5FLXE

Mammalian 40s hcv-ires complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
257
structure length
257
Chain Sequence
ARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
molecule keywords 18S RRNA
total genus 36
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00467 KOW KOW motif
E PF00900 Ribosomal_S4e Ribosomal family S4e
E PF08071 RS4NT RS4NT (NUC023) domain
E PF16121 40S_S4_C 40S ribosomal protein S4 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5flxE03
2.40.50.740 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5flxE02
3.10.290.40 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A 5flxE01
1YITT 1VQKT 3KBGA 3I55A 1VQLA 3CD6T 3CCLT 3J81E 1YJNA 1NJIC 1YJ9T 4QQDA 2MWPA 1M1GA 4CRIA 2IG0A 1M90C 4RG2A 3CCEA 1KC8C 4ZN1A 5IT9E 1VQ8T 2KDSA 3LGLA 1VQ6T 1X6OA 3TREA 1VQMT 3G71T 3CXCA 2LQ8A 5DM7R 3OW2S 1Q81U 3CXCS 1VQKA 3CPWS 1VQMA 3OW2A 3CD6A 3CMAT 1NPPA 5A2QE 1KD1U 1JJ2A 3CCJT 1YJNT 3DB4A 1Q81C 1JJ2S 3HKSA 1VQ9T 3CMEA 3G6ET 1N8RU 3CCJA 3CPFA 5LL6S 1VQOT 2CKKA 1YHQT 1YJWA 2E6ZA 3LGFA 3PIOA 3CMET 1M1KC 2L3RA 3A5ZB 3I56A 2G3RA 2QEXA 1N8RC 2JNGA 1S72T 3G71A 3CC7T 2EIFA 3CC2T 1W2BS 3CCUT 1M1KU 2QEXT 1W2BA 2JOYA 4TVRA 3CMAA 1QVFA 1YITA 1Q82C 1KC8U 5FLXE 1K8AU 1IZ6A 4X34A 5J26A 1QVFS 3J80E 1KQSS 1VQLT 1QVGA 1K73U 3G6EA 1KQSA 1VQ7T 1YHQA 1Q86C 1XTDA 1Q82U 1KHIA 1K8AC 3JAME 3CC4T 3G4ST 2OTJA 2LCLA 5HY6A 1VQ5A 1Q86U 3OYYA 1VQ6A 3CC7A 1Q7YU 1VQPA 3CC4A 1EIFA 2JVVA 3CCUA 3CCRT 3PIPA 3P8BB 3CCSA 3CCVT 4YTLA 1VQPT 1Q7YC 3CCST 1VQ4A 3CCQT 1VQNA 1VQ7A 1VQ8A 1UEBA 2OTJT 3G4SA 3CPWA 2MI6A 1SSFA 1VQOA 1RL2A 2DO3A 1YI2A 5DLQE 1M90U 5IAYA 2MWOA 3CCVA 1S72A 1K73C 3CCRA 2QA4T 5J3BA 3CCMA 1VQ9A 2KVQG 3I55T 4ZN3A 3CCQA 3DLLA 1NPRA 2QA4A 1VQ4T 1VQNT 2LVMA 1YBYA 1YJ9A 2OTLA 2XHCA 1YJWT 1K9MU 2JUFA 1XNIA 3I56T 1KD1C 1BKBA 3J7AF 2OTLT 3CCET 1YI2T 2E70A 1YIJT 3CC2A 3LH0A 3ER0A 1K9MC 1NZ9A 1VQ5T 3DB3A 1NJIU 1QVGS 3CCLA 1YIJA 3CCMT
chains in the Genus database with same CATH superfamily
1S1NA 2DL3A 2KHSA 2ROTA 3KBGA 3AFPA 2YXYA 3OYEA 4JK1C 4XT3B 3OYHA 3K0XA 1STBA 5IT9c 1BR9A 4X62L 4LF6L 4JI0D 5CO7A 5KNLA 2B2TA 1AE3A 4F7UF 3VRZA 3AQQA 5COYA 1VQ4Q 2WP8J 5D3DA 4KHPL 3QPHA 4XAXB 4LFCQ 3ZEHA 2PZ1A 2A6HD 1H3ZA 4PK4A 2UXBL 1ZXTA 4NXML 1B4OA 2A7YA 2L11A 1L2FA 4LDWA 1MMGA 4E7LA 1CHQD 1STEA 2JJ9A 4ANJA 4C8QA 1Q8IA 2O5IC 4LUDA 2EKHA 1WD0A 3PFSA 5ISRA 3HOZG 1VQMA 4X64Q 3RUZA 3LYIA 2K9GA 3H94A 2CP3A 4JI3L 1GUGA 5BN5A 1II3A 3RZDH 1BI2A 1CI3M 3QUIA 1UHCA 5GAMg 3HP3A 3X20B 3JCMP 5ELCA 1GD7A 5LL6S 4A3GH 4M78F 4QQBX 1BCPB 4XIGS 1SLJA 3A55A 3Q23A 1CM9A 1E7OA 3H0IA 2AT1B 3SFMA 3P75A 2A28A 4CKBA 3SR1A 2YYZA 3EG9A 4OMMA 2QA4Q 3CBOA 2YTYA 1TWCB 3MVVA 2VUMB 2HKQB 3OQ5A 4ATOA 4HVWA 2M9VA 3TQYA 4KULA 2DY7A 2MO1A 4BDYA 1JOKA 5JVH3 5J26A 5LJ3d 1GKHA 2D0OA 3J80E 2F52A 3SK8A 1SYFA 1JT8A 1UEAB 1CQFA 3G6EA 3EG2A 3VDYA 2KCNA 4M7DC 4DR2L 2HDMA 4POFA 1TTHB 1TR5A 2P4TA 1K1ZA 1XMOQ 5JJLA 2F0JA 1B50A 3FVQA 4J83A 4J9EA 1A3TA 3TN2A 1QVGP 3AEVA 3I7FA 1I3QH 1KSKA 1HNXD 5IY0A 3I3CA 2UU9D 1RAEB 3V7RA 2F0QA 2R92B 1KIXA 1EU3A 2NUCA 4R8NA 4DK0A 4OWWB 4ZUJA 1L0WA 4K0KL 1XOVA 3KFUA 5KCOA 1Z9FA 3S1NH 3CBPA 2HHHQ 4PJLA 2KK4A 4R0KA 2TMPA 4ID6A 3HHTB 2PPBC 1QP3A 3KBXA 5IGGA 2CQAA 1XMQQ 5D6XA 3JB9I 3U4ZA 4JBMA 1XNQL 1SFOB 3KF6A 2CP2A 1WOCA 2Q2UA 2JA5B 3HRSA 1JJGA 3RNUA 3HOWH 1VUBA 1C6VX 2CYZB 1EY7A 2H5XA 1EYCA 4JI6Q 2NVYH 3EFRA 5E4WC 2VQED 2J06A 2K5LA 3CCRA 1K73C 1B3QA 2GQVA 4IPGA 3M53A 3IKJA 2R7ZG 2KHIA 5EGTA 2ES2A 1RDPD 3L2QA 1NUCA 2K5WA 1TWCH 2ENMA 1LVKA 2KSSA 2LZ6B 3IFTA 3JCMf 2CUDA 1JWUD 1T5EA 1TVXA 4ZQ3A 4DV4L 3CD6Q 4RCNA 1IHZA 1MMNA 2EKOA 5M9OA 1X55A 1PV4A 2Q8IB 4RWSC 1KD1R 4NP5A 3E3XA 2UUCL 4HCSA 4PZ7A 4LDYA 3ER0A 3MJXA 4EVOA 3HPWA 3VA7A 2L3PA 4OWXB 1SF9A 4FYWB 1KDCA 4KTAA 2Q2TA 3SHWA 4N9PA 2FRWA 3META 3VRYA 3CC7Q 4M75A 4UC4A 2ZXPA 2BE9B 1FNWA 3ICEA 3MKDA 3TZDA 1I3QB 2E10A 3JCMe 2O4XB 4H0LC 1VQNQ 4ZLTF 5CCAA 2V1QA 4C0FA 4PJOA 4J8QA 4HJAA 2KR3A 1N5ZA 3GTMB 1YNJD 1P9KA 2ZTCA 2VGNA 4FIBA 2DVJA 4GOPA 3X3NA 1BB9A 2EQJA 3Q1JA 1OPLA 3V7SA 4BACA 2XWJB 5CV7A 5ELFA 4OX9D 1D1KA 3FPUB 4FNFA 2WB1G 1LTBD 1E0BA 2D9UA 4AFZC 1DOMA 1KD1U 2M0YA 1JJ2A 1A8VA 2CVRA 1ZKOA 2COWA 2BZ8A 2D1XA 2YUQA 1PWTA 3KOJA 3A0JA 4YWMA 4B6MA 2DMOA 3RD4A 1HR0Q 4C5IA 2AZSA 1ENCA 5JEAH 5FJ8H 1XNRD 2RCNA 4HJ8A 2E6ZA 3LGFA 1NLOC 4JJBA 4OVAA 3CMET 1IW7D 3Q8DA 1MHNA 1N33L 4N0AA 1PHJA 3FKIB 2ENBA 4PNYA 4IZ8A 1UB4A 3G71A 2GVBA 2HDLA 2K03A 4I7AA 3FC3A 3OBYA 2ABLA 1NTGA 1Y1WB 1G91A 5C44G 3JB9G 2EQMA 3GTPH 1F9PA 4DU9A 2Z6KA 3REAB 3I5RA 1RLPC 3BJUA 1B7YB 5AFWA 4XYQA 2ICIA 2DGYA 2RHQB 1PRLC 2L3SA 2WACA 3HOXH 2HCCA 1HNWQ 3I35A 2F2XA 3CEYA 4K8IA 1N9RA 1QZGA 4F04B 1NMGA 3BE3A 4JV5L 2DAQA 4GOPB 5I11A 3X25B 1J5EL 2HL3A 2HT1A 4F7UE 2WKDA 3CCUQ 1ZUUA 1TWHH 4JLGA 5GAOr 1STYA 1SNCA 5GAOl 3NBIA 5CV8A 5FWCA 1SNDA 1Q86U 1A3VA 1Y8PB 2C0TA 4G4KA 1BIBA 3C4SA 2ID0A 2CSQA 4KUDK 1K0SA 2JVVA 2VXWA 4E7ZA 1N32Q 3CCSA 1BU1A 1YN8A 2K3YA 4M4ZA 1GXIE 2VB3X 2F0TA 4FDBA 2C0OA 5DAUA 4JYAD 1SR3A 2R57A 3GTOB 4Y7NH 3OMCA 3S2DH 2KCTA 2L55A 3I4MG 1IBKL 5FRMA 1HNZD 2HKNA 2PQEA 4KGZB 4AT1B 1QVFP 1DD2A 4JI5D 1JB0E 2YUOA 1AFPA 3FB9A 5A0DA 4DA2A 5D7UA 1GCQA 1KNEA 2KJXA 4POGA 5LJ5f 2YTXA 4Z9CB 4H13C 4EX5A 3R2TA 4EDUA 1M90U 1X9NA 2BE7D 3GIBA 3CCVA 2KRSA 3E19A 1WJSA 4JS5A 1KDBA 3A54A 1CA6A 3Q22A 4X66D 3FKIH 1LLRD 2UXCD 1N34Q 1QWEA 2EGEA 2Z6KC 1R9TH 1G3TA 1K3BC 2CP5A 2L0AA 2DJGC 1SG5A 1C06A 1DXMA 4PJOE 2MQHA 4N9TA 1JBMA 1T3LA 3HEJA 1XMOD 4OXPA 1VS0A 1Y1VB 4OO1G 1ZUKA 1MBYA 3CCMQ 4LDUA 2FG0A 1K73R 1EY5A 2PNHA 2VB2X 2ZT9C 1SSOA 4FXGC 2UUBD 4A54A 2ISTA 3BVMA 1C1AA 1QKXA 1NZ9A 3OYCA 1YI2Q 1UG1A 1A0IA 1UGPB 1JE4A 3K7AB 1WXTA 1HYOA 1H95A 3HSBA 3BG3A 1C05A 1PDQA 2YHTA 1YITT 3OWEB 3S1RB 1H9KA 2J7ZA 3QJYA 2F0MA 4WORA 2WAQE 4ME3A 4M77A 1U4MA 3W3AA 2MWPA 2A08A 1HZCA 1X54A 2XIDA 1CK1A 3A5UA 2YLBA 1GJXA 2K6AA 2HCKA 1Y71A 4BI3A 2L2PA 4ZN1A 3LGLA 2ZXOA 5CAIA 3M4YA 4ME5A 2YU9B 2VQEQ 4JI6D 4KN7C 3HOYG 2NUZA 1HFGA 3T13A 2FL7A 1I1JA 5FU7B 1VQMT 2KA7A 3AYHB 2FZKB 4N4IA 1OZ2A 5CV9A 4AFQC 2EXDA 4XTUA 1VQLQ 4KKTA 4JYAL 3JCMJ 4MNOA 4ESRA 1TQOA 2HHHD 4X64D 1PTOH 4X3UA 3DB4A 4JDSA 4JI4Q 4E7IA 3PMTA 4M7AC 2M1HA 1E22A 1TU0B 1TWGB 4DUYL 1I4K1 2BA0A 2JYOA 2EE1A 1TXQA 5GAMj 2N55A 5GMKi 2ICEC 4A3FH 1S72T 3QOJA 4KGXB 4YWLA 1KDAA 4BD3A 5C0XG 4J9DA 3G4SQ 3Q6SA 5M3MG 3H0GB 5LMUQ 1FMWA 3QO2A 4GN3B 4BBRH 2JN0A 1B34A 3PE0A 4M78D 2HAXA 1PXUA 1QVCA 4E47A 1NAPA 1S5BD 4KKUA 4Y28E 4ZKBB 5C3XA 1IBMQ 3S2DB 2QQAA 3JCMg 1G291 4DV6L 1NJIR 2KRMA 1KQSS 1EEID 2K32A 4Z88A 3E9FA 1R0CB 4M78C 3S14B 4CC3A 1VDZA 3PQIA 2FYKA 3UWNA 2Z1CA 3S14H 2P0PA 1HNWL 3OTOQ 1GHKA 2KBNA 1KHIA 2ZPBB 2RSNA 4C8QB 3K8AA 5D3IB 2K3BA 1Y14B 4WF2A 4FO2A 2RB6A 3P1HA 1VQ8Q 1LTRD 5HK3A 5CBAE 4WTOB 1TWBA 1WYDA 5I2MA 3HRUA 2WAQB 1EIFA 3I55Q 1CSPA 1EFWA 2VWFA 1A63A 4F8MA 4C3IB 1L1OA 3MEVA 3MXGA 4AQYL 4M75G 4JG2A 3GPLA 2E12A 3CC4Q 3CC2Q 1M9SA 1TOVA 1YEZA 1Y1VH 3VR3A 1XMQL 2K5QA 1ZUYA 2XKOC 3KJOA 4H7BA 4A3EH 5GAGC 4HMJA 1WFWA 2MI6A 1G2TA 4LF9Q 1HTLD 1RL2A 4J8OA 2SNSA 3MFGA 4DN4M 3I56Q 3OYJA 1OI1A 4E7JA 3QR8A 2B63G 2WB1E 1N36D 4PMCA 4XTZA 4X9DA 2RDHA 1FNUA 1I4PA 3WXMB 1GL5A 1X01A 2RH2A 3E6ZX 4XXEA 3V05A 1PVOA 1HH2P 2KENA 3OW7A 4IJLA 4LF5Q 2LX7A 5IT9L 1RACB 1I50H 4GS3A 4IKFA 5IYCG 2R7ZH 4DV7L 1QLYA 2OTLA 4DFAA 1TWAB 2XHCA 3LWUA 5M5WB 3S1MH 4A93H 4A3BB 4BY7B 1QG7A 4XTVA 1X56A 1LNXA 3QYGB 3I56T 1EYDA 2V4DA 3IFDA 5IP7G 3RZOB 1WIEA 3KLSX 1A15A 1QNKA 2IWHA 1WQWA 1W6KA 3FDRA 4JLIA 2XIWA 5LMNQ 2BIVA 1O7ZA 1TKWB 1UGSB 3JCMc 2JA8H 1FKAD 4EQPA 1IBLL 2F0IA 4A3IH 2CT3A 3CCMT 1IYVA 2DFUA 1JO8A 3X28B 3G48A 2HIXA 1LT3D 2O31A 2E5LQ 1AWXA 2I5HA 2Q8TA 3CCLT 4LUEA 1CKOA 3TP8A 3OS2A 4B3SL 4JS4A 1TWGH 7AT1B 3MXNA 1WHJA 1M1GA 2EY1A 3CMMA 1OXTA 2F0VA 3UE0A 4JVZA 4DBFA 5L23A 1W6XA 1KAWA 2E3IA 1L0XB 3GTGH 4U673 2KDSA 4B3RQ 1UAPA 1XTCD 3KLWA 4X66L 1FWZA 3TREA 1I81A 2V1CC 3KDFB 2ZCFB 1EIGA 4LW1A 1TS4A 4MZMA 4ELZC 2HUGA 3NELA 1UTIA 4DK6C 4A3DH 5C6AA 3VS7A 2DN8A 2DX1A 3EAEA 4KH1B 3K0YA 3U4VA 3S1RH 3A8OB 1D1CA 4RTZA 4DAVA 4NXMD 3CMEA 4JBKA 2OXPA 2PNRC 4JI2L 4JI8L 3WVDB 4NB3A 4PJOF 2DNCA 1GVPA 3JB9F 4HCKA 3LLRA 4C92B 2L3RA 2EYLA 3A5ZB 4LWCA 1PH4A 2E2IH 2Y4XA 1WJRA 1WJJA 4OP0A 3PCOB 3QJ6A 4RTTA 2GN5A 2B29A 2QYZA 5LJ3f 2JA7B 4GY5A 4XDXA 4A3LH 3D4DA 2P84A 1BCPC 5GANh 2OX7A 2QASA 3VA5A 3Q0AA 1ASZA 3P8HA 3EGUA 4DEXA 1PFMA 2RI5A 3GV3A 1EOTA 5CBEE 4JV5Q 1SYEA 4X34A 1MV3A 1CKBA 4JV5D 2CS7A 2B2UA 4N0AC 2K5NA 2QQSA 2DRMA 2QXFA 1Q82U 2JS0A 4ORZA 5LJ5j 2FINB 1LTGD 1AD5A 3BY7A 4GLXA 1WVLA 2JTEA 2RNAA 1YCYA 3SWNA 5EPKA 2RHXA 2VC8A 1C48A 1U4PA 4DR6L 3QZ9B 3S3MA 3J7YW 3RN5A 2PU9B 1QMCA 2OI3A 4QVCA 1PD0A 3OYMA 1Q90A 3LX0A 1Q7YR 5LMND 3EGDA 1K83H 3PSIA 3NHNA 2ESWA 2B2UC 2K5HA 3I70A 3ULLA 1PYSB 1CKNA 1WTWA 5FW9A 1X69A 1D5ZC 1PD1A 5KYNA 4A3DG 1SHFA 4WFN3 5GAOm 1EL0A 5GANe 2DLPA 2H1EA 1H3HA 1R4PB 4LFBQ 1X65A 1M8VA 1U5KA 3F70A 2F0SA 1LTTD 3V8KA 5JJZA 1V76A 3PF4A 2KY9A 5IGBA 5FROA 1VQGA 2MUYA 4LF8D 2YUNA 2ZPIB 3VR5A 2EVBA 3ZL7C 5T1GA 5KYUB 1H92A 1STHA 5FLXL 4BXXH 4NXND 4NPSA 1AWJA 2YWWA 4OB1B 2E4HA 4ZGEB 4OIKA 1N34L 3H09A 2IVWA 3T1YQ 4DV2Q 3EHRA 3OYDA 1LM0A 3JCMQ 3W1GA 4OO1I 1UGQB 2KVQG 3J80c 1IBKD 3RN2A 1E6GA 2VV5A 4M75B 4P72A 2K57A 2UUAD 4BBRG 4PJJA 4M77D 3VJPA 3SHLA 2XVSA 1EY9A 4KD3A 2FPEA 3RR6A 5KYWB 5M5YB 2X35A 4M7DF 2F0EA 5CYUA 1VQAA 2R93H 3QWYA 4UP8A 4QCLA 4A4FA 1VQ9Q 2E8GA 2E70A 2NWMA 3GOXA 1A2TA 3S17H 4A93G 1RAFB 3OBWA 4PKCC 1HZBA 2NVTB 4A3DB 3K7AH 5IYCH 5AJ3L 1JMCA 3DB3A 4DNIA 1NBWA 3VUZA 1YIJA 2RQRA 4C1NK 3TSZA 1GXDC 1R0BG 2AMCB 2QK0A 2RA2A 2UXCL 1SRMA 4PL6A 4GKKD 4NXNQ 1YFNA 3KUFA 3SK6A 4CDEC 3GF5A 2F2WA 2C06A 1J6QA 1I50B 1AN8A 4DV0Q 1M1FA 1IKMA 3F2CA 4RMOA 2QQ9A 5C5MA 2F4VQ 1VQEA 3RIRA 3KYHC 4HSPA 1TY2A 2A73B 4KBMB 2X6LA 3GNFB 5GAOp 2B8FA 2JA8B 1UHFA 4R4TA 2AUJD 2NVXH 2DJQA 3PO2H 2OT2A 1QP2A 2VKNA 3A98A 4KJNA 4O5VA 4K5XA 4QIWB 1RIPA 1KRSA 2ATCB 1Y07A 1YVCA 2EY5A 1VQOT 2CKKA 2A69C 2R92G 5KGUA 2ZM6D 3U58A 1M1KC 1KK7A 4RG8A 2F0UA 3GTGB 1CTMA 3TP5A 4LK1C 3LWIA 4LFAL 1PTOD 1PTOF 4RKLA 2QAZA 1WHKA 5CKFA 1AWWA 2R93B 4QUFA 1H9SA 5HURA 4MTNA 3GTLH 4DV6Q 1W2BA 1RF2D 4J9BA 2YTVA 2A37A 3AHUA 4B3TD 1IZ6A 2QDYB 2BE5D 2CREA 3K5LA 1GFCA 3DXJC 1M27C 1NYGA 2DL7A 4KY6A 3E0JA 3L2WA 1JB7A 4RGMA 3CC4T 1VQIA 5LMUD 4BA1I 5GANf 4NXMQ 4A3CH 1C9OA 3BS1A 2VUBA 2IX0A 5FKAC 2HMAA 4GOPC 5KNCA 1SN8A 2V26A 3UF4A 3M4GA 4M78A 3RBBB 2I46A 1HUNA 3CCLQ 3TVTA 4GN5A 1UE5A 4X64L 4XQ3A 2E3HA 1B1ZA 2R7ZB 3S6WA 2KNBB 1Z6HA 4DBHA 1XJVA 2C0IA 3G1JA 2P0QA 2Y0SB 5I2XA 2COZA 5BR8D 3GTQB 4AH6A 5FOBB 1N34D 2NN6I 2RJDA 2R5MA 5CK9A 2H8HA 4M75D 4J6HA 1TUDA 5GJVB 2N88A 1UECA 2FZCB 2K7AA 1CKAA 3C95A 1BK2A 4YIJA 2OAWA 3MEHA 2PI2E 5IXBA 2K52A 1ET6A 3CMEQ 5BR8Q 1K83B 5M3FG 1NPRA 1VQ4T 3TEHB 3T1HD 3SK4A 1VQFA 2DTOA 4X65Q 4BY7H 1ZBXA 3HP9A 1S5ED 5EAYA 1AHJB 1KD1C 2UUBL 4LF7L 4R4IA 4C92G 3PUZA 4PG3A 5IE8A 3J7AF 2GF7A 3J80L 1N32D 1YI2T 2SOBA 1WHGA 1RAIB 2GCXA 4LNPA 2BH8A 2RM4A 4LN2A 4C2MH 5FO9B 1XMOL 1HR0W 2DD4A 5GAN2 1STNA 2D5DA 1NJIU 1PSFA 3L2VA 3CCLA 2LQKA 4NL3A 2AK5A 2EJFA 4EGVA 5GANd 4HR7B 3FP9A 4KK7A 3JV3A 1CT1D 1WTHA 5M3FH 2CQOA 4XTYA 1YJNA 3D8GA 4II1A 3DWPA 4JBJA 3P8DA 2VNUD 2RQVA 1ML0D 2EFIA 5KYYA 4JPBW 1ZHIA 2EYQA 3OSSC 4K8JA 2K33A 3QYHB 2LJ1A 4RKUE 2EQKA 5FRNA 1G5VA 5LJ3j 1I4XA 3CP0A 1GCQC 2LSSA 4JI7Q 3J81L 4A3EB 3L2RA 5GQOA 3GTLB 3CXCA 2X51A 3VYGA 2F2VA 2HEQA 3KUPA 3LNNA 4JI2D 1EFNA 3CPWS 2OJ2A 4B3MQ 5C0XI 5KIXA 3STBC 2RK1A 1RTNA 4DA4A 1JJ2S 1G2SA 1SRLA 5DLOA 3M59A 3CCJA 3GBQA 1I4RA 4WCIA 4YHHQ 3JCMd 2E2IB 1BOSA 3A8KE 5J22A 3I56A 4HIOA 1IXRA 2CT4A 4DQ2A 2FHTA 2LXJA 4DR2D 1D1AA 1PCXA 3RZOH 4FT4A 2ZJRA 1NR4A 1I94Q 3CCUT 2JE6I 1BBXC 1NR2A 3J80i 2Z0SA 5KYYB 5CR2A 1SE4A 3M0TA 1SE8A 5CV6A 1RCVD 2J0TD 2DA9A 2JANA 5FLXE 4PJNA 3JB9H 4J6YA 1PZJD 4A3IB 1K8OA 3NTHA 3VS2A 1Q46A 5C4ZA 4DV6D 1MGSA 3R3OA 2X9HA 1OOTA 4J9HA 3GV6A 6AT1B 4DGZA 4DK1A 1YHBA 1WD1A 3EQLC 1WTXA 3NE5B 1PC0A 3EG3A 2LT1A 2K5IA 3NGPA 2MO0A 3VR6A 4Y52H 5JJIA 4RTXA 2EOTA 3I4NG 1M2VB 4KGVB 1DOLA 1ZYRC 2E2HH 4DV7D 1NEBA 3TP6A 5IGCA 1MKHA 3K80C 1ZX6A 3E9GA 4X65D 4LDXA 2B2TC 4A76A 1BCOA 4MDWA 2K4KA 1TS2A 3C1EA 1K76A 1EY4A 3BDUA 4G57A 2VW9A 2DL4A 3PUVA 1LUZA 3S1QB 4RGTA 3S1QH 1EZZB 4X9CA 1ENFA 2OCEA 3G4SA 4RKBA 4LF4L 4W5VB 1MNEA 3R93A 1UE7A 1H641 1SEBD 3CRLC 1HQMC 3FEWX 1PH8A 1D3BB 2EGAA 4QT7A 3K5OA 2RPNA 3OWFA 3CQTA 1DM0B 5GADC 4LF8Q 1G3YA 4L6V5 4L59A 1ESFA 1YNZA 4BY6B 3MXPA 3UDGA 4RHSA 2O4XA 4RUGA 5A0GA 2LFNA 1K9MU 5GAN4 5FQ2B 4HIKA 4K2LA 3RLOA 4JOIA 1AWOA 2JA9A 5C4HA 1J5EQ 3HOUG 4R56A 2F3IA 1HNXQ 3C2PA 1PYWD 1YIJT 5IYDG 1EX4A 3T1HQ 4V190 3LH0A 2QGGA 4NDXA 3K58A 4A3FG 2B2VC 3OYLA 3MHBA 4DXGA 1I4QA 2BA1A 4CDFC 2EXZA 1KJWA 3PO3G 3CQZH 2UXDQ 4QUCA 2CUBA 2UXCQ 3PUXA 3CQZB 2UUAL 1FVIA 3TQ7P 2KAFA 2NN6G 4HT8A 4RA8A 2EJGA 3UE1A 4HKEA 2CZ1B 2F0DA 2NVUB 4PMBA 4DR2Q 4M7DE 3QXEB 1FMKA 1GCPA 1BCMA 2MFIA 5KNDA 5C3EH 2QGQA 5J39A 3CHBD 2PVOB 3PMIA 1FR3A 1GUOA 4ULLA 2C35B 4AFSC 1NE8A 2OEOA 1E6HA 2R92H 1NYFA 1ESRA 2A8VA 2UU9Q 2LQNA 1LJOA 4JCVE 2E64A 5CV4A 1R8OB 5CQYA 3AFQA 2BZXA 3R6OA 3EJIA 2KCMA 4DPGA 5GMKj 1F2ZA 4K0KQ 3ME9A 5A2QE 3J81c 4PMWA 2MK5A 4OHJA 1YJNT 4A3JB 2EYMA 3RZDB 5IWAD 2XGTA 2VL6A 4OIJA 2HHHL 3L3OC 1BVSA 4XU0A 1K3RA 1W1FA 4K6DA 1HCZA 4L6TB 4GNXB 2KVMA 2Z4HA 2N8NA 3HOZB 3GTKB 2AHOB 3VS6A 4LF4Q 1XNQQ 4A3MB 4QMGA 1M3BA 4HCZA 5ELEA 4A75A 3OY9A 4LDVA 4V2SA 2NTSA 2DIQA 1SJHD 1MV0B 5FLMG 1YJ9Q 3R6NA 3MXNB 1HPCA 4LMQD 2QW7A 3HG9A 2DNUA 2DXCA 2BZYA 2L89A 4EIKA 1W2BP 1KTKA 1VF5C 4CHTB 4DR1D 5LL6X 1WZOA 2VASA 1Z9QA 2RF4A 3VYSA 3VR2A 4F7UB 2MNAA 4FXDA 1KHCA 1EWCA 1MI2A 4DV0D 1Y8QB 2R58A 1Y7XA 2JP1A 1ZSZA 3CCJQ 1B2TA 4NS5A 3QO3A 4F16A 4APVA 2IW3A 1LT4D 2DETA 3HRTA 3K5MA 4IPCA 4GKKQ 3LH5A 1SMYC 2FMMA 2RN8A 4DV4D 3C46A 3CCSQ 3PTAA 4IFDH 3RUXA 2I0QA 2R93G 3QG1A 4DOWA 4ZTFA 4BY7G 1E2WA 3VR4A 1ZA2B 2DPPB 1DCZA 3CCUA 4XQJA 4EMGA 1S4ZA 1ZEQX 1P92A 1CUKA 1R9TB 1B53A 3AMUA 5NUCA 1D7QA 2R5AA 1SNQA 3KK7A 4L5TA 2B86A 4JI1L 1XPUA 4BY1H 5CGKA 4JRPA 1I6HB 3JAML 2GTJA 2SDFA 4OGEA 4KLKA 4FF1A 1I6HH 2LDMA 5FO8B 3QWXX 1VQBA 3GTJH 4UAIA 3GTQH 2MHVA 3SB2A 1HD3A 4MZTA 2KXDA 2LJ3A 1B9MA 4DUYQ 2OTLQ 2UXBD 3FJPA 3T1YD 8ATCB 1PA6A 3G71Q 3KJPA 4FYVB 2PW7A 2FPDA 3GO5A 3A74A 4C56C 1V8QA 3V8JA 1KABA 2MWOA 4JZ4A 4EMKB 1G51A 4B3SD 1TT2A 2QA4T 1A6XA 1BNZA 2RK2A 1OTCA 3D4RA 3S16H 4YCUA 2QTXA 5KRUA 3I2ZA 1ARKA 2DK3A 2O88A 3NPFA 4B08A 3KFVA 3IRBA 1B8AA 5BN3A 2YRVA 1YJ9A 4M78E 1OXUA 1RJTA 2L0CA 3A8JE 4RAUC 4RTWA 4AYBE 5GMKh 1I4HA 2BTTA 4PZ6A 5D6WA 1G2BA 3E0EA 2JEAI 2GQIA 4GLKA 3EROA 3CC2A 5C3EG 1NNXA 2F5KA 4CKEA 3S2HH 5E3FA 5GROA 3QBYA 2BOSA 3MFYA 4HEDA 4QL5A 5TSSA 5IGEA 1KNAA 4HT9A 5D14A 4IOCA 1AOJA 1VQJA 2X6GA 5JEAG 3I55A 1Q95G 4C92C 5M3FB 1FL0A 5KYUA 4A4GA 2E75C 1F9RA 4BE1A 5KE3A 5DEHA 2DE0X 2FO0A 4PNOA 3ND9A 1JXMA 4F7UG 2XDDA 4LAAA 4RG2A 2J6KA 3QDRB 4RHRA 2RDFA 1AZEA 4DNTB 1IGUA 1SYDA 3HL8A 1SEMA 1HJPA 4A3FB 4R4QA 3I5SA 3HFOA 3PUWA 4DR1Q 2RQXA 1OQKA 4PLIA 3SWNC 4PQXA 3R8BA 3OW2S 3FJ5A 4MN3A 4DR3D 1I5LA 3HP7A 3CD6A 1O80A 2L3QA 1ZYRD 2DL8A 2NTTA 4DR3Q 2K2MA 4HMIA 3M4OB 2M0OA 2W10A 5KYXA 1JR0D 4LF5L 2K4YA 4DBQA 2EYZA 2A68C 2WKCA 4QF4A 1ACMB 4RH6A 4ME7A 4F87A 3G6ET 4BDZA 2O01E 1E7ZA 3ZBDA 3HGBA 2I07B 4A63B 1B9NA 3CAMA 4K0KD 1V29B 1Q8KA 1SMYD 3BDCA 1M3CA 4DR5Q 2A0FB 3MEFA 4ZAIA 2LCSA 4XU1A 1D0ZA 2DEUA 3CC7T 3GNGA 2R7FA 1BYMA 1OU8A 2L12A 3BYYB 2H4OA 3M55A 5LMNL 1AP0A 2WV6D 2GA4B 3RR5A 2D0QB 2A1AA 1LT6D 3I9QA 1YNXA 2A6HC 3TDQA 2M2LA 3OTOD 3M7GA 4DV3D 2RQWA 1BCPF 1KFZA 1WTVA 1F9QA 5EKKA 5L37A 2EGCA 4K2KA 2PYKA 1RI0A 2JXBA 2FJ2A 4IFDI 1RUWA 1XTDA 2ZPGB 1EU4A 5M3MH 2E5LD 1C0MA 4V0BA 1G83A 2EYXA 5CIUA 3H8ZA 2XI9A 3I73A 1C7YA 2HBPA 4CJ1B 1PFBA 1OPKA 4KY7A 1FX7A 2C5CA 2K04A 2B39A 2IJ0A 1EWHA 4OMOA 4CI0C 4C3HB 2EZVA 1S40A 1RHPA 3LWEA 2B2VA 2M02A 1HUMA 3N6RA 4PFPA 1S5FD 2PQAB 3EN2A 1TSFA 2VY3A 3ULJA 3L2ZA 4DV2D 4AFUC 4R55A 3CCST 2J7IA 2HL5C 1DJRD 3RESA 1TWAH 2ZPFB 1RTOA 4H44C 3PMFA 4L5GA 2JTFA 4OB3B 3M0PA 5GAMf 2VVKA 2QTVA 4NOYA 1PFNA 3WDNA 1SSFA 3VV0A 3HZXA 1W3SA 3VS3A 4R4OA 1N6AA 3I4MB 2PVDB 2FPFA 3G6JB 4ZNXA 1YHAA 5KEEA 3MPUB 1VQ9A 3MCAB 1D0XA 4GLMA 1GUNA 1SBBB 3E9IA 4HN7A 3J81i 3CCVQ 1M2OA 1YCSB 4JJDA 2AWOA 3E1SA 5ELNA 4JW0A 1UUEA 4JI5Q 2ZAEA 1ZSGA 2ZTEA 3OIPA 4FM4B 2JSOA 4WRDA 3D7SB 2Q2IA 4JI0L 3DH3A 3ERQA 2XG8D 2EQSA 1XNIA 2KE9A 2EVRA 4D6WA 1PZID 2Z6BA 5IP9H 1VIFA 3H9NA 4DR7D 1BO0A 3KDFA 2DJFC 4P2CB 1M8MA 2UUAQ 5LMUL 1YNNC 4TRDA 1IYUA 2H3EB 3EH1A 2KEDA 5K36H 2J4XA 1QWFA 2JA6H 3KLRA 5IYBH 3NQTA 4CC4B 2XMFA 3FMCA 3H0HA 3WVEB 4KH0B 4BBSG 3OS0A 4LUOA 1DONA 3WOFA 2JA6G 4JJCA 2XK0A 4M77E 4LFBL 4C0ZA 2UXBQ 1BQQT 4DUYD 4L5SA 1XPOA 2IY5B 3HOUB 1TS3A 3ONGA 1DM9A 4KHPQ 1SDFA 4M8AA 4GBQA 1I94D 1X6OA 2Y4YA 3PT9A 4IFDJ 2ZTDA 1WGSA 3RMQA 3G71T 2RSOA 2LQ8A 2XTIA 3ASKA 3JCMb 1YJNQ 1HNZL 1T0HA 1A0NB 4UY8C 1KXLA 2FRYA 2VS1A 3OB9A 1FNVA 4DV2L 3I4MH 1AEXA 4NKLA 5ELDA 1KIKA 1A62A 1SFOH 4DBRA 2BKDN 2MYSA 4YWKA 4JI3Q 1T3SA 4AYBG 4JI1D 2RHYA 4Y92A 2E5KA 1PH2A 3HOWB 4DXFA 3DUZA 2RHIA 1M30A 4FCYA 3KF8B 3OPOA 3M9BA 2VQFL 2M51A 3A8LB 2XDBA 5I2YA 1G6PA 2EPDA 2DL5A 3SEBA 3T53B 1NLPC 1WNLA 3TEEA 2EYHA 3NBHB 4BBSB 3OYBA 4A3KB 3F2UA 2PNIA 1J9OA 3EGDB 3E2UA 1W2BS 1P8LA 5EJWA 4JI7D 1IRXA 1WQ7A 2V1RA 2LJ0A 5LHY1 3P7JA 4HVUA 5JPNC 1HK9A 3K7UC 2SEBD 3ZFJA 1IBMD 2PUOB 3P20A 2EQUA 1PG5B 1BI3A 1IB8A 4BUGA 3JAME 3REBB 2VB6A 1OXVA 4OGQC 2ED1A 2R6GA 1V1OA 4KHVA 3PV0A 4KKSA 3CC7A 5JPMC 5IWAQ 1IBLQ 1O7YA 4FXKC 3HOUH 5IHKA 3V2TA 2CSIA 2K3XA 2EJGC 2LP5A 1PRTC 1IXDA 2GTOA 2L8DA 1OZ3A 4B3SQ 1N36Q 4II2A 3HTRA 4K11A 1JWMD 2NZOA 2B63H 4WJ4A 2PZUA 4HJ9A 4AMCA 2B63B 2MAMA 1ABOA 2LMCB 4VUBA 2D2CC 3NBHA 2IPKD 2OTJT 3CRKC 1K8AR 4X66Q 2NUTB 1CFMA 2NVTH 3PVLA 5EC7A 3R2IA 4DAYA 1UE9A 1X3GA 2OWOA 2F0FA 2I5LX 4LFAQ 1EQVA 2NVYB 1TUGB 1IL2A 2P0KA 4QY7A 2DJZA 4AIMA 3CCRQ 2F0WA 4HSVA 1CKNB 2RQUA 1H9MA 5EPJA 4C8QF 3F8TA 3RLFA 3C3LA 5FU7C 3W5OA 1UFFA 2VUMH 3QIAA 3J7A5 1T9HA 4A3BH 4E7KA 2KYBA 1PH6A 1FYNA 2DD5A 3SDZA 4CBVA 2F0OA 4LUVA 2OTLT 4DV4Q 4JC0A 4KI0A 1PLFA 1OV3A 2W0ZA 4H02A 2CGHA 4IUVA 4M7AB 2F0PA 3L7ZC 3NENA 1VQ5T 2RD1A 1V9PA 1X75C 2P5ZX 1VQ9T 2VXEA 4JRQA 4KD4A 1CHPD 3S24A 3A1PA 2RCFA 4CGYB 4FYDA 3ULPA 2E1HA 3HKZG 4ODGA 4UHVA 2RF0A 1SE3A 2NN6H 4LF9D 2LMJA 2IG0A 5C44H 3OYFA 2RHZA 4Z89A 4X3KA 3CCEA 1S5CD 3DLMA 3I4OA 4DR1L 3S15H 4DV5D 5CMDA 1RAAB 4LGTA 3S15B 3G6EQ 2K01A 2RQTA 5A2QL 3OA6A 5FJ8G 5HCKA 3A7LA 4JI4D 1G3WA 2XWBB 4DR3L 4IUNA 4OB0B 4MIUA 4XT1B 5CC4A 2JA5H 3J7AV 4B3MD 2O2OA 2ZM6Q 1NPPA 1D2BA 1KC8R 3FDTA 1YIJQ 5C4JH 2JA6B 3HKSA 2D0PA 4FYYB 3E5SA 3ND8A 4IUTA 3VS4A 1L1OC 2JS2A 1XWEA 3A8IE 3RKXA 1VIOA 1N33Q 3JB9D 1RD9D 1TG0A 3UDXA 4ZKCB 1HR0L 1YHQT 2PI2A 2YUPA 2KT1A 1QUQA 4OELB 2ZTBA 1L1OB 4L5QA 4P75A 1O7IA 4A4EA 3JRZA 1AEYA 1VQOQ 3CPWP 4D8KA 2WSEE 3GTPB 1M1KU 2QEXT 1YP5A 2NWGA 3QIIA 2JOYA 2NYSA 4TVRA 1RABB 3S2HB 3O5ZA 3SEMA 4M7AD 5I4DA 3J7ZC 2A19A 1K8AU 2CP7A 5A35A 1X6GA 4EPCA 1RADB 4MDXA 1Q81R 1LABA 4KY5A 4PZ8A 3EA6A 5M3MB 1WTPA 4JRIA 1WFQA 2CDTA 4LUZA 3I4NH 5JJKA 4F17A 4HTHA 1M5Q1 1K4US 1Y0MA 4MMLA 1STAA 3X26B 1VMPA 4DK3C 1CZWA 3M0UA 1PH1A 1JWSD 2Q8RE 4N8X1 4JI7L 5C5LA 4F7XA 1FGBD 1B34B 3OYKA 1ENAA 1SNOA 4P73A 1D09B 4BBSH 1M4ZA 4J6WA 4YTLA 1PZKD 4OX9Q 2F03A 3JC66 2CZ6B 2DTIA 4OMFB 4B3ML 4K14A 2O9SA 2PZWA 3EG1A 1XYIA 4KRTA 1DZ1A 1QUQB 2I5MX 4XU3A 1FGUA 1YZ6A 4ILWA 3M54A 1UEBA 2QKIC 5C4JB 4O1NA 1IBKQ 1DOKA 2E5QA 2GFAA 1CSKA 1I6VC 2F4VL 4J5YA 5I21A 5ELOA 1YI2A 3A56A 2KOLA 3RERA 3HS0C 5KNBA 5IXFA 3SGIA 5DM73 4BS9A 1BCPD 4TSSA 2FXQA 5J3BA 3CCMA 4JI5L 1VOMA 1AZPA 3S3OA 2ASBA 1HZAA 5I9OA 1AE2A 3H3VI 4ZN3A 1EQTA 3RKWA 1M8AA 3UA7A 1SPKA 3HRZC 2DKGA 3EFOB 3M3YH 4C92D 4RTUA 2RDGA 1YBYA 2AKLA 2DBMA 3TCJA 3MZ5A 1YJWT 1SHGA 3K57A 1QCFA 3S1NB 5C4XG 2JJQA 5M5YH 3HFNA 1YNND 3GP8A 1WJQA 4A4HA 3RLNA 1XQHA 1V1PB 1U9RA 5I2SA 4QIWE 4BBRB 1AH9A 3M56A 1K28A 5LJ3g 3F2BA 1JCKB 2B8AA 2LT4A 3KLSA 4O2DA 1E1OA 3JCMX 1C4QA 3L0OA 1VYUA 2CFMA 1XJWB 3TU4K 2PW5A 1KQ2A 5J1ZA 2WSFE 2V8KA 3J81E 4A3IG 1NJIC 4B3TL 1YJ9T 2F0HA 4C3JH 2PUKB 1ZSZC 4E7SA 3PO3H 3BVGA 2DZCA 1JC7A 4UP9A 2YRDA 2YRCA 5IP7H 3HOWG 4ZYSA 3EFXD 2DIGA 2PTKA 2F1MA 1EIHA 1GO3E 4Q5VA 4YHHD 4LFAD 3LGJA 2DXBA 4FT2A 4C92A 2VQEL 3V7CA 3A8MB 2EPBA 2Y0SE 2E2JB 3CMAQ 1Q81U 1VQKA 2E2JH 3UPUA 4OMLA 2RI2A 3UA6A 4EQOA 3EG0A 4FU6A 2KBTA 4IUPA 1R4QB 3HKZB 4LF8L 3PO2B 4C92F 3SWNB 1XX8A 4FF3A 4M77F 1MSHA 1OO9B 5GANg 2X69A 2VQFQ 4A4IA 5C44B 4RCCA 1MGQA 5IN1A 1JE5A 4KHPD 3VU3C 2Z0WA 2M00A 1WLPB 3GTMH 4DUZQ 4A3EG 1I07A 1CSQA 2A74C 1TS9A 1OXXK 2LCCA 1VYVA 2AKWB 2A6EC 1D0YA 2LQWA 2XD0A 1I0CA 4XK8E 1M2VA 1WTOA 2X3WD 2B2YA 4M77B 2ZXRA 3VS5A 4GKJL 1Q82R 1P16A 3OYNA 4J7FA 2F0GA 5JAVA 3NXWA 1KC8U 1V43A 2B2WA 1VQ7Q 5CR3A 4X62Q 4LF6Q 4P5NA 2R7DA 1K73U 1VQ7T 2RHUA 5GAN7 2P4RA 2ZPHB 2K5VA 3RMHA 2K7VA 2XRQD 4DR7Q 3STBD 2X3XD 5C3WA 2JW4A 2M16A 4DR4L 5GMKl 1X43A 1ZLMA 5HY6A 1VQ6Q 1D8LA 2JN4A 4J15A 1HR0D 3OYYA 2K05A 2LC4A 1QNUA 4P71A 3CC4A 2AZVA 1N9WA 2IHEA 1Y69U 3JB9J 2UU9L 4YCWA 4G7HC 1JICA 1SJED 1U0LA 1N36L 4U68A 4C3JG 4IUUA 2MPMA 1VQPT 2CKZB 4XQNA 4E6RA 3L9AX 1T5XD 1WXUA 2F0LA 5GAMd 9ATCB 3CCQT 2X4XA 1N8RR 1VQNA 1GHJA 3TS2A 2F69A 3URGA 2CZ0B 1MJCA 2K50A 4AQYQ 4PJMA 1VQ8A 1ILPA 4LF5D 1DYQA 1LOJA 3DM1A 2K1BA 3H0FA 4K5VA 2C9OA 3OOCA 3FIFA 1TWHB 4LJZC 1QCBD 2KT8A 4JBWA 4LFBD 1E2ZA 1LV9A 1MMAA 2KEAA 4PFOA 1I5FA 3L2UA 5E1FA 2X4WA 1F1BB 5FLXc 2HQLA 1QJOA 3OIQA 1OX8A 5IH2A 2NLUA 2L4NA 4EMHA 2F5TX 2LVMA 2N78A 3D6CA 3URYA 1X2QA 1WCMB 4DV1L 1EQRA 2O5JC 3N52A 4N4HA 2LX9A 2PCFB 1IREB 5M5WH 1HNWD 3NPPA 4A3MG 3BYTB 1BKBA 2HQEA 2CP0A 1TS5A 3HKZE 2AQ1B 4IURA 2LRQA 2EQIA 1UJYA 1D5XC 1SYGA 1FJGQ 1U1TA 1K9MC 1Q1BA 2RO0A 4GZYC 3I91A 1SYCA 1K8GA 2E5LL 2D9TA 2NUPA 3DMUA 3NQIA 2RJCA 2YV5A 4UPAA 2ZJPA 3T9NA 3C12A 3EFOA 2EDGA 4F88A 1VQLA 3DKMA 5CKBA 3VS0A 3GDEA 4GN4B 3CW2C 1QZHA 2DYBA 4QQDA 3L1AA 2RVLA 2L5TA 5E7NA 1TXYA 1Y96B 2FZGB 3PVQA 1V1PA 1E1TA 3M3YB 3GQBA 4IFDG 2DUDA 1MJEA 2IHFA 1VQ6T 4IIMA 4AG1C 5A0LA 4E6IA 5GMKe 3UI2A 2WAQG 3EG9B 4MZ9A 4HXJA 1SXTA 4JI8D 1W6JA 3OW2A 2A6ED 4L8JA 1W70A 2L9HA 4XU2A 4OONA 2PMZE 3M4QA 2B8GA 2JEBI 3T56B 3QHSA 1WPYA 2FEIA 1UJ0A 1M1KR 1K9AA 2HDAA 2M9UA 1BDOA 3A8HB 2Q2HA 4CJ2C 4C3JB 5C6SA 3PUYA 2YLCA 2HIVA 5FLMH 1ABQA 3M9QA 1S72Q 4JI8Q 2QEXA 2UUCQ 1JJCB 4DAMA 4A93B 2XNAC 1Y1WH 3K6OA 4QW2A 2G6FX 3NP8A 3UDFA 4DKAC 1LPLA 1J8IA 1PRTF 2O9VA 2NB0A 3H91A 3SK5A 2IIMA 4XTCS 4RCOA 1BBUA 1D3BA 2WFWA 2DERA 2EJMA 1Y1WG 3GTJB 4X3SA 1O75A 3JCMW 2AUKA 4N4GA 2K5DA 2GVAA 5HKCA 3MTSA 2KGTA 4DAYB 1EY8A 1QWYA 1TWFB 3T1HL 4A3GB 1TWFH 1HA6A 3U23A 2K28A 1Y8NB 4EMKA 3M4PA 5LJ5g 1QB5D 1X3EA 3DHQA 4WJWA 5I22A 1FJGD 2LS01 4Z8AA 3P8BB 1BBZA 4QKUA 1YHQQ 1WCMH 1PH5A 2GBQA 2J05A 2MMPA 3GTOH 4G7ZC 4IN3A 3OYGA 1VQ4A 1YWPA 3BVZA 3MWYW 3CU7A 1YITQ 1VCIA 2DNEA 3VUBA 4A3LG 4BI4A 3S3NA 5FU6C 3JCMV 1NSNS 3L42A 3PIO3 5C4XB 3TP7A 1SNPA 5GAN3 1JOOA 2FMCA 3X3MA 4DR5L 2E65A 5GAHC 4DEYA 4XQQA 3T1YL 3QKJA 2EW3A 1SNMA 2RMOA 2K6DA 4QQ6A 3CCQQ 2Y0SG 3FRPB 4TKOB 4A3BG 4IPDA 4LXCA 4RGNA 4C8QC 2VUMG 1Y1VG 2BDOA 5LJ3h 4PLLA 2PO4A 4BE0A 4JJNK 1X32A 2IX3A 4DV5L 1B70B 1XPRA 1VQCA 3EVQA 1VQNT 1PH9A 5KCHA 1JQQA 4DR4D 4Z02A 4A4KA 1RI9A 2AIRB 4IPHA 5K5PA 1JJ2P 4D8DA 2QQRA 1WTQA 3QWNA 2JUFA 3N5BB 2K5FA 2DY8A 2NZ1D 2WSCE 1G3SA 1QILA 2KYMA 1JORA 3SXHA 5C0MA 2IPOB 3OW2P 5EKIA 1STGA 4DR6D 1PHTA 4RTYA 1B3AA 3EFSA 2MCNA 4R4CA 2MIOA 2YT6A 4OEMB 1PRMC 5IGDA 1LTAD 1LCKA 1SE2A 1N32L 4AG2C 3U50C 5AJ3Q 3MEWA 2PVGB 1HXYD 2SNMA 5IIFA 3CD6T 1JH3A 3V96A 4HCCA 1S3OA 4LD9K 5GMKm 3T16A 1HRJA 2DF6A 4BA2I 3PO3B 2RI3A 1KG1A 1X6BA 5FK9C 4NXNL 3D31A 3C0CA 4C1NI 1WDXA 1KQSP 1PM3A 2CHBD 4C5GA 3CXCP 1TY0A 3OS1A 1M90R 3TBIB 1A2UA 1QOHA 1UE6A 1SYBA 5DM63 4A3JG 4IOAA 4OGCA 2PZTA 4KN4C 3MXUA 1GUSA 4DUZD 4YY3Q 3SVMA 3S9WA 3NHHA 1UUPA 1XXGA 3OSOA 2NVXB 1EEFD 2NBFA 1Y8XB 2LY7A 2VGMA 2AQ2B 4LD6A 1K9MR 4JOIC 3HOVB 3BZDB 2JA7G 4HAEA 4EQ5A 4DUZL 1MIUA 4B3RD 3ULRB 4CC7A 1YJWA 4NW2A 1W4SA 3PIOA 1A3UA 1PRTB 5CKDA 3NUCA 4QJFA 2BCOA 1BI0A 2G3RA 4ZRZA 2DXUA 1EUJA 1Q86R 1M4VA 4ZTJA 4JI6L 4J9FA 4ELYC 1M3AA 2EIFA 3H0GH 1AZGB 1PFSA 4PJOB 4BI8B 2RJFA 2DTHA 5CVIA 2MJ8A 3BU2A 1HQRD 3PO2G 2CH4W 1YITA 4C92E 2QGFB 1B44D 5F2DA 3BDLA 2XDPA 2HD0A 1QVGA 4PJOC 2G9DA 4DR7L 2RJEA 1JU5C 4JZ3A 1YHQA 1Q86C 2FB7A 2E6NA 1NY4A 2ZJQA 1F2LA 1RAHB 1O7LA 3G7ZA 3G4ST 3QSUA 3KYCB 2I1SA 4M75E 1QE6A 2SRCA 3CKIB 1L0YB 4M1UB 3B6YA 2B2WC 3OYIA 1VQPA 1H3EA 3KXTA 3HFZB 3OHXC 2K6PA 4DV1D 2F0NA 3M0QA 3BDOA 1QCOA 1WXBA 1EQQA 2VQFD 1BF4A 4ZCKA 1GOZA 4JRKA 1DJ7B 1PNJA 2QDLA 3UDCA 4LNQA 1T0JA 2D8HA 2D62A 2JZ2A 4S3SA 3THKA 5IYBG 1IHVA 1U4LA 4ABNA 3SD4A 3ZYYX 1HXDA 3MEAA 1WCMG 1Y8OB 4JI4L 2AKKA 4QVDA 4OB2B 4RGOS 1BUVT 4A3GG 4C0GA 4MMKA 5CKHA 1X2KA 4DOVA 4QQGA 4BE2A 1MHWC 1NCVA 3DWQA 3J81j 3TSWA 4X3TA 2CCZA 3WWVA 1G8ZD 3D0FA 5DLQE 5IP9G 1GFDA 2L5QA 3RKYA 1S72A 5KYIA 2HBWA 1OEBA 1NEGA 4M7DB 3C94A 2KCCA 2TSSA 5I6YA 5BR8L 3WOEA 3M57A 4X6AH 1XMQD 1VA7A 2JM8A 3RNJA 4UP7A 4DV1Q 3G7LA 1IBML 2J6FA 2QA4A 4DNRB 5C3EB 3OYAA 1OXSC 2OAUA 2AQ3B 4R8IA 2UUBQ 1HSQA 3QZ5B 4LF7Q 2V8JA 1F9SA 2MOXA 3FRNA 5IODA 3MO8A 1WYXA 4BXXG 3H15A 3PF5A 2A36A 2VYTA 1O9SA 3M0RA 4F14A 3X24B 3W2DA 1FJGL 3TSSA 3VYHB 3HOYH 5C4XH 5LJ5e 2LTOA 3HOYB 4J9IA 3HOVG 1HA5A 1EYAA 3CBMA 1J5ED 4GNXC 3CC2T 3O13A 4G7OC 2Z9HA 5D6YA 1WI7A 1IHWA 3I8ZA 4FW1A 4K6LA 2A69D 2JXMB 4YCVA 5EQ0A 2XU8A 1VQMQ 1VQPQ 1WX6A 3KF8A 4C3IG 3FN1A 2MPXC 3HOXG 2JA5G 2YSQA 5CQXA 1SKUB 3T4AC 5IHIA 4P74A 2GGRA 1ICWA 1PKTA 3T51B 1B7TA 4MZPA 2FFKB 3VYTA 3W1BA 5IT9E 2JA8G 1VQ8T 1XNRQ 1UE1A 2EYYA 4M75C 3FEOA 2MF2A 1ZSZB 3VYUA 4FF4A 4UDUC 3M85A 1Q12A 5DM7R 1VQ5Q 2KUMA 2A68D 3CXCS 2DYIA 2GNCA 1YNJC 3IQLA 3AU7A 1JXOA 2QI2A 4Q5WA 3RDVA 1JOQA 2F3WA 1U3OA 2QCPX 5JOBA 4O0AA 2I2LA 1EZ6A 3MC0B 1AVZC 4YHHL 4N8FA 3AT1B 1VQHA 4DV7Q 1YJWQ 2EY2A 4ALPA 1MNDA 2Z8LA 4O6JA 2KI7A 3V8LA 2LQ7A 1PRTD 4C8QG 5GANj 4M7DD 4HCEA 5AYFA 3JAMi 3CF5A 2YU9H 2VZAA 1N8RC 2HQXA 4X62D 2JNGA 4J1MA 1I4GA 1BIAA 4LF6D 5M5XB 2MP1A 5GAN5 1HZ9A 3U9SA 1H9RA 1G6ZA 4BY1B 1Y96A 2QEJC 3ITPA 1IYJB 1PTOB 1VQLT 3EBEA 3D4WA 3F2DA 1MMDA 2F4IA 3UDIA 1D6EC 4JI0Q 4M77C 3M5AA 4EMKC 4RCBA 2K14A 1KQ1A 2V8IA 2NUTA 3UATA 4DV3L 3MHXA 2XSCA 1PTOC 3HOVH 1H8KA 5L8RE 3KF6B 4RFBA 4HIMA 2OTJA 2LCLA 2NVQB 4B3RL 1PH3A 3VS1A 1MD2D 4CDDC 1VQ6A 3NTKA 1KLGD 2ATWA 4I7ZC 4II3A 2LNHB 2CWPA 1N33D 5E4XA 4WJ3M 2K79A 2ZM6L 2HZYA 1Q7YC 2HCIA 3GD7A 2R3ZA 1VQ7A 1GM5A 2IX1A 1LT5D 1NG2A 4NMZA 3NMZC 1X3FA 4KT0E 3PGZA 1EYGA 5GAN8 1UNSA 5C0XH 3VKIA 1FXXA 4JI2Q 1E2VA 3PIP3 4B9WA 2GFUA 1QVPA 4LE9A 8AT1B 3QDFA 1K0XA 2HQHA 1FYCA 2CW0C 5I9PA 2RKSA 2B2YC 5IYDH 1EY6A 4JUVA 1HNZQ 4DV5Q 2MGSA 3I4LA 1PMRA 2ZGWA 4FVMA 4KV6A 5EBCA 4JYAQ 2UXDL 3H3VC 1D1IA 4FP5D 3IAYA 3I55T 3K59A 4IUQA 3FLGA 3CCQA 4C3IH 1JQYD 1SSHA 4ZGJB 4M7AE 4FL6A 3LWHA 1F77A 2ZZDA 2WB1B 3H3VH 1OU9A 1HNXL 3TZUA 3A7AB 1MUZA 4J6XA 1TH7A 1F2YA 3LW5E 2DEQA 1EOVA 1U4RA 3S17B 3CCET 2EYFA 2Y90A 1EWIA 1K0RA 3K81C 1CA5A 4DF7A 4FSXA 3NWSA 2EY6A 4DR6Q 1IBLD 2KQ3A 4M75F 1U5SA 1QVGS 1KSLA 1DGSA 1E24A 3EIVA 1U06A 2FHDA 2DRKA 2QG9B 1HHVA 2L15A 4J9GA 5GAN6 4CRIA 5EG2A 2JM9A 2E2HB 4M77G 3UT1A 4OMPA 5DY9A 1OYXA 2CZ7B 1UGVA 2DILA 5KH6A 5KYXB 1M90C 1LTID 4R9WA 5C0XJ 3S1MB 1KC8C 4CJ0B 4Y91A 1NBEB 3GLXA 3Q24A 2QDBA 1S5DD 4LFCL 2DXTA 2QQBA 2A3LA 2B3GA 5IWAL 4YY3L 2KXCA 4X1VA 3M7NA 2BDNA 5KYLA 1BXTA 1N9SA 2OTJQ 5LJ5h 1BI1A 1SAPA 2CP6A 3CMAT 3ZJYC 3M58A 2RBMA 3HOXB 2KTLA 1TU2B 3ONAB 4QB4A 1ET9A 3VYRA 4JI3D 3FKIG 3PGGA 2QEXQ 1V1QA 2F0KA 2WIIB 5GJWB 1N8RU 2EJ9A 4ZGDB 3HOZH 4QGUA 4FW2A 2COYA 3JCMh 4MTKA 2LNVA 4R1JA 2PQAA 2RHSB 4LF9L 4YY3D 4FSSA 1Y8RB 2PMZB 1JB3A 2N49A 1C0AA 1WHHA 1LYLA 3IL8A 4DAPA 1GUTA 2JTMA 2VXFA 4OMNA 1NMFA 4C3HH 3OTOL 2EJFC 4AYBB 1RODA 4KMUC 4RMFA 3MP8A 3NK9A 3MAQA 3K5NA 4XTXA 2H3JA 5GAMh 1CZGA 3RMSA 2R61A 5D65A 1X27A 1Q82C 3FHWA 5I6WA 4Y7NB 4GKKL 3FPPA 4GKJD 3DM3A 3KYDB 4NNJA 2CW0D 4OF1A 4B3TQ 1ZQ1A 1KQSA 5ECAA 4HVVA 1K8AC 4XYOA 5KE2A 1TIID 4DV0L 2KQWA 1JRIA 2X4YA 1HJDA 2BE5C 1VQ5A 1WI5A 2A5HA 4FF2A 1Q7YU 5LJ3e 2JA7H 1E3PA 1GBQA 3INZA 3PNWC 3CCVT 4QVZA 4BY1G 1UGRB 4J7IA 3GP7A 4IJHA 4JI1Q 5M5XH 1PYBA 4HJ7A 4GNXA 4M7AA 1ASYA 3EGXB 2J6OA 5DNFA 1Q3LA 4CC2A 1UWVA 4IALA 2KHJA 5EBDA 3AB9A 1BBWA 1J3TA 4C3HG 2AWNA 2AHJB 2ZPEB 4I65A 5G3LF 2WINB 1O78A 1VYTA 2D8JA 2UXDD 1WHLA 4A3JH 4LFCD 3TMEA 2BUDA 3CPWA 4OO1H 5FO7B 2EWNA 1GRIA 1KSWA 4A53A 5GAOq 1VQOA 3F1ZA 2NVQH 2LXKA 2ALYB 2F4VD 2JT4A 3QB3A 4TQUS 5FU6B 2JK8A 4OL7A 5HK0A 2FVUA 2RA4A 5LJ5d 3OMGA 1KLUD 3DLLA 3S16B 1MSGA 3OSVA 4B9XA 1FMVA 1ILQA 5BN4A 3EH2A 3H6ZA 1QQJA 5K36G 3BZKA 4AQYD 3EHQA 4M7AG 2EYOA 2X4JA 2NYZD 4GLAC 1WHMA 5JVG3 1QKWA 4C0DB 2D6FA 4L63B 4CDCC 5T1IA 3TRZA 1HFNA 1IW7C 2HSPA 4DR4Q 5FWBA 1AW7A 1RAGB 3D3RA 5H1SE 2KROA 1JEGA 3CCEQ 4C0DC 1U8RA 1LTLA 4IIOA 3E9HA 1VQKT 3C1FA 4L5RC 1VIEA 2L1BA 3QOLA 3H6MA 2EYWA 2JMCA 1G8XA 2DVEA 5IHNA 5AT1B 2E76C 2XRSD 2IL8A 2E2DC 2HD3A 1H9JA 4TVAB 5CV5A 3GTKH 3MA2B 3H0GG 4KUIA 3A8GB 4M78G 1K8MA 1XNRL 3ONHA 2DM1A 5KYWA 2ECZA 4OMQA 1LTSD 3D6WA 3U9OA 5HGTA 1B07A 2F3VA 2K75A 4M7DA 3NEMA 1OULA 3DEPA 4A3CG 3JAMc 2PQWA 4BY6C 1HTPA 4BWGB 2XN9C 2QILA 2BH2A 1YWOA 4DR5D 1IO6A 2EYPA 4OX9L 4NL2A 1IL8A 1Z7TA 3MEUA 3CCJT 4F7UA 1D5MC 2K2VA 2YDLA 3M4OH 1I8FA 1I5OB 4E7HA 1Q81C 2O2LD 5LMNW 4LF7D 5GAOn 2EYJA 3CPFA 4X65L 1RLQC 4GLVB 4M7AF 2NZHA 4BB7A 4PJOD 1VF7A 1KSVA 2HSEB 1UDLA 4KJOA 3NWTA 3I72A 3L2PA 1IKLA 1EIYB 4HIDA 2CH4A 1SROA 1ZA1B 4O42A 4PV1C 3MP1A 1AZQA 2OF1A 4Q0FA 1X3QA 5EPLA 2HNIA 4M78B 5CORA 4HCBA 4C8QE 3DEOA 2IT1A 3CMAA 1VQKQ 1Q1EA 5G3LD 1QVFA 1WA7A 4C2MB 1WTRA 1R77A 3I90A 4C5EA 3BFMA 1QVFS 1KL9A 1ONLA 4CKCA 4A3KG 5CKEA 2ROLA 3EGXA 2UUCD 4DV3Q 4PJOG 1FD7D 2KRNA 2OQKA 3I4NB 1NM7A 1EZ8A 1LACA 1N27A 2ED0A 5IGFA 2JQOA 4KHZA 1CKMA 4E2FB 4HJ5A 4C5HA 2N3SA 2DZ9A 2OQ0A 2G9HD 3ERSX 3H41A 1RKNA 1X3PA 3TS0A 4A3MH 1PH7A 2CWAA 1ICFB 4RG1A 1AT1B 2Z4IA 4LF4D 1XNQD 2KMTA 3CCRT 3PIPA 1VQDA 2E74C 2LKVA 2I0NA 4A3KH 1LO5D 5IOCA 2EBPA 1EY0A 4IO9A 2QF7A 5GAMe 3M0SA 1H9SB 1IGQA 1VMCA 1H3FA 1SRUA 5JEAJ 4HA8A 1F2MA 5ELBA 1ZBJA 4FYXB 1EFID 2DO3A 1C8CA 5IAYA 1SMXA 3BZCA 1QW1A 3BW1A 1OX9A 3NFCA 1KRTA 2NUPB 3JSCA 1I94L 1U1SA 4OWTB 2EAYA 1PKSA 2SEMA 1GBRA 3SE0A 4EQNA 4PFZA 1Z9ZA 4IQZA 4K5WA 3NTIA 1Z47A 5GAEC 3OS5A 3MP6A 1Y57A 4C8QD 2DBKA 4M7DG 4MHEA 4OUDA 4J9CA 4RTVA 2G5DA 1GUWA 2JMAA 4ZUIA 2KEEA 1TUCA 2KECA 1PSEA 3DWAA 1D1BA 5HGQA 2XICA 5EKLA 4XTWA 1V1CA 3O8VA 3NSWA 2E41A 3LX7A 1KAAA 1QCNA 1CQVA 1NE3A 4ZK9B 2D0NA 4GKJQ 2F1LA
chains in the Genus database with same CATH topology
2KHSA 3KBGA 4JK1C 3OYEA 4XT3B 3OYHA 1STBA 5KNLA 1BR9A 5CO7A 2B2TA 5COYA 4F7UF 2WP8J 5D3DA 3QPHA 4XAXB 3ZEHA 2A6HD 1H3ZA 1ZXTA 1B4OA 2A7YA 2L11A 4LDWA 1CHQD 4E7LA 1STEA 4C8QA 1Q8IA 2O5IC 1WD0A 3PFSA 5ISRA 1VQMA 3RUZA 3LYIA 3H94A 5BN5A 1GUGA 1II3A 1BI2A 1CI3M 3QUIA 5GAMg 3HP3A 3X20B 3JCMP 5ELCA 5LL6S 4M78F 1BCPB 4XIGS 3Q23A 3A55A 1CM9A 3P75A 3SFMA 4CKBA 3SR1A 2YYZA 3CBOA 1TWCB 3MVVA 2VUMB 3OQ5A 4ATOA 2M9VA 4KULA 2DY7A 4BDYA 1JOKA 5JVH3 5J26A 5LJ3d 3SK8A 3J80E 1SYFA 1UEAB 1CQFA 3G6EA 2KCNA 4M7DC 2HDMA 1TR5A 2P4TA 2F0JA 1B50A 3FVQA 4J83A 1A3TA 3TN2A 3I3CA 3V7RA 2F0QA 2R92B 1EU3A 2NUCA 4R8NA 4DK0A 4ZUJA 1XOVA 5KCOA 3CBPA 2PPBC 2KK4A 2TMPA 4ID6A 3HHTB 1QP3A 3KBXA 5IGGA 2CQAA 5D6XA 3JB9I 1SFOB 2JA5B 3HRSA 1VUBA 2CYZB 1EY7A 1EYCA 5E4WC 3EFRA 1K73C 2K5LA 3CCRA 2GQVA 3M53A 3IKJA 5EGTA 1RDPD 3L2QA 1NUCA 2K5WA 2KSSA 3IFTA 3JCMf 4ZQ3A 1JWUD 1T5EA 1TVXA 4RCNA 1IHZA 2EKOA 5M9OA 2Q8IB 4RWSC 4NP5A 4HCSA 4LDYA 3ER0A 4EVOA 3HPWA 3VA7A 1KDCA 4KTAA 4N9PA 3META 4M75A 4UC4A 2ZXPA 1FNWA 3TZDA 1I3QB 2E10A 3JCMe 2O4XB 4H0LC 4ZLTF 5CCAA 4C0FA 4PJOA 4J8QA 3GTMB 1YNJD 2VGNA 4FIBA 3X3NA 2EQJA 3Q1JA 3V7SA 4BACA 2XWJB 5CV7A 5ELFA 1D1KA 3FPUB 4FNFA 1LTBD 1E0BA 2D9UA 1DOMA 1KD1U 1JJ2A 2CVRA 1ZKOA 3RD4A 4C5IA 1ENCA 5JEAH 2E6ZA 3LGFA 3CMET 4OVAA 1IW7D 1MHNA 4N0AA 3FKIB 2ENBA 4PNYA 4IZ8A 1UB4A 3G71A 2HDLA 2K03A 3FC3A 3OBYA 1Y1WB 1G91A 3JB9G 2EQMA 1F9PA 4DU9A 4XYQA 5AFWA 2ICIA 2WACA 2HCCA 4K8IA 3CEYA 1N9RA 2DAQA 3X25B 4F7UE 2WKDA 4JLGA 5GAOr 1STYA 1SNCA 5GAOl 3NBIA 5CV8A 1SNDA 1Y8PB 1Q86U 1A3VA 4G4KA 1BIBA 3C4SA 2ID0A 4KUDK 2JVVA 2VXWA 3CCSA 2K3YA 1GXIE 2VB3X 2F0TA 5DAUA 3GTOB 2R57A 3OMCA 2L55A 5FRMA 2PQEA 1DD2A 1JB0E 1AFPA 3FB9A 5A0DA 4DA2A 1KNEA 2KJXA 5LJ5f 4Z9CB 4H13C 3R2TA 4EDUA 1M90U 3GIBA 3CCVA 1KDBA 3E19A 1WJSA 4JS5A 3A54A 1CA6A 3Q22A 1LLRD 1G3TA 1DXMA 4PJOE 4N9TA 1JBMA 3HEJA 1Y1VB 4OO1G 1MBYA 2VB2X 4LDUA 1EY5A 2ZT9C 1SSOA 4FXGC 4A54A 3BVMA 1NZ9A 3OYCA 1JE4A 3K7AB 1UGPB 3HSBA 3BG3A 1PDQA 2YHTA 1YITT 3OWEB 3S1RB 1H9KA 2J7ZA 3QJYA 2F0MA 4WORA 4M77A 1U4MA 3W3AA 2MWPA 2XIDA 1CK1A 2YLBA 1GJXA 2K6AA 1Y71A 4BI3A 4ZN1A 3LGLA 2ZXOA 5CAIA 3M4YA 4ME5A 2YU9B 4KN7C 1HFGA 3T13A 2FL7A 1VQMT 5FU7B 2KA7A 4N4IA 1OZ2A 5CV9A 4XTUA 4KKTA 3JCMJ 1TQOA 1PTOH 4X3UA 3DB4A 4JDSA 4E7IA 3PMTA 4M7AC 2M1HA 1TWGB 1I4K1 2BA0A 2JYOA 2EE1A 5GAMj 2N55A 5GMKi 2ICEC 1S72T 3QOJA 1KDAA 4BD3A 5C0XG 3Q6SA 3H0GB 3QO2A 2JN0A 2HAXA 1PXUA 1B34A 4M78D 5IGCA 2R7ZB 4E47A 1NAPA 1S5BD 4KKUA 4Y28E 4ZKBB 5C3XA 3S2DB 2QQAA 3JCMg 1G291 1EEID 1KQSS 2K32A 3E9FA 4M78C 3S14B 1VDZA 2FYKA 3UWNA 2Z1CA 2P0PA 1GHKA 1KHIA 2ZPBB 2RSNA 4C8QB 5D3IB 4FO2A 4WF2A 2RB6A 3P1HA 1LTRD 5HK3A 5CBAE 5I2MA 3HRUA 2WAQB 1EIFA 4F8MA 4C3IB 3MEVA 3MXGA 4M75G 3GPLA 2E12A 1M9SA 3VR3A 2K5QA 2XKOC 4H7BA 4HMJA 2MI6A 1G2TA 1HTLD 1RL2A 4J8OA 2SNSA 3MFGA 4DN4M 3OYJA 1OI1A 4E7JA 4PMCA 4XTZA 4X9DA 2RDHA 1FNUA 1I4PA 3WXMB 4XXEA 1X01A 2RH2A 3E6ZX 3V05A 3OW7A 5IT9L 4IKFA 2OTLA 4DFAA 1TWAB 2XHCA 3LWUA 5M5WB 4A3BB 4BY7B 1QG7A 4XTVA 3IFDA 1LNXA 3QYGB 3I56T 1EYDA 2V4DA 3RZOB 3KLSX 1A15A 1QNKA 2IWHA 1WQWA 1W6KA 3FDRA 4JLIA 2XIWA 2BIVA 1O7ZA 1TKWB 1UGSB 3JCMc 4EQPA 2F0IA 3CCMT 1IYVA 3X28B 1LT3D 2Q8TA 3CCLT 3TP8A 3OS2A 3CMMA 4JS4A 3MXNA 2EY1A 1M1GA 1OXTA 2F0VA 1L0XB 4U673 2KDSA 1UAPA 1XTCD 1FWZA 3TREA 1I81A 2ZCFB 1EIGA 1TS4A 4MZMA 4ELZC 2HUGA 5C6AA 2DN8A 3K0YA 3EAEA 3A8OB 4DAVA 3CMEA 2OXPA 2PNRC 3WVDB 4PJOF 2DNCA 3JB9F 3LLRA 4C92B 2L3RA 2EYLA 3A5ZB 2Y4XA 1WJRA 4OP0A 3QJ6A 2JA7B 5LJ3f 4GY5A 4XDXA 3D4DA 1BCPC 5GANh 3VA5A 3Q0AA 3P8HA 1PFMA 5CBEE 3GV3A 2RI5A 1EOTA 1SYEA 4X34A 2CS7A 2B2UA 4N0AC 2QQSA 2QXFA 1Q82U 5LJ5j 2FINB 1LTGD 3BY7A 1WVLA 5EPKA 1YCYA 3SWNA 2RHXA 2VC8A 1C48A 1U4PA 3QZ9B 3S3MA 3J7YW 2PU9B 4QVCA 3OYMA 1Q90A 3LX0A 3I70A 2B2UC 1WTWA 1D5ZC 4WFN3 5GAOm 1EL0A 5GANe 2H1EA 1R4PB 1M8VA 3F70A 2F0SA 1LTTD 3V8KA 5JJZA 2KY9A 5IGBA 5FROA 2MUYA 2ZPIB 3VR5A 2EVBA 5T1GA 1STHA 5FLXL 4OB1B 4ZGEB 4OIKA 3H09A 2IVWA 3OYDA 3JCMQ 4OO1I 1UGQB 2KVQG 2VV5A 4M75B 2K57A 4M77D 3VJPA 3SHLA 2XVSA 1EY9A 4KD3A 5M5YB 2X35A 4M7DF 2F0EA 5CYUA 4QCLA 4A4FA 2E70A 3GOXA 1A2TA 2NVTB 3OBWA 4PKCC 4A3DB 3DB3A 1YIJA 3VUZA 4C1NK 1GXDC 2RA2A 4PL6A 3KUFA 3SK6A 3GF5A 2C06A 1I50B 1AN8A 1M1FA 1IKMA 4RMOA 2QQ9A 5C5MA 3RIRA 4HSPA 1TY2A 2A73B 4KBMB 2X6LA 3GNFB 5GAOp 2B8FA 2JA8B 2AUJD 2OT2A 1QP2A 4KJNA 4O5VA 4K5XA 4QIWB 1Y07A 2EY5A 1VQOT 2CKKA 2A69C 5KGUA 1M1KC 3GTGB 4RG8A 2F0UA 1CTMA 3TP5A 4LK1C 3LWIA 1PTOD 1PTOF 4RKLA 5CKFA 2R93B 4QUFA 1H9SA 5HURA 1W2BA 1RF2D 3AHUA 1IZ6A 2QDYB 2BE5D 3K5LA 3DXJC 4KY6A 3E0JA 3L2WA 4RGMA 3CC4T 4BA1I 5GANf 3BS1A 2VUBA 2IX0A 5FKAC 5KNCA 3M4GA 4M78A 1HUNA 2I46A 4XQ3A 1B1ZA 3S6WA 1Z6HA 2P0QA 2Y0SB 5I2XA 3GTQB 5FOBB 2NN6I 2RJDA 2R5MA 5CK9A 4M75D 4J6HA 2N88A 3C95A 4YIJA 3MEHA 1ET6A 1K83B 1NPRA 1VQ4T 3SK4A 2DTOA 1ZBXA 3HP9A 1S5ED 1AHJB 1KD1C 4C92G 3PUZA 3J80L 3J7AF 2GF7A 1YI2T 2SOBA 2GCXA 5FO9B 2RM4A 2DD4A 5GAN2 1STNA 2D5DA 1NJIU 1PSFA 3L2VA 3CCLA 2LQKA 4NL3A 2EJFA 4EGVA 5GANd 4HR7B 4KK7A 1CT1D 4XTYA 1YJNA 3D8GA 4II1A 3DWPA 2VNUD 3P8DA 1ML0D 2EFIA 1ZHIA 2EYQA 3OSSC 4K8JA 2K33A 3QYHB 4RKUE 5FRNA 2EQKA 1I4XA 1G5VA 5LJ3j 3J81L 4A3EB 3L2RA 3GTLB 3CXCA 3VYGA 3KUPA 3LNNA 3CPWS 5C0XI 5KIXA 2RK1A 1RTNA 4DA4A 1JJ2S 1G2SA 5DLOA 3M59A 3CCJA 1I4RA 3JCMd 2E2IB 1BOSA 3A8KE 5J22A 3I56A 4DQ2A 2FHTA 4FT4A 1NR4A 3CCUT 2JE6I 1BBXC 1NR2A 5CR2A 1SE4A 5CV6A 1RCVD 2J0TD 5FLXE 3JB9H 4J6YA 1PZJD 4A3IB 1K8OA 3NTHA 5C4ZA 1MGSA 3R3OA 3GV6A 4DGZA 4DK1A 1WD1A 3EQLC 1WTXA 3NE5B 2LT1A 2K5IA 3VR6A 2EOTA 1DOLA 1ZYRC 3TP6A 3E9GA 4LDXA 2B2TC 4MDWA 1TS2A 3C1EA 4G57A 1EY4A 3BDUA 3PUVA 3S1QB 4RGTA 4X9CA 1ENFA 4RKBA 3G4SA 3R93A 1H641 1SEBD 3CRLC 1HQMC 3FEWX 1D3BB 3K5OA 3OWFA 1DM0B 1G3YA 4L6V5 4L59A 1ESFA 4BY6B 3MXPA 4RHSA 2O4XA 5A0GA 2LFNA 1K9MU 5GAN4 4K2LA 5C4HA 4R56A 3C2PA 1PYWD 1YIJT 4V190 3LH0A 3K58A 4NDXA 2B2VC 3OYLA 3MHBA 4DXGA 1I4QA 2BA1A 2EXZA 4QUCA 3PUXA 3CQZB 2KAFA 2NN6G 4HT8A 4RA8A 2EJGA 4HKEA 2CZ1B 2F0DA 4PMBA 4M7DE 3QXEB 5KNDA 5J39A 3CHBD 2PVOB 3PMIA 1FR3A 1GUOA 4ULLA 1NE8A 2OEOA 1ESRA 1LJOA 5CV4A 2E64A 1R8OB 5CQYA 3EJIA 3R6OA 5GMKj 1F2ZA 3ME9A 5A2QE 4PMWA 4OHJA 1YJNT 4A3JB 2EYMA 3RZDB 4OIJA 3L3OC 4XU0A 4K6DA 1HCZA 4L6TB 3HOZB 2KVMA 2Z4HA 3GTKB 4A3MB 4QMGA 4HCZA 5ELEA 3OY9A 4LDVA 4V2SA 2NTSA 2DIQA 1SJHD 1HPCA 4LMQD 3HG9A 2DXCA 2L89A 1KTKA 4CHTB 1VF5C 5LL6X 3VYSA 3VR2A 4F7UB 4FXDA 1KHCA 1MI2A 1EWCA 2R58A 1Y7XA 2JP1A 1B2TA 4NS5A 3QO3A 2IW3A 1LT4D 3K5MA 3HRTA 1SMYC 2FMMA 3C46A 3PTAA 4IFDH 3RUXA 3QG1A 4DOWA 4ZTFA 1E2WA 3VR4A 2DPPB 1DCZA 3CCUA 4XQJA 4EMGA 1S4ZA 1ZEQX 1P92A 1R9TB 1B53A 3AMUA 5NUCA 2R5AA 1SNQA 3KK7A 5CGKA 4JRPA 1I6HB 3JAML 2SDFA 4FF1A 4OGEA 2LDMA 5FO8B 4UAIA 2MHVA 3SB2A 4MZTA 1B9MA 3FJPA 2PW7A 3GO5A 4C56C 1V8QA 3V8JA 1KABA 2MWOA 4EMKB 1TT2A 2QA4T 1A6XA 1BNZA 2RK2A 3D4RA 5KRUA 2QTXA 2DK3A 4B08A 5BN3A 2YRVA 1YJ9A 4M78E 1OXUA 1RJTA 2L0CA 3A8JE 4RAUC 5GMKh 1I4HA 5D6WA 2JEAI 4GLKA 3EROA 3CC2A 2F5KA 4CKEA 5E3FA 3QBYA 2BOSA 3MFYA 4HEDA 5TSSA 5IGEA 1KNAA 4HT9A 5D14A 2X6GA 5JEAG 3I55A 4C92C 5M3FB 4A4GA 2E75C 1F9RA 4BE1A 5KE3A 5DEHA 4PNOA 3ND9A 4F7UG 2XDDA 4LAAA 4RG2A 3QDRB 4RHRA 2RDFA 4DNTB 1SYDA 3HL8A 4A3FB 3HFOA 3PUWA 2RQXA 4PLIA 4PQXA 3SWNC 3R8BA 3OW2S 4MN3A 1I5LA 3CD6A 1O80A 1ZYRD 2NTTA 4HMIA 3M4OB 2M0OA 1JR0D 2K4YA 2A68C 2WKCA 4QF4A 4RH6A 4ME7A 4F87A 3G6ET 4BDZA 2O01E 3ZBDA 3HGBA 2I07B 1B9NA 1V29B 1SMYD 3BDCA 4ZAIA 4XU1A 3CC7T 3GNGA 1BYMA 2L12A 3BYYB 2H4OA 3M55A 1AP0A 2WV6D 2GA4B 2D0QB 1LT6D 2A6HC 3TDQA 2M2LA 3M7GA 1BCPF 1WTVA 1F9QA 5EKKA 4K2KA 2PYKA 1RI0A 2FJ2A 4IFDI 2ZPGB 1XTDA 1EU4A 4V0BA 5CIUA 3H8ZA 2XI9A 3I73A 2HBPA 4CJ1B 1PFBA 4KY7A 1FX7A 2C5CA 2K04A 2B39A 2IJ0A 1EWHA 4C3HB 4CI0C 2EZVA 1RHPA 3LWEA 2B2VA 3N6RA 1HUMA 1S5FD 3L2ZA 3CCST 4R55A 1DJRD 3RESA 2ZPFB 1RTOA 4H44C 3PMFA 4L5GA 2JTFA 4OB3B 5GAMf 1PFNA 4NOYA 3WDNA 1SSFA 3VV0A 3HZXA 1N6AA 3I4MB 2PVDB 3G6JB 5KEEA 1VQ9A 3MCAB 1SBBB 1GUNA 4HN7A 2AWOA 3E1SA 3OIPA 4FM4B 2JSOA 4WRDA 3ERQA 2XG8D 1XNIA 4D6WA 1PZID 1VIFA 1BO0A 4P2CB 1YNNC 4TRDA 1IYUA 2KEDA 5K36H 2J4XA 3KLRA 3NQTA 3FMCA 3WVEB 1DONA 3OS0A 3WOFA 4M77E 2XK0A 4C0ZA 1BQQT 3HOUB 1TS3A 1SDFA 4M8AA 1X6OA 2Y4YA 3PT9A 4IFDJ 1WGSA 3RMQA 3G71T 2RSOA 2LQ8A 3ASKA 3JCMb 3OB9A 1FNVA 1AEXA 4NKLA 5ELDA 2BKDN 2RHYA 3HOWB 4DXFA 3DUZA 2RHIA 3OPOA 3A8LB 2XDBA 5I2YA 3SEBA 3T53B 2EYHA 1WNLA 3TEEA 4BBSB 3OYBA 4A3KB 3F2UA 1J9OA 1W2BS 5EJWA 1WQ7A 5LHY1 3P7JA 5JPNC 1HK9A 2SEBD 3ZFJA 2PUOB 3P20A 2EQUA 1BI3A 4BUGA 3JAME 1OXVA 4OGQC 2R6GA 1V1OA 4KHVA 3PV0A 4KKSA 3CC7A 5JPMC 1O7YA 4FXKC 3V2TA 2K3XA 2EJGC 1PRTC 2L8DA 1OZ3A 4II2A 1JWMD 2PZUA 2B63B 2MAMA 2LMCB 4VUBA 2D2CC 3NBHA 2IPKD 2OTJT 3CRKC 1CFMA 4DAYA 3R2IA 2F0FA 1EQVA 2NVYB 2P0KA 2DJZA 2F0WA 4HSVA 1H9MA 5EPJA 4C8QF 3RLFA 3C3LA 5FU7C 3QIAA 4E7KA 2DD5A 3SDZA 4CBVA 2F0OA 2OTLT 4KI0A 1PLFA 2CGHA 4IUVA 4M7AB 2F0PA 3L7ZC 1VQ5T 2RD1A 1X75C 1VQ9T 2VXEA 4JRQA 4KD4A 1CHPD 4CGYB 4FYDA 2E1HA 4ODGA 1SE3A 2NN6H 2IG0A 3OYFA 2RHZA 4X3KA 3CCEA 1S5CD 3DLMA 5CMDA 3S15B 2K01A 5A2QL 3OA6A 3A7LA 1G3WA 2XWBB 4IUNA 4OB0B 4MIUA 4XT1B 5CC4A 3J7AV 1NPPA 1D2BA 3FDTA 2JA6B 3HKSA 3E5SA 3ND8A 4IUTA 1XWEA 3A8IE 3RKXA 3JB9D 1RD9D 4ZKCB 1YHQT 2ZTBA 4A4EA 3JRZA 2WSEE 3GTPB 1M1KU 2QEXT 2NWGA 3QIIA 2JOYA 4TVRA 3S2HB 4M7AD 5I4DA 1K8AU 5A35A 4EPCA 4MDXA 1LABA 4KY5A 3EA6A 5M3MB 1WTPA 4JRIA 4HTHA 1M5Q1 1STAA 4MMLA 3X26B 1VMPA 1CZWA 1JWSD 2Q8RE 5C5LA 4F7XA 1FGBD 1B34B 3OYKA 1ENAA 1SNOA 1M4ZA 4J6WA 4YTLA 1PZKD 2F03A 2CZ6B 2DTIA 4OMFB 4K14A 2PZWA 1XYIA 1DZ1A 4XU3A 4ILWA 3M54A 1UEBA 2QKIC 5C4JB 4O1NA 1DOKA 2E5QA 2GFAA 1I6VC 4J5YA 5I21A 1YI2A 3A56A 2KOLA 3RERA 3HS0C 5KNBA 5DM73 4BS9A 1BCPD 4TSSA 1AZPA 5J3BA 3CCMA 3S3OA 5I9OA 4ZN3A 1EQTA 3RKWA 1M8AA 3HRZC 2DKGA 4C92D 2RDGA 1YBYA 3TCJA 3MZ5A 1YJWT 3K57A 3S1NB 3HFNA 1YNND 3GP8A 1WJQA 4A4HA 1XQHA 1V1PB 1U9RA 5I2SA 4BBRB 3M56A 5LJ3g 1JCKB 2B8AA 2LT4A 3KLSA 3JCMX 1C4QA 3TU4K 2PW5A 1KQ2A 5J1ZA 2WSFE 2V8KA 3J81E 1NJIC 1YJ9T 2F0HA 2PUKB 3BVGA 2DZCA 1JC7A 4ZYSA 3EFXD 2DIGA 1EIHA 2F1MA 4Q5VA 2DXBA 4FT2A 4C92A 3V7CA 3A8MB 2EPBA 2E2JB 1VQKA 1Q81U 3UPUA 2RI2A 4EQOA 4FU6A 4IUPA 1R4QB 3HKZB 3PO2B 4C92F 3SWNB 1XX8A 4FF3A 4M77F 1MSHA 1OO9B 5GANg 2X69A 5C44B 4RCCA 1MGQA 5IN1A 3VU3C 2M00A 2A74C 1OXXK 2LCCA 2A6EC 2XD0A 1WTOA 4XK8E 2B2YA 4M77B 2ZXRA 3OYNA 4J7FA 2F0GA 5JAVA 3NXWA 1KC8U 1V43A 2B2WA 5CR3A 4P5NA 1K73U 1VQ7T 2RHUA 5GAN7 3RMHA 2ZPHB 2K7VA 2XRQD 5C3WA 2M16A 5GMKl 5HY6A 3OYYA 2K05A 2LC4A 1QNUA 3CC4A 1Y69U 3JB9J 4G7HC 1JICA 1SJED 4U68A 4C3JG