGA 4N4HA 1I5OB 2J7IA 3I56A 2HHHL 2DVJA 3OMGA 4HVUA 3OWFA 4X62L 2NVXB 4CDDC 3VDYA 1BOSA 3G4SA 4FW1A 4BDYA 1N33L 2JEAI 1C0AA 2COWA 4IUVA 3CCJQ 4ID6A 4DAVA 2B2WC 2M9UA 2LCLA 1WGSA 1V1PB 4OMNA 1VQOA 3L0OA 1M1KR 1IKLA 3L2RA 1V43A 2D5DA 4F17A 2NWGA 2XSCA 3B6YA 1YNND 1WJJA 3H6ZA 4I7ZC 4A3EH 1PNJA 2LC4A 4LF7D 4DOWA 3C0CA 4OMQA 1B8AA 2WACA 4A3EB 2EJ9A 1JORA 4IKFA 3I35A 4DBQA 3MA2B 4JRPA 1OPLA 3VYGA 4ZLTF 4DQ2A 2FINB 4DUZQ 2CP0A 4C3IG 2CZ0B 2HCKA 4CRIA 1M3CA 5IXBA 1UE5A 1Z47A 2XNAC 2HCIA 4NL2A 3X28B 1HNZL 1FX7A 2F1MA 1J8IA 2A6HC 2GF7A 5LJ5h 3QB3A 1VQ5T 1NUCA 3DB3A 1QCNA 2A1AA 5CV7A 1M3AA 2E70A 1AEXA 2MMPA 2JYOA 3CRKC 3H91A 5E1FA 4IZ8A 2ZM6L 2RK1A 2RQRA 2V26A 3HHTB 3PGGA 4F7XA 1QP3A 3S2DB 1JCKB 2UXDD 2DJQA 1GUGA 2P5ZX 4ZRZA 5EBCA 1HNWL 2D0OA 3FPUB 3I4LA 1QLYA 4IPGA 2GVAA 4OO1I 5GMKi 5ELDA 3ME9A 2E76C 3AB9A 4LF9D 1G291 3CMEQ 1SRLA 5KCHA 2IHEA 4X66Q 1VQ9Q 3VS0A 2CT4A 2K5NA 5GQOA 4A76A 3ONGA 4DV1D 4DR4Q 4OB3B 3GP7A 4M7DD 2UUBL 4JRKA 1HXDA 3V05A 4BY7G 1B07A 3NFCA 1VQ6Q 4M8AA 3EAEA 3S6WA 2PQAA 2QW7A 3LW5E 1WJQA 4KY5A 5D3DA 1N34L 2EWNA 1ZYRC 2IX0A 2I5MX 1VQ4Q 1VQBA 3MXNB 3T53B 2NB0A 1VQMA 1E3PA 4IFDI 5A35A 4BACA 2XIDA 4XAXB 3HOZH 1U4MA 2EJGA 1BU1A 3K6OA 3VU3C 4OF1A 1XTDA 3WVEB 4WCIA 5EBDA 3HOZB 1RAEB 4A3BG 1U4LA 4D6WA 1KIXA 1SDFA 2DGYA 1RABB 3I2ZA 4LDXA 5CV6A 4LF9Q 3TN2A 4BI8B 3FN1A 2VUBA 4DXGA 5GANh 3DUZA 4DV1Q 4DV3L 4A53A 4IALA 1U5KA 4KULA 4S3SA 2JP1A 3EJIA 3FRPB 1JXMA 3OYDA 4TVAB 1I94L 3FJPA 1MJCA 1XPOA 4FF1A 4OWXB 2D9UA 2LXKA 3EQLC 4J6HA 5CV8A 1YNZA 4NXND 3NXWA 4II1A 1TWHH 4BY6B 5IGFA 2UUCL 5CKBA 2EDGA 2XRQD 3M54A 4JI6L 5JVH3 4HCBA 2L0AA 1JJ2P 4Q0FA 1K8GA 4M77C 1A2UA 4DNTB 4DR7Q 1ZX6A 5GJWB 1DJRD 3DB4A 1RAIB 1CZGA 3JCMV 1N36Q 4DBHA 2O9SA 2JUFA 1HNXL 1VIOA 1XMOD 3CCRQ 2FG0A 1EU3A 1Y96A 1NMGA 1SE8A 2E2JH 2PZWA 2MAMA 1VIEA 3M85A 1MJEA 2F0EA 1LNXA 3TU4K 1GUTA 5GMKl 1A3TA 1EFID 4K6LA 2NZOA 3DEPA 2PMZB 5FK9C 1B1ZA 4EQNA 4C92F 1YHQT 4HTHA 4EMKB 1IW7D 3AYHB 5JJLA 1KXLA 4YWLA 1HPCA 1STBA 1STHA 1TY2A 1PH2A 3HL8A 2DKGA 1A8VA 1W2BS 1SNMA 4EQ5A 4HJ7A 2EYOA 4DKAC 3VA5A 1SJED 4XU0A 4GLVB 1PTOD 2LQNA 4RAUC 3UDXA 4YY3L 5IP7H 2CKZB 4PG3A 5ELEA 2X3WD 1PXUA 1LTTD 1TY0A 3JRZA 2K5HA 1K83B 2AKLA 3D8GA 1X54A 3CCSQ 1N32L 4EQPA 4IIOA 2JJ9A 1WXTA 4KUIA 1HA5A 1QVFS 1HXYD 4ESRA 3C1FA 3I3CA 4XU2A 4OVAA 4JOIC 1XMOQ 1JO8A 4B3MQ 2D9TA 5KYXB 1WXBA 1M90R 3BDOA 2D2CC 4BDZA 4YWKA 4OB0B 1C05A 1CM9A 1SNPA 3IAYA 5GAMe 2QEJC 5C4ZA 3MEAA 1OXXK 2FFKB 4RKUE 1EU4A 4LFAL 2A74C 5EAYA 2ED0A 2BE5C 1KTKA 1VQ8A 4BE2A 1SYEA 2H5XA 2WKDA 4LE9A 4XTZA 1W70A 1PRMC 2FO0A 1QE6A 2B39A 2NBFA 4JI2L 3MEWA 2ZPHB 2K9GA 3MJXA 2OTJT 2DBKA 1LV9A 2ZTEA 4BY1B 1S3OA 2L3RA 2F3WA 1GD7A 3O13A 1QKXA 2KT8A 4J9IA 3MXGA 5I2XA 1IYVA 1PFSA 2ZTDA 1U4PA 4XTYA 3D7SB 1MV3A 4X34A 4EPCA 1TH7A 1G5VA 2CQAA 4C2MH 4CBVA 4F8MA 4ME7A 4LXCA 1YP5A 1EY0A 2I5HA 3P8HA 5IYBG 1NLPC 1HRJA 2B63H 3HEJA 3PV0A 5IY0A 3M0TA 5CR3A 2LQ7A 1VQIA 4FDBA 2EIFA 2LNVA 3M3YH 2KI7A 1ILPA 4EX5A 2WKCA 4HJ8A 3G6EQ 5AT1B 4AG2C 3M3YB 2RSNA 2N8NA 3TZDA 3E1SA 1GHJA 4LF4D 2JM8A 4A4KA 5BR8D 2K57A 4J6WA 3QOJA 1HUNA 3NBHB 1ESRA 1VCIA 2RQTA 4FM4B 4FSXA 1NBEB 2XVSA 5GAN5 4C56C 4EMKA 3PVLA 4DR1D 2YSQA 1KSLA 1ZSZC 2DA9A 4CC4B 2DRMA 3E9HA 1YJWT 2CSQA 3A98A 5KE2A 1GUSA 2K14A 2OX7A 2JEBI 1EIGA 3BZDB 2KHJA 1G2TA 4A3EG 1VQLT 4JK1C 4O42A 3U9SA 2EYYA 3G6JB 1KQ1A 1YJ9T 1I81A 4Y7NB 1KC8C 3PO2H 3L2WA 3KBXA 4HT9A 3OYMA 4LF5L 1YEZA 3VUBA 1UJ0A 1PRTD 3BU2A 2CZ1B 2LVMA 3DLMA 4M7AA 3W1GA 4LF6D 3L2ZA 2FRWA 5HGQA 4M7DB 3TS0A 2D6FA 1QQJA 2RHXA 2Q2HA 1D1CA 2RD1A 5GAEC 4NPSA 3EROA 4DOVA 5GAMj 4M77E 3GOXA 1UGPB 2DIGA 3GLXA 1E1OA 1FGBD 1OO9B 4A93H 3SEBA 1O80A 1M4ZA 1PDQA 1KSVA 2NVTB 1S72A 1B34A 1STGA 2RJCA 3I56T 3GTKH 1VUBA 3CXCP 5LMUL 2JXBA 4QJFA 3J81i 4DU9A 1H3FA 1QZHA 1QCOA 4DXFA 3ULRB 2R57A 1K9MR 2EY6A 3OYAA 3I91A 1FNWA 1VYTA 2K4YA 2X51A 4NXMQ 2I2LA 2YRDA 1WTOA 4LD9K 1MMGA 1YFNA 1CA5A 3CCLT 3PCOB 1WA7A 2A73B 3F2BA 1II3A 1HCZA 4LFCD 4OWTB 1U9RA 2GQIA 3S24A 1TWGH 4LF6Q 1VQHA 3EA6A 2IG0A 2NYSA 2DNCA 1N6AA 2YTYA 1MV0B 2L3QA 1TWGB 2CGHA 4DV2D 2KEAA 2G6FX 5JJIA 3PT9A 2KVQG 2TMPA 4JI1D 1FYNA 3HOZG 1Y8XB 1PYSB 1FKAD 2GFAA 1W3SA 2WAQB 5GAN2 1UE1A 2E3HA 1YZ6A 4XT3B 2EOTA 3A8HB 2C06A 4DUZL 2AKWB 2XICA 2X4JA 1XJWB 2K79A 3PMFA 4N9TA 4KGZB 3PE0A 1PH6A 5TSSA 3GF5A 4HXJA 2CQOA 2CP7A 2PQWA 4F88A 5HY6A 2RF0A 2J6KA 1QVGS 1GXDC 3CCMT 4M7AC 4H44C 4OO1H 1H3ZA 1PH8A 2HSEB 2OXPA 1ACMB 4DV6D 5I9PA 3PF4A 4DA2A 2R7ZH 1RACB 3E0EA 2CZ6B 2KE9A 3T56B 2EQUA 3M0SA 4JLGA 2TSSA 4M7DA 3PGZA 1A62A 4JI1Q 3CCQQ 1LVKA 1VQNQ 2KK4A 5GANf 3NENA 3J81L 5KYWB 5C6SA 1BBXC 2DZCA 4B3SD 2YUNA 1G8XA 4F04B 1G91A 5GAOl 5M5WH 4A3CH 4X66L 3L2VA 2IL8A 1VQMT 5M5WB 3EFOB 3A54A 4FF3A 4IFDH 3M4GA 1EEFD 4MIUA 3NBIA 3EG2A 1KRSA 2EYFA 4J9FA 5EG2A 4BD3A 4B3RD 4DR2Q 1UDLA 2ZJPA 3V8JA 4LGTA 4DV4D 1XMQQ 2RQUA 4E7SA 2M00A 4M75B 2KNBB 4WJ4A 4LFBD 5IP7G 3HFOA 1Y69U 1BI1A 3JB9J 1NE8A 1YHBA 4AQYQ 1YNJC 4J9EA 1L1OB 3MC0B 1OEBA 3NEMA 2RQXA 1UWVA 3QPHA 2MFIA 4LF9L 4A4EA 1I6VC 4WRDA 2XD0A 4RG1A 4DV1L 5KRUA 1NZ9A 5IP9H 3PSIA 5COYA 1AWJA 2CSIA 3EGXB 4C8QF 5GAN7 3X25B 2HZYA 5IYCH 4A3IH 2L3PA 2LQ8A 4B3TD 4OX9D 2A68C 4YIJA 2PW7A 4A3IB 3MHXA 5KYYA 1C1AA 3FKIB 2EQSA 2O5IC 3M4OH 2LDMA 1A3VA 2QA4T 4DV4Q 4OUDA 1KL9A 4LUOA 1ZUKA 3W5OA 4L6V5 4XTWA 1TWFH 4MTKA 1BIAA 3FVQA 4LFBQ 5CIUA 3WDNA 1N33D 4L59A 1Q82U 1TWFB 3DMUA 4PL6A 2HQXA 3CBPA 4E7IA 3NGPA 1Q8KA 2EYMA 2L5TA 2X6LA 1X2KA 4LUZA 1Y07A 3UDGA 4JJNK 2ZJQA 3A8JE 4C1NI 5E7NA 1VQKA 1SN8A 3Q1JA 1X65A 1KHCA 5C0XH 1YWOA 1ZKOA 2JA9A 3CD6Q 4L5TA 2HIVA 2M9VA 4JI3Q 2B63G 1T9HA 3GTOH 1TOVA 3M4PA 2RQVA 4V0BA 2CDTA 3AQQA 2DF6A 2KRMA 2AHOB 2KQ3A 4ZAIA 3PUVA 3GTOB 5JJKA 2LMJA 4I7AA 3PUZA 3QWXX 3I4MB 1VYUA 1IZ6A 2H8HA 1TWCH 5FKAC 4JUVA 4B3TQ 1UE9A 1PRTB 3IQLA 5ELFA 3URYA 1Q1BA 1IBKQ 3H8ZA 4ELZC 4DR5D 5DM7R 1TWCB 3VR5A 1VYVA 5IT9E 1TKWB 4JBWA 4KJNA 3CQZH 1HZBA 5GAOp 3H09A 2CW0D 4HVVA 3CQZB 1YITQ 1BI3A 4N4GA 1JWMD 1XMOL 3CC7Q 4GN3B 4B3ML 2ZM6D 3OW2A 4HR7B 4DV5Q 4OGCA 3QG1A 3F1ZA 5FLXL 4RMFA 1J9OA 3BJUA 3V2TA 1KQSS 4RTTA 5FU6B 5LJ5e 5I6YA 2O4XB 2IX1A 3MKDA 1RD9D 4XU1A 1M9SA 1SNQA 3FP9A 2YYZA 3OYFA 2RI3A 4M7DG 3SK4A 4X6AH 2OCEA 1JQYD 2UUBD 4DR5Q 4PJJA 4MN3A 1WOCA 3EGXA 1TTHB 2CP5A 2F2VA 4PV1C 2NVQH 2LNHB 3UA6A 4LAAA 1KG1A 2BUDA 2RQWA 4E6RA 2QQAA 1TT2A 1BCPD 2R3ZA 3HOVH 1IW7C 2NVQB 4Z9CB 1GFDA 1WLPB 2F0GA 1YJNT 4ORZA 1U1TA 3P1HA 3HOVB 1PZID 3QYHB 1TXQA 4A4GA 1IKMA 2E64A 4D8KA 1PTOC 5IGEA 1YCYA 1SNOA 4XTUA 4ANJA 5FLXc 1JJGA 1U3OA 4LF8Q 2PNHA 2ROLA 1H3HA 2Q8IB 4C92E 1Y8OB 4FF4A 1Q7YC 2D0NA
chains in the Genus database with same CATH topology
3M56A 1O7YA 3K5LA 2M0OA 3A8KE 3CCJT 5EKLA 2CKKA 3GTPB 3SK6A 1LT4D 3TMEA 2R93B 1S5CD 3I4NB 3RKWA 2KSSA 2A69D 3H6MA 2FHDA 5GANe 3M53A 3BG3A 3V7RA 3AMUA 1UAPA 3NTHA 1LTRD 3EFRA 3VR6A 2LY7A 3Q22A 4RCOA 3G7ZA 3MO8A 3OBYA 2A6EC 2X4XA 3MZ5A 1S72T 2KECA 4DF7A 2JTMA 3OA6A 2K28A 4MZTA 1WTPA 4C8QA 4C3IB 3R6OA 1B50A 5LJ5j 2O4XA 1GJXA 4OO1G 4DFAA 3NWSA 4C1NK 3JAME 1MHNA 5DLOA 1W6JA 5AFWA 1I5LA 3QDRB 3HFNA 3FC3A 3SDZA 1VF5C 1N8RC 3NSWA 3CU7A 1KLUD 2J0TD 5BN3A 1EWCA 3CC2T 3GQBA 4G4KA 5LJ3h 1SAPA 4ULLA 3OYIA 4IFDG 2X35A 2A3LA 2E6ZA 1HQMC 1QVPA 3CPWS 3QIIA 3OB9A 1VQ6T 1FR3A 2JE6I 4CJ0B 4M75G 4ZGJB 4QMGA 4CKCA 3OYYA 4EDUA 4ZN3A 2OT2A 4JS5A 1CZWA 1YHQA 2O5JC 1OXVA 1CQFA 3LGFA 1FXXA 3I55T 4ZK9B 1ILQA 2KCNA 1MBYA 1X01A 2GA4B 3VA7A 2LT1A 3DEOA 3A8OB 3W2DA 1CI3M 1PFBA 2D0QB 2DEQA 3HS0C 4LK1C 4C8QC 2K5WA 2F0LA 5D6YA 4B9WA 4LDWA 4RFBA 2AHJB 2E74C 3CCRT 4K5XA 2L5QA 4GZYC 3A8GB 1ZEQX 1H9JA 3A55A 1EY9A 2QKIC 5C0XG 5KNBA 4G7ZC 1U4RA 5IGCA 3BYYB 3LGLA 2AQ1B 3M58A 1WCMB 2L11A 2PW5A 5JPMC 4ZKBB 5C0MA 1Q1EA 2LCCA 2QI2A 3CCST 3NWTA 1EIFA 2OF1A 1H9SA 2XI9A 3RZOB 1M1GA 4KKSA 1M5Q1 3C4SA 1BCPB 1AZQA 4FYDA 1S4ZA 4RHSA 3L9AX 4ELYC 3BVMA 1UB4A 2RA4A 3P75A 3MP8A 3OSOA 1WTQA 2LFNA 1B9MA 1JRIA 3MXUA 1K8MA 5GAOr 4A4FA 2EYJA 2C5CA 1YJWA 1D2BA 2WIIB 2Z1CA 3O8VA 3NK9A 5C6AA 2FHTA 1WD1A 1HA6A 1ESFA 2IT1A 4QVCA 1VQLA 2K33A 2JOYA 3UPUA 3S1RB 1X3QA 5CR2A 1YJ9A 2Q8TA 1LTID 3IKJA 4E7KA 2KDSA 4X9CA 3DXJC 4J7IA 4ATOA 2ZPBB 2H3JA 3BVGA 3V8LA 5I2YA 3JB9D 2JN0A 5T1IA 3G6ET 4TVRA 4BUGA 4XQ3A 4M77B 3Q0AA 2RM4A 4Y28E 2R6GA 4PLIA 4FT4A 3D4WA 2EJMA 3OIQA 2PPBC 1QOHA 3VYTA 2PO4A 5KH6A 3H3VC 4QVZA 4IUTA 2EYPA 3PMIA 2KQWA 4A3GB 3CCLA 1SE4A 1TS4A 1RTOA 3IFDA 4K8JA 2DD5A 1EWHA 3T13A 2KEDA 1Q81U 3GP8A 2EXZA 1N27A 3X26B 2F69A 3EFSA 5KGUA 2FMMA 5J1ZA 4IUNA 2EQJA 5LJ5g 2K2VA 1EY6A 2SOBA 2EPBA 4C92D 2RI5A 4MMLA 5DEHA 1DOMA 5GAN3 4GY5A 3KUPA 3CCMA 3JCMP 2K5DA 5D6WA 4QQDA 2RDHA 4JDSA 3UWNA 3HOYB 2RBMA 2NTSA 4RGMA 1EQVA 2IWHA 1FWZA 4EMHA 3PNWC 4M78D 3OS1A 1WD0A 1VF7A 2B2YA 1B53A 1TWAB 2VYTA 3LX7A 4RA8A 2E1HA 5JVG3 1LJOA 2BIVA 5LJ3f 3TEEA 2XWBB 3JSCA 4K2KA 3BDCA 5CBAE 5M5YB 4PMCA 1DCZA 1V1PA 4L5GA 4KHVA 1SE3A 5FROA 3OS0A 4M7AF 2BCOA 4HCZA 3M9QA 3LWHA 3S15B 4C5GA 4O6JA 1RI0A 5J26A 3AU7A 4N0AA 1EZ8A 1Y8PB 1I8FA 4C0ZA 1TWHB 5E3FA 3E5SA 1A15A 3TP7A 4PJOD 4RWSC 3J7YW 2KVMA 2N88A 2FL7A 4EGVA 4XQQA 2QA4A 2VGNA 1U8RA 2E2JB 2R92B 2K6AA 5C5LA 1TS2A 3MEUA 2MUYA 2DXCA 3A8MB 2NYZD 4TQUS 3DWPA 4QUCA 3WOFA 2YLCA 1IYUA 1O9SA 5KEEA 2E75C 2Z4IA 4CKEA 2EYQA 2V8JA 4C0FA 3N52A 4BA2I 3HZXA 2K7VA 5KIXA 5GMKm 3CBOA 2EJGC 3JB9H 3MHBA 2M16A 4XTCS 3MXNA 1MGQA 2WINB 1CQVA 5C5MA 3KLRA 5IN1A 1B44D 2RHYA 1I3QB 3CCEA 5CMDA 2HDLA 4OHJA 3SD4A 4QQGA 5EGTA 1H9MA 4M75D 1ET6A 1JOOA 4N0AC 1KHIA 4PNOA 1RDPD 4H0LC 4M7DF 4LMQD 5LL6X 4KTAA 1JR0D 3LYIA 1VQ7A 1G3TA 1AW7A 2DVEA 1M1KU 4RH6A 1BXTA 3ZEHA 1JJ2S 1QVGA 4C2MB 4M77G 1V8QA 3LWEA 1RKNA 2XKOC 5BN5A 4F7UB 4OIKA 3SHLA 3TZUA 5DAUA 2LX9A 2B63B 4C3JB 2F0OA 4P2CB 5GAN6 2Z8LA 4JLIA 1I4HA 3MAQA 1YJNA 3MTSA 2XU8A 1B9NA 2EY1A 2FJ2A 3S17B 4FXGC 1D3BB 2O01E 3CC7T 2D62A 2EYHA 4MDXA 1PSFA 2F3VA 3UDCA 3TBIB 5CKEA 4PQXA 1KDBA 3JCMg 4C92B 3PUYA 4DAYA 1OXUA 2NLUA 1F9SA 4NW2A 3CKIB 4IQZA 3CCJA 1UGSB 1RF2D 3F70A 2WSEE 4NS5A 5G3LD 3L42A 5I2SA 3PO2B 1RL2A 4GLKA 2IPKD 4OGQC 1Q82C 2Q8RE 4J6XA 3J80E 2F5TX 1BIBA 1WTWA 4M78B 4PLLA 1S5DD 4TKOB 2F0FA 2NTTA 5LJ3e 4A93B 1P92A 3S3MA 2R5AA 3ITPA 3GTGB 5CK9A 1PTOF 2ZPIB 2G9DA 5IGDA 2K04A 3BVZA 1DOKA 4J1MA 3GTKB 4BY6C 3K5MA 1O78A 1LO5D 3S3OA 2DN8A 2EKOA 3HKZB 2RSOA 2KOLA 3FIFA 2L1BA 2HAXA 4H13C 3MEHA 3INZA 1HK9A 1N9RA 4F7UA 4DNRB 4OIJA 5C4JB 3G7LA 4B9XA 3CMEA 1VQ9A 3CC2A 4J83A 4EMKC 3E6ZX 1GXIE 2DXTA 5GAN4 3MCAB 3EVQA 3NBHA 1VQ6A 4PJOB 5ELBA 3CPFA 1D3BA 2KA7A 5IT9L 3BS1A 3LNNA 1I4RA 1VQ4A 1CT1D 1HFNA 3E19A 4K5WA 1G3WA 1KD1U 5GMKh 5IODA 2PQEA 3SFMA 1DXMA 2MWOA 3P8BB 2V8KA 5L8RE 3I55A 1LTSD 3HRTA 1BDOA 1Q90A 3TP8A 2WSFE 4CKBA 2VXFA 2R7ZB 5CV4A 5CCAA 5EJWA 5D14A 3GNFB 3LH0A 2K03A 4KI0A 5LJ3j 3GPLA 3CXCS 1CHPD 2ZXPA 3JCMd 1JB0E 4C0DB 1SJHD 1M90U 1R4QB 3TSSA 1ML0D 1WTVA 2QDYB 5IAYA 2BDOA 2IW3A 3GV3A 5CGKA 3QJ6A 1Q12A 1AZPA 3CCRA 2F0WA 5EPJA 1YNNC 3E0JA 1MI2A 4KT0E 2L12A 1U1SA 2Z4HA 1STAA 2WP8J 2A7YA 1SSOA 1PRTF 3META 4HAEA 5GAOm 2BA0A 1SNCA 2F0NA 2RB6A 3OPOA 5CORA 4J5YA 5CC4A 1XOVA 2BA1A 3RIRA 3V7SA 3JB9G 1DJ7B 1EYCA 2E5QA 2K32A 3DM1A 1A3UA 1Y7XA 3HSBA 2ZZDA 5KCOA 3SWNB 3CCSA 2PUOB 3VR2A 3Q23A 1MD2D 3W3AA 3VKIA 3D4RA 2XRSD 3H94A 2P4TA 3M4OB 3A7LA 4QF4A 3RMSA 2F0QA 2JSOA 2HDMA 4NDXA 1SXTA 2FVUA 1EOTA 2F0VA 1H641 1G3YA 4M7DC 3SK8A 4MDWA 3JAML 2B2TA 1BI0A 4F7UG 4OB2B 1D5ZC 2L9HA 4C3JG 2V8IA 1XX8A 3RD4A 1WTXA 5I6WA 1Y1VB 2XK0A 3ND8A 1Z6HA 5IIFA 2XDDA 2XN9C 3OWEB 4L8JA 2LTOA 2M2LA 1BNZA 2HBPA 3OOCA 4KKTA 3G6EA 3CCET 4BI3A 1HFGA 3TREA 4C92G 5CBEE 4ZGEB 1DYQA 2A6HD 2P0KA 4LD6A 4M75A 1ICWA 5GAN8 2HNIA 1G8ZD 5DNFA 3NQTA 2L55A 1LTBD 4M1UB 2JA7B 1PYWD 1K9MU 3S1QB 5ELCA 3DKMA 1VQ7T 2MP1A 3Q24A 4M7AE 2PYKA 3M4YA 2QQSA 3I8ZA 2DIQA 3QWNA 3MEVA 1I4PA 3DHQA 4BB7A 4JRIA 2WSCE 4M78G 3SWNA 1EZ6A 1M8AA 2VB3X 5FRNA 5GAMg 4KD3A 1X75C 1BYMA 2IX3A 1STNA 4ME5A 1NSNS 4H7BA 2B2TC 1SYFA 1ZYRD 2B8FA 3QKJA 4ZGDB 2H1EA 4K14A 2VB2X 2B2VA 1UGRB 1I6HB 2EY2A 2QF7A 3OW7A 2DNEA 3RESA 3MXPA 3FEWX 3C1EA 2LRQA 3G71T 1JICA 2VXWA 1PMRA 4DGZA 3JCMQ 1Y71A 1LTAD 3S2HB 1CA6A 2F0DA 2N55A 5A0GA 3OYHA 2QCPX 3T9NA 2SEBD 4PJOG 1CTMA 1DM0B 3VUZA 3K0YA 4IN3A 3OYLA 2F0KA 3ERQA 2XIWA 2QQBA 5FU7B 1YI2T 2XDBA 4BBRB 4M77D 2JA5B 3QZ9B 2Y4XA 1I4QA 1K73U 2DK3A 1QWYA 2AQ3B 1WJRA 2QTXA 3VYHB 1MGSA 4IUQA 1HTLD 3NQIA 4HMIA 1O7ZA 1QG7A 5A2QE 5KE3A 5HURA 4M7DE 3QJYA 2JVVA 4WF2A 2ZXRA 1SMYD 4WFN3 4DK0A 1Q86U 3CMET 1VQ9T 4ABNA 3BDLA 5LJ3g 4R8IA 1B2TA 2DXUA 3CCQA 3L7ZC 1VQNA 4X3UA 3MP1A 5KYLA 3SE0A 4HCCA 2L89A 2XDPA 1EL0A 1VQ4T 4RCCA 3OQ5A 1QB5D 2E41A 3C95A 5J3BA 3K5OA 2QQ9A 3N5BB 3VYRA 2BE5D 2I07B 1PRTC 1Q81C 1PFNA 1JOQA 3KLSX 3GV6A 5GAMd 4FT2A 3R2IA 1BCPF 4RCNA 4J7FA 3KXTA 5GANj 5AYFA 2EZVA 2GQVA 1GUOA 1XYIA 3CC4T 1GUWA 4BI4A 5FU6C 4QCLA 3OY9A 3E9FA 2K3YA 4OGEA 1JB3A 5DM63 2CVRA 2IJ0A 1VDZA 5J22A 2RA2A 3L1AA 2RK2A 3OMCA 2EE1A 3TCJA 1VQPT 3CMMA 3A7AB 2RDFA 2JA6B 3QYGB 4PKCC 3H0GB 2PU9B 5CYUA 1K8AU 1AHJB 1LTGD 2VXEA 3CD6A 3LX0A 1ZXTA 1FYCA 4KN7C 1F2YA 3J7AV 4XXEA 2G9HD 1PZKD 3D6CA 4RKBA 4C5EA 3ZBDA 2K05A 5CO7A 3BDUA 1KAAA 2L4NA 3FLGA 3M5AA 1YITA 1WJSA 4HKEA 1JE4A 4CJ2C 3CC7A 2EQMA 4FXKC 3CRLC 4BWGB 3A8IE 4LDVA 2H4OA 3CHBD 2ICIA 2VC8A 1EY4A 4HCEA 3V8KA 1ZBXA 4FP5D 5BN4A 2RHUA 4RG8A 2F0PA 1OZ2A 5NUCA 2J7ZA 5JEAJ 2L8DA 4XDXA 3GTLB 5FO9B 1VMPA 3VJPA 3HP3A 4FIBA 5JPNC 5A0DA 2KMTA 3VYUA 4EMGA 2F0TA 2ICEC 2EYLA 1OI1A 2RDGA 3BFMA 3FMCA 3SXHA 2JA8B 5LHY1 2K5QA 4EQOA 5FOBB 4FXDA 1TU2B 4II2A 1V1OA 1G3SA 1EYAA 2KCCA 3NUCA 1BF4A 4DA4A 1F9RA 4HA8A 3QIAA 3HOWB 5GMKe 1D6EC 2YRVA 1KNEA 3CMAT 3VYSA 1W2BA 1R4PB 4VUBA 3OS2A 2K5FA 4C8QE 2C9OA 5DLQE 4DK1A 1JWUD 1Z7TA 2XG8D 1LT3D 4IUPA 1QVFA 1DONA 2Y0SB 1F2LA 1M1KC 4KY7A 2QXFA 1SEBD 1CK1A 4A3KB 5J39A 1KLGD 2X4WA 3QO3A 3A56A 2RH2A 4UDUC 3KLSA 4LDYA 1TS5A 4AYBB 2RKSA 4O5VA 1NJIU 2LKVA 3A5ZB 2CW0C 2NN6I 1YNJD 4ZYSA 3S9WA 4X3KA 2MHVA 1UGQB 1TIID 2OTLT 3HRUA 2VV5A 1Y96B 5C44B 1XXGA 1CHQD 5D3IB 4DU9A 4M77A 1KABA 3PMTA 5EQ0A 3ASKA 4IURA 2E10A 1JJ2A 1EEID 3A8LB 1SYBA 3ZYYX 3V7CA 2FYKA 1IHZA 2A68D 1TR5A 2DO3A 4FVMA 1STEA 1F9QA 4CGYB 2PVDB 3UT1A 1LLRD 2E2HB 2NZ1D 1DOLA 4E6IA 2L0CA 5GANg 4KV6A 1BCPC 5HGTA 1WTRA 3JB9F 5GMKj 4XT1B 4HEDA 3OYKA 1LT6D 4A3DB 1OZ3A 5CAIA 3PUWA 3P20A 4L6TB 3HRZC 1ENCA 3V96A 3D6WA 3JCMc 3PUXA 1RHPA 4Y91A 4XQJA 4RHRA 2B8AA 3CCQT 4A54A 1VQNT 2QDBA 4JS4A 5CV9A 1UNSA 1BKBA 1Q8IA 4KKUA 3RUZA 3J80L 4QW2A 2RJFA 2PZTA 2LQKA 5F2DA 4BA1I 3RUXA 5FO8B 4A3JB 1D5XC 2K5IA 1FNUA 2A69C 5FO7B 2F0UA 1EIHA 3JCMJ 2IVWA 2GFUA 1YBYA 4F7UF 4P5NA 1A2TA 2ENBA 3GD7A 1WNLA 2HD0A 4R55A 2KEEA 4PNYA 1D5MC 3S1MB 3QHSA 4UAIA 2B2YC 2F0HA 2KHSA 3C94A 2E65A 1M8VA 5LJ5d 5KNLA 4C0GA 2X6GA 4K8IA 3R2TA 2RI2A 1ZHIA 2B2UA 3E9GA 1KD1C 4MHEA 2QEXT 1SFOB 2EJFA 3L3OC 3I73A 2K5LA 1SMYC 2KJXA 5IOCA 5C0XI 2OAUA 1PSEA 4WJWA 4X3TA 1VIFA 5HK3A 4IUUA 2GCXA 1E0BA 2F0SA 3GTMB 4BBSB 5ISRA 4ZTJA 3P8DA 1KNAA 1UEBA 2MF2A 4M78F 3FB9A 4J8QA 4M7AB 1M90C 4II3A 3CD6T 2ZT9C 4XTVA 4WORA 1KDAA 1M1FA 2A5HA 2DY7A 4FU6A 3RERA 1TS3A 4HT8A 1EQTA 1B34B 3VR3A 1O75A 1EY7A 3PIPA 1S5ED 4RGOS 3MFYA 2F4IA 2A6ED 5M3MB 5GANd 3C3LA 2DZ9A 4UC4A 3TP5A 1YITT 1HHVA 1XTCD 3M7NA 4FL6A 4RMOA 3CXCA 4HSPA 4O1NA 2DY8A 2DD4A 1OXTA 3CCUA 1AN8A 3CCVT 3C12A 2F0IA 3G71A 1AFPA 4NMZA 1FNVA 2B2UC 2X69A 5EPLA 3NPPA 2SNMA 3S16B 4PJOF 5C3WA 4DN4M 5M3FB 4OP0A 3LWUA 2EJFC 2JZ2A 2RVLA 5E4WC 1QW1A 1V29B 3LWIA 1CFMA 3ONAB 2VGMA 1LABA 3I72A 5CVIA 4CHTB 1GUNA 4C5HA 1YI2A 3X24B 2MJ8A 4U68A 3K57A 4R9WA 1WQ7A 2JXMB 1TVXA 5CKFA 2DTOA 3JCMh 4NL3A 5D6XA 2Y90A 3KUFA 3T4AC 3X20B 2XHCA 4OL7A 1M4VA 2KUMA 4Q5WA 1QJOA 2LMCB 5CQYA 1KQ2A 2DPPB 1UEAB 4RKLA 3C46A 3D4DA 4A3FB 2RHZA 2SDFA 3SB2A 1JBMA 4ZKCB 4E47A 1RTNA 3OBWA 1YIJT 2X4YA 1D1IA 3RZDB 4CJ1B 4F87A 3TDQA 2E12A 3OYGA 2LT4A 2E2IB 4C8QD 2AUKA 3G4ST 1K9MC 4M75F 4C3HB 3URGA 3NTKA 4R56A 1B4OA 5LJ5f 4QVDA 1VQOT 3RMHA 1NPPA 1W6KA 3JCMb 5CKHA 1SYCA 4K5VA 1OYXA 3L2UA 4C92A 1FD7D 1TQOA 2MWPA 4NP5A 3FRNA 1E2ZA 1RJTA 5M9OA 4XYQA 1C8CA 2EAYA 5JAVA 1SYDA 1PLFA 2AQ2B 2NN6H 1KQSA 4A3MB 3GTQB 1WPYA 4XU3A 4ZUIA 3OS5A 3HOXB 5HKCA 1A6XA 2MPMA 1SBBB 4TSSA 1SYGA 4M78A 3CC4A 2PZUA 2P0QA 3PO3B 2O2LD 1W4SA 3OYNA 1NAPA 2SNSA 2J4XA 4BE1A 5K36H 1QCBD 5IGBA 5EKKA 3UI2A 1BI2A 1IL8A 2BOSA 1PTOH 1EY5A 4R8NA 3OYEA 1VQPA 1PTOB 4XYOA 5G3LF 2CZ7B 1F77A 3BW1A 3J7AF 4E7HA 4NOYA 2YU9B 3S14B 4B08A 3GTJB 1K73C 3FDTA 3NHHA 3ND9A 1NR4A 3X3MA 1RCVD 2RO0A 3RKYA 1HUMA 4G7HC 3F2UA 4ZN1A 3QO2A 4C92C 4PJOA 4RGTA 2PNRC 5C4XB 3RMQA 1C48A 2YLBA 2CS7A 2KAFA 1S5BD 5CQXA 5KNDA 3I70A 1L0YB 3RLFA 3K5NA 1N9SA 1XQHA 4J8OA 1Y8NB 1K8OA 1Q86C 4ILWA 4ZQ3A 2LS01 2DTHA 4M7AG 2JTFA 5GAOq 3WXMB 3HOUB 5A2QL 3PIP3 4M78C 1Y1WB 4FO2A 4PMWA 1EYDA 4KY6A 2AWNA 3X3NA 2E6NA 4OMFB 1MSGA 3P7JA 1ZQ1A 4MMKA 1KC8U 2P0PA 1BO0A 1D1KA 2F0JA 1AP0A 2ZPGB 1ONLA 1G6ZA 4RG2A 3OSVA 2JNGA 3R93A 4XQNA 1LT5D 1EY8A 4K2LA 3GIBA 4TRDA 2HQEA 3S1NB 1SNDA 2G3RA 3CPWA 1QILA 5CV5A 3MFGA 3VR4A 4I65A 3OYCA 2NVYB 2Y4YA 3D31A 4X9DA 1T5EA 4KN4C 1F9PA 1E2WA 2FB7A 4HSVA 5DY9A 1NPRA 4PJOC 5E4XA 4Z02A 2WB1B 3HG9A 5EKIA 1WQWA 4NNJA 4LJZC 4G57A 3KF8A 3AHUA 5JOBA 3CMAA 1VQ8T 4FF2A 1GHKA 3M57A 1QP2A 4C8QB 4E7LA 2MGSA 5T1GA 3SR1A 2VNUD 3R3OA 4XIGS 2EFIA 5J