3KYDB

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
545
structure length
477
Chain Sequence
SRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQDQQVLDVKSYARLFSKSIETLRVHLAEKDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-activating enzyme subunit 1
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 120
structure length 477
sequence length 545
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
B PF14732 UAE_UbL Ubiquitin/SUMO-activating enzyme ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.520 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ubiquitin activating enzymes (Uba3). Chain: B, domain 2 3kydB02
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 3kydB03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kydB01
1N1GA 3EMKA 3HSKA 3I83A 1H93A 4ZD6A 4MVJG 4CV1A 3KSDO 4BMVA 4KWHA 4CLXA 1I2ZA 3U9LA 3TNLA 2C0CA 2CVQA 1E7YA 4DIBA 5TS3A 1G0OA 2YQ5A 1U7TA 2R6JA 3G17A 2PGDA 1QSGA 1YL6A 3VDQA 1NFQA 4B4VA 4RVDA 3DOOA 1PJBA 3M1LA 5EERA 3LT0A 2PNFA 2I3GA 4DBVO 4DMLA 1BXGB 3O4RA 4OIMA 3FRJA 4R9SA 2GERA 3RUCA 4D42A 1R4NB 2FP4A 4BV9A 4E5KA 3K92A 3ZV3A 2J5RA 3E8XA 4FS3A 1B3BA 3JQDA 1KEUA 2CVZA 2ZTUA 4ILKA 2DPGA 2YYYA 4IMRA 3R3JA 1KBZA 5DP1A 4DWVA 4DYDA 2GZ3A 1Z6ZA 1A7KA 2LDBA 1UXGA 2IXBA 2PZJA 3TOZA 4RPGA 1GZ3A 1W4ZA 2Q1TA 5ICMA 4IIVA 3AUAA 1HL3A 4CMKA 1P1RA 1OZAA 4M49A 4Q3AA 4U7WA 3H9EO 4UVGA 2GNAA 3QWHA 4S1VA 3V2HA 2V65A 1LC0A 4DLBA 4FDAA 4UVEA 3FNEA 2EP7A 1SCUA 3ROKA 1I0ZA 3PPIA 3MZ0A 3AOEA 4ND3A 1RM4A 2DM6A 1LI4A 2Z1MA 1HDRA 1X15A 3O03A 2PKQO 4YEDA 3Q9UA 1ZK0A 1N7HA 1FDVA 2VCYA 2NU8A 3GDFA 4P8RA 4R68A 4B3JA 1NTOA 5G4LA 5CHEA 5I9NA 3UKOA 4C4OA 2IEDA 1NVGA 5IJZA 1DRVA 4PVDA 3KUXA 2ZQYA 4WNIA 1V3TA 3VPHA 1LEHA 3G3EA 4GWKA 1B3RA 1BGVA 1WWKA 2AHRA 4WEOA 2ZATA 2NTJA 1NQTA 5DZSA 1GZ6A 4E13A 4D0SA 1X0XA 3ASVA 4RPHA 1UXHA 2ZTMA 3H6KA 2HJRA 4KP7A 3KSUA 2RHRA 3CUKA 4ID9A 3WR5A 1YBVA 1QLHA 4BNIA 2J3IA 4O6VA 3MOIA 4OAQA 4N5NA 4ZHSA 1ZXBA 3BHJA 4R69A 3FCOA 4BNWA 3C24A 3WJ7A 3QLJA 1TT5A 5KVVA 4EYEA 2YV3A 1UAYA 1MG0A 2V6BA 4ZU3A 1EQ2A 4DTIA 1HKUA 1HDXA 2AE2A 2R2GA 5ICSA 3PVZA 3Q6IA 1NWHA 5DCYA 2NV6A 5LDHA 2GR9A 4MP8A 3U09A 4R01A 1DO8A 5AXCA 3W4KA 1K6XA 1P74A 4HFNA 2B5VA 2ZK7A 2GSDA 1CIVA 2VWHA 1CF2O 4R1SA 2CF5A 4DBZA 3LK7A 4KDFA 1PEDA 2C07A 3ZU4A 4B4UA 1HYHA 3NJ8A 2H6EA 4BNNA 2J3KA 1XDWA 4GKVA 4PRLA 3S2EA 3WGYA 2G5CA 5HBRA 2Y66A 3HNPA 2OXIA 4WLVA 4CPDA 4EITA 4E3ZA 3MOGA 4YAIA 4IJKA 2EGGA 3NT4A 3CH6A 3RROA 1R6DA 3GQVA 1E3LA 4LRTB 4HP8A 3IMFA 1U5CA 2PK3A 3ANMA 4UEJA 1R0LA 3U3XA 4A26A 3WSWA 4RLSA 2X86A 4YVFA 1W8DA 4BUCA 4FC6A 5JLAA 3PI7A 1B8PA 2GO1A 4L0QA 4L74A 2UYYA 4RVSA 3Q11A 3DBVO 4XGNA 2YDYA 4LISA 4YRBA 1PIWA 1XKQA 4BVAA 5I9LA 2I9PA 4DIFA 3PZRA 3GFBA 3QVXA 3WTCA 1PGQA 3PHHA 3JD2A 4BB6A 2VWGA 2EGHA 1ZH8A 2HSDA 1P44A 1IHXA 1LQUA 3U62A 5ILGA 2TMGA 1LLUA 1KIFA 1RYEA 1YDEA 2VTEA 1YDWA 5EN4A 1YS4A 1M6HA 1NNUA 3W6UA 2X22A 3JD4A 3IKVA 3E1KA 2DKNA 3AI1A 5A9SA 1ZK4A 2VWQA 4I5FA 5CDUA 3I6QA 4R1TA 4I08A 5IAAA 2I99A 3DQPA 1PZGA 3NAQA 1N92A 1QYXA 4J16A 1ZJYA 1ONNA 1JVSA 3UAGA 1MA0A 1EUCA 1RKXA 5I8WA 3LLSA 3W8FA 3I9KA 5EPOA 3L6OO 5KKAA 4PGFA 2DBZA 3F4LA 4URFA 3QSGA 3PDUA 1C14A 3DHYA 5IXSA 4IS3A 1D3AA 3FNHA 4LMRA 3U49A 3RC9A 1D4FA 3DMYA 4KTTE 2JCVA 2C29D 5CG1A 3ZWNA 1LRJA 2VHVA 1VL0A 1PX0A 5KVSA 1PL6A 4XR9A 1QMGA 2X0IA 1ZZEA 4RF3A 1MGOA 3HDJA 3P19A 3SX2A 4XB1A 2A4KA 4MIYA 1GR0A 5G2OA 2OBNA 2YV1A 1RPNA 4WCFC 3W1VA 2HKIA 2E6UX 4IDAA 4MOWA 4AJPA 1X1EA 3QWAA 1BDBA 4YJFA 2JD0A 4CLHA 3RUHA 1O5IA 3DFUA 1ZIDA 3VZRA 2YHIA 3WQQA 3ZWMA 4KTVE 1N8KA 1MXFA 4UEOA 4PG5A 4YJHB 3JQBC 2I3AA 3LC7O 3OJEA 2GUGA 5ITVA 4BMNA 1YH3A 1C1XA 4NJMB 4NI5A 5F1KA 3T4XA 2FZWA 5FI5A 4CLRA 4N18A 4CQMA 5H83A 1NR1A 4JP3A 1AHIA 5COAA 2BH9A 1A9YA 4ALMA 3JD0A 4C7JA 3N7UA 4NFSA 3PJEA 1P1KA 2O48X 4XYBA 4MINA 1U2GA 3FHLA 2IZ0A 4ALLA 3OECA 1YKFA 4XZ3A 1AXGA 2J5QA 4LCJA 3I52A 4J0FA 3TDKA 3ZU5A 3C7DB 3DR3A 4AJ4A 5TIIA 1HXHA 2RHCA 4AJLA 3D3WB 4GLOA 2WYWA 2OL4A 1OBFO 4BO2A 4MP6A 1V35A 3A14A 4YTEA 4MPDA 3JQFA 1KERA 3I4FA 1PZEA 3NTOA 5AVOA 2VNAA 4D44A 1U5AA 2DBRA 1EEHA 3RJ9A 1PR9A 2AEMA 4YAEA 3JQ7A 1PTJA 3L77A 1EQUA 3ITDA 3ROQA 2H1SA 1PQWA 5T64A 5L45A 2Y0DA 3RAJA 1E6WA 1DSSG 3OICA 4WKGA 4PLGA 4FFNA 4J9VA 3OQ1A 4U6SA 1VRWA 1DIGA 3KEQA 3I5MA 3KYCB 2E82A 5KOIA 1MB4A 3PQEA 1UR5A 4BO9A 2AQIA 2GASA 3RBXA 3PRJA 4EJ0A 2UUPA 2V6FA 3D0OA 3L07A 4DPLA 4J3FA 1AUPA 2GZ1A 2YJZA 3OA0A 4FPXA 5ADHA 4WCFB 3BHMA 5AQ1A 5JAZA 1A5ZA 1BRMA 4NK5A 4QECA 1JTVA 5EINA 5CG2A 3K8ZA 4ZVVA 4J49A 4HXYA 2NACA 1K2WA 2OP0A 4U0JA 2E48A 3S1LA 1DFGA 4G81A 5G4KB 3RVDA 2RCYA 2IYOA 4FIZA 5MGBA 2GZ2A 4IDCA 5BSFA 2Y1OA 4J7XA 3I6IA 1OAAA 1Q2XA 2B36A 3JD3A 4AL4A 4OQYA 2DLDA 4MO2A 2EW8A 3AU9A 2AEFA 2DPHA 4E2XA 3HB4X 1BVRA 4O63O 3G0OA 5A9TA 1F0YA 3KO8A 1GDHA 5AXDA 3OF2A 2YHUA 4WK6A 4E0BA 2IYPA 3DZJA 5L53A 1HT0A 3AY6A 3WGTA 4BO8A 2FOIA 2P68A 1EE9A 1C0IA 3AOGA 3FNFA 2Y93A 3UH1A 1DDOA 1G1AA 2OORA 5JSFA 2J8ZA 4J1SA 1I3KA 4YB8A 5JS6A 5GMOA 3QWFA 4D41A 1F8GA 1KEVA 4YRAA 4A73A 1ULSA 2DTEA 2NVUA 3S2IA 1HE5A 5U1PA 3V8BA 4E5YA 4IDEA 2UAGA 4OL9A 4W6ZA 1B2LA 2C59A 5CPFA 3BA1A 4BL5A 1ZK1A 1XEAA 1NFRA 5B4UA 3NKLA 1FDUA 3RD5A 2Q49A 4RF5A 1ZMOA 1OI7A 4JIGA 4E5NA 3E03A 1E0DA 4CMEC 4KUHA 4G65A 2JFGA 2VUTA 1EK5A 3BIOA 3Q9NA 2H5LA 4HNGA 2Z95A 4RORA 4TQGA 5JFOA 1HDZA 2NM0A 4FN4A 4W4TA 4EDFA 3IKTA 3CINA 4O59O 3ONHA 3AU8A 4OOEA 4RDHA 5MDHA 3OBBA 2BGLA 4J6FA 4QO7A 3I9MA 3V5NA 4L75A 1SC6A 2B5WA 5DN9A 1ZNQO 1E92A 1ZSNA 5AXAA 1ADBA 1DC4A 4CMIA 4PLPA 1A72A 2HQ1A 3H9GA 2V6GA 2Q45A 3RFXA 1P77A 4FFPA 3LZ6A 3QA9A 4HX5A 4PLVA 3WICA 1MFZA 2X5KO 3ZWBA 1XQ1A 3C1OA 2NU7A 4E2ZA 1B26A 1XELA 4DIOA 4FC7A 3ZW9A 2OZPA 3U5TA 1Z45A 1GUFA 4CM8B 4L76A 1E3IA 3ONEA 3GG9A 1UP7A 1VKNA 2A92A 2J6IA 3G49A 3HJAA 1HE3A 3VVBA 3ZNQA 3JYOA 1OOEA 3DBLB 2IDZA 2DFDA 3RBZA 4RV9A 4CM9A 3K5PA 1N9GA 3HN2A 1X7HA 2HJSA 2B0JA 2O2SA 4ZQGA 4CUKA 7ADHA 3TN7A 2W2LD 4UREA 4FQ8A 2YUTA 5TSDA 4LVUA 1IE3A 4PLFA 5FF9A 3HQ4O 2O3QA 2EEZA 5L7WA 2CFCA 2I6TA 4W9NC 4M87A 2HU2A 1YBAA 2Y99A 3COSA 3UUWA 2IZ1A 4ZGWA 4YT8A 3JSAA 4FJ1A 3AY3A 3K96A 4H7PA 5COQA 5TJ9A 4XYLA 3H9QA 1CRWG 4BNFA 4R3WA 1DLJA 1I30A 2VT3A 3UCFA 4L4RA 4EJ6A 4BOYA 4PRKA 1YOVA 1XG5A 4O1MA 2QQ5A 1WNTA 1P1HA 1JN0A 2X58A 2HK9A 3CXRA 1C1DB 4JXKA 2W2KA 4AJKA 4BIIA 1T4DA 4ZQFA 3IOYA 4CMAA 3N58A 1FK8A 2POQX 2DAPA 4NBRA 1K6IA 2FPGA 2ZCVA 3DAPA 3DL2A 4FB5A 2OP1A 2NNLD 4RLHA 1GD1O 2IRWA 2Y1DA 3WLEA 3RJ5A 1LA2A 4X54A 3WWYA 1B14A 3B1KA 5TF4A 3ZV6A 2B4RO 4ZRNA 4AJ2A 1ZXLA 3TF5A 4BNYA 1EK6A 2HK8A 3FR8A 4MIOA 2HUNA 1SB8A 4LN1A 4WLUA 4Y9DA 3DONA 2Q2QA 1LDNA 1VJ0A 1E3EA 3EZLA 3GVHA 5DBIA 3RC7A 1DIAA 5KNLA 4XX0A 5JAQA 4QX6A 5J23A 3B6ZA 4YBZA 2GYYA 2EP5A 1LDBA 1YBMA 3B1JA 1NQOA 3TZQA 4MP3A 3GK3A 5EQDA 3K9QO 3UOGA 4DQXA 1VJ1A 1LRLA 3A1NA 3DMTC 3GEDA 5F5NA 3PLNA 3IUSA 4BQRA 3BXXA 2RBEA 3U4CA 4Y6SA 2C7GA 1RYDA 3SC4A 2NQ8A 2CMDA 1O8CA 3GR6A 2WD8A 4BKOA 4DQUA 2HLPA 4MKRA 1D7OA 4DQVA 1LDMA 1U3UA 4PLZA 1GCOA 3C7CB 3OM9A 1K3TA 2X6TA 1TVEA 5HM8A 1ENOA 1PL8A 1E5QA 1UJMA 3AUUA 4OYRA 1WXDA 1IPEA 4NBTA 3L4BC 2EXXA 2C82A 1QYCA 4Q3BA 4R5HA 2HCTA 3FI9A 1U7HA 5DNAA 3CZMA 1HE4A 3WIEA 2VHWA 1HSOA 4CODB 1LBEA 1Y8QB 3AUSA 2FY8A 3K73O 1FXSA 2VNSA 3LYLA 3NJ4A 1H6AA 1WDKA 3GHHA 2O50A 1YJ8A 2RIRA 3NRCA 1P9LA 5U9CA 4J7UA 2FR0A 1CQJA 3MTJA 1ISJA 4K9DA 2CY0A 4XQ9A 3H8VA 1JU9A 4CM1A 1ZW1A 5THKA 1F17A 5T6BA 2X7HA 5A03A 5JAIA 2QW8A 4G2NA 1HF3A 1BXGA 5H81A 4RVFA 3DHEA 2O7SA 1LU9A 2QZ9A 4IDBA 4ONEA 5IN5A 3ZCXA 5BNFA 1SEVA 3WGOA 1LSSA 2WYVA 3F5SA 1LDGA 5IZ4A 1XCBA 4AICA 3DMTA 2WD7B 2W90A 4H15A 1PWZA 1SOWA 3NYWA 1M2WA 3HB5X 2G1UA 2CVOA 2IE0A 2DUUA 1IYZA 3VKVA 2EKLA 1CEQA 3JQ9A 3S55A 3VKUA 2EHDA 4TRJA 3GNTA 3HADA 1LQTA 4CMBA 4CR7A 4PLYA 5L40A 3R1IA 3LC2O 1GYRA 1R66A 4NMHA 3VH3A 1IY8A 2D8AA 9LDBA 4B3IA 5L4LA 3PP8A 3ICCA 1PQPA 2CF6A 2ZJ1A 2X9GA 3ZNNA 4ZICA 3WB9A 5IDXA 5A04A 3ZWOA 4IJVA 2F1KA 1Z7BA 9LDTA 3N74A 2VRBA 4PIVA 1HLPA 3H5NA 5U4QA 3BAZA 1RJWA 3WNQA 2VYND 1BXKA 1PJQA 2PD6A 5HWSA 3HDYA 3MCVA 1GFSA 3OIDA 3M2TA 1Q0QA 3MJSA 2YFHA 1JKJA 1H5QA 1T2CA 2XXBA 5ILOA 4RQTA 1UP4A 3ZWAA 3SXPA 5KCZA 2ZB7A 2AQHA 1I24A 5C7OO 1ADFA 1LXCA 3SJUA 3AFNA 4A27A 2DBQA 1ULUA 3JCZA 1JA9A 3BMQA 5JCXA 3A06A 1PGNA 5KKCA 2GLXA 3AFMA 3GZNB 1QR6A 5JCJD 4JP2A 1SB9A 4YA6A 5KJ1A 3DAGA 2QX7A 3JQ6A 4ZQBA 1LDEA 1L1FA 3IQDB 5TQVA 3CSDA 2AQKA 3DBRA 3CKYA 3RC1A 3ZU2A 2HAEA 1FDWA 1KY5A 3PHLA 1Y1PA 4BV8A 2JHFA 2Q46A 5AXBA 1C0PA 4FFRA 1IL0A 3WLFA 2HMVA 5K6AC 1EUZA 3GC6A 2DQ4A 5C5IA 1ISIA 3BTVA 5TGDA 4A2CA 2AXQA 1KVQA 4BO7A 1R4MB 4XB2A 4M54A 2P4HX 2BKAA 2E49A 4IINA 3OQBA 3KETA 4FSHA 3AJRA 4XWYA 2X0RA 3V1YA 2DTDA 3TSCA 5TLSA 3X2FA 5B1YA 4FR5A 4YT5A 1R0KA 4K26A 4GL4A 4N5LA 5DDIP 4Z0HO 3DTTA 2FPPA 4IQGA 2P9GA 3KEOA 3ZNPA 1Q7GA 4OKNA 2Q2VA 4IY1A 4EI2A 3OEYA 1T2AA 3F9IA 5T8KC 3WIDA 1DLIA 3GVCA 1RWBA 2X23A 1DRUA 3GOHA 4FJ0A 1Y9AA 4TVBA 3TZ6A 4YR9A 1B8VA 4WOKA 5DT9A 4BNTA 1QYDA 1EVZA 5I7SA 5F3RA 4LSMA 3C1TA 3NGXA 1XSEA 2JHGA 3PJDA 1FJHA 4J9UE 3KM0A 1OMOA 4D3SA 4CLDA 4ZQHA 4ZJUA 1EDZA 1PU2A 2HRZA 1V8BA 1Q0LA 4RPLA 2QIOA 3E5RA 4N54A 5A02A 4QT0A 2O3TA 3JQCA 3WQSB 4QUKA 5A9RA 1J0XO 4UUMA 3TL3A 4EBFA 1PGOA 4DC1A 5CEJA 3SVTA 2X5OA 3VZSA 3R0IA 4K1LA 1KC1A 1YXMA 1LLQA 3VAZA 2D59A 1YJQA 5JY1A 4GKBA 1T24A 2I76A 2FSSA 3GUYA 2VZ8A 1KOLA 3GHYA 3PHIA 4DREA 1WMAA 1BG6A 3WXBA 1PZFA 4CMCA 3PWKA 1GQQA 4UEKA 4CM7A 1UH5A 2YFQA 3RFVA 4JN6B 4FOOA 4WPGA 1TEHA 3WOHA 4EEZA 4CMGA 3JQGA 2ET6A 1HETA 5FYDA 3QVTA 4EW6A 1ID1A 4J4HA 4BO5A 4M8SA 1AE1A 1UDCA 2WTBA 1TT5B 3BMCB 1ORRA 4WGGA 4WASA 1T2EA 4OJNA 1ZBQA 4RZIA 2J3JA 5L4SA 3VH2A 3OQ6A 4XRRA 2EJWA 4D3DA 3H3JA 4GX2A 1P33A 2PD4A 1DBVO 1R0SA 4OXNA 4R1UA 3RKRA 3FN1A 4F6LA 3MEQA 5IF3A 3BYZA 4IQ8A 3VVCA 3OA2A 4GLLA 3DDNA 3ULKA 3VTZA 1I01A 3I23A 4EUFA 1DAPA 1JQBA 1IZ9A 1J49A 3IJPA 3QVWA 3UW3A 1LSJA 4NDNE 4YT4A 1LUAA 1K6JA 3O38A 3ORFA 5CP8A 1VL6A 2C7VA 3ITKA 1L7DA 5DCUA 3GVPA 3KOUA 5FWNA 3HFSA 2VN8A 3PHGA 3H2SA 1F14A 3O8QB 3U4IA 4JX8A 4R51A 4KUGA 3ZH2A 2BELA 1ZSVA 4MKXA 2O7QA 2BGKA 4WOJA 3E9NA 3GT0A 4A03A 3RCBA 1HDGO 3ZWVA 2ZKLA 4PG4A 3RU9A 2EKPA 2HMTA 4YCAA 4QTZA 3WFJA 4D79A 4BNLA 4E5MA 2JCXA 1ISHA 4NNJA 4NHEA 1OFGA 4CQMB 1ZJZA 2Y05A 3JV7A 5K0ZA 4CR8A 2PFGA 5DOVA 2EG9A 3KLMX 1NM5A 3PWZA 3GRPA 3K6JA 2BFAA 1JAXA 2AG5A 5A9SB 3PYLA 3BMNA 3ABIA 2R00C 1KVUA 3JYLA 1NVTA 2FR1A 1HYEA 3D3WA 1DHTA 3QRWA 6ADHA 1LX6A 2QHXA 2VRCD 1HLDA 1LSOA 1M76A 1PSDA 4YQZA 3I4CA 3VH4A 4IQ0A 4B79A 4AFNA 2O23A 4PN3A 1SNYA 4E2YA 3TOXA 4J2HA 5KWEA 1Q0HA 5TNXA 4OH1A 5HS4A 2QG4A 2C5AA 2P5YA 3RU7A 1C0LA 3INTA 4OHUA 2WWRA 2ZQZA 4DUPA 3GRKA 1I10A 1QV6A 4HWKA 4Y6PA 1DFIA 1GQYA 2HMSA 2PH5A 3G1TA 3QIVA 1B15A 1VSVA 1Z82A 1QYVA 5KJEA 2NVWA 1E7QA 1WZEA 3RBVA 3TZKA 4OXYA 4GI2A 1LNQA 3ZN2A 2W8ZA 4O5OA 2VUUA 3TQHA 5JC8A 3WFIA 1QLJA 2EW2A 3KYDA 4WCDA 3RKUA 4RZHA 1A9ZA 1G6KA 4Z3DA 2B69A 4XYEA 1GV1A 4WCFA 2C20A 4XGIA 3PYXA 8ADHA 2BI7A 1QKIA 4HFMA 2HO5A 4D7AA 1K5HA 3PEFA 2YHIB 3SC6A 4Z0PA 4Z3KA 3VPFA 4IGFA 2DU8A 2G76A 3IIEA 1BDMA 3ZGYA 5THQA 5G4KA 5BNIA 4ITUA 4BKQA 4P4NA 4E12A 3JQBA 3P2YA 3ICPA 3F1KA 3S8MA 1U8FO 4CLRB 2YDXA 4P22A 4W82A 2FZEA 2VHXA 3L9XA 2BFPA 2AW5A 4XYMA 1PJCA 4NG5A 2J5KA 2AE1A 1M67A 2NTNA 4FOSA 1J4AA 4J4BA 3ETDA 4K6FA 3OJOA 2NUAA 1CETA 4IXWA 3DZBA 1T4BA 2LDXA 5JY6A 4DGSA 1VPDA 2Y0CA 5A05A 1ONPA 5EJ2A 4OMUA 4PZCA 1AHHA 1SO8A 2FRDA 4IBOA 3BTOA 1I8TA 3HWRA 4PG8A 4QFCA 4YAGA 1QP8A 3V1UA 8LDHA 4KOAA 1NPDA 5B4VA 4IMPA 1MLDA 3EW7A 2FPIA 3QE3A 3ZZNA 3IP3A 4MVJH 4WEQA 5I7VA 2VYVA 3WBBA 4Q3CA 4E4YA 3H9JA 3EDMA 3ETEA 3RFTA 4GX1A 5T67A 1RM0A 2SCUA 3M1AA 4PG6A 4CQLA 1Z75A 3RIHA 1E6UA 2ZYAA 4JK3A 4QSMA 1EFLA 3NX4A 3UHAA 4BKUA 4L4SA 5BNTA 1F8FA 4CLOB 5T5QA 4RJTA 3VDRA 4FD3A 3INGA 3GGPA 1WVGA 1XLTA 1Y6JA 4HKTA 3NEPX 4Q3NA 5KIAA 4GPD1 3BTUA 4GMFA 2CDBA 1XIVA 1GPDG 1W73A 1MX3A 2FMUA 5TT1A 3ROMA 3VZPA 4RVHA 2B4QA 4WNCA 2PX9A 3C1AA 2VOEA 2NADA 2ZTVA 4DXHA 3Q3CA 4E5PA 2BI8A 3LT1A 4BGUA 3SLGA 1EVIA 3QVSA 3G79A 1DB3A 1F12A 2WJPA 4ALKA 2VHYA 1E1NA 4OSOA 2I65A 3LLVA 1H2HA 4R4JA 1NAIA 5JYDA 4MVJM 5JNLA 1ZEMA 3HZZA 4LMPA 4J90A 2VHZA 1J6UA 3D7LA 4NR0A 5HS6A 3B70A 3FWNA 2NWQA 4CM8A 4CQMD 4I1IA 1GYQA 4LSWA 1Y5MA 5A3JA 3DBLA 3I3OA 3ANNA 5LC1A 4AJEA 2PA3A 2P91A 3MJ4A 2X5JO 3GA0A 4KZPA 4TRNA 1C0KA 4NFYA 3ZHXA 2Y1FA 3TRIA 4JJFA 4I5GA 3ZU3A 1DJQA 3F47A 4N7RA 5K9ZA 5LCXA 3PTZA 4E33A 5EL0A 1DC5A 1MG5A 3MWDB 1DAOA 2BFMA 4NU5A 2EIHA 2I67A 3WGZA 1CDOA 3D4OA 4RCVA 3AW9A 4DYVA 1Q1NA 3AM5A 4G5HA 4BKPA 4ND4A 4BGVA 4I5DA 4M1QA 1PZHA 2D3TA 3F6YA 5L95A 5L51A 4K28A 1HSZA 1WAMA 4FGWA 4CMHA 3F1LA 4MIEA 3PHJA 3NDJA 2EJVA 2Y1EA 2ZIZA 3MTGA 1DIRA 2IXAA 2JAPA 2YW9A 2QRLA 3FD8A 3T7EA 4IDFA 5C3MA 4CMEA 3PK0A 2JFFA 4I9NA 4Z6KA 1NXQA 4IDDA 5JCJA 4A10A 3WYBA 4XGKA 2PKRA 3VZQA 4IUYA 3QV1A 4KWIA 2VOJA 3WGIA 4TZKA 1UUFA 2F00A 1C1DA 1VSUA 1BW9B 2DFVA 4RO0A 1GYPA 1QORA 3V2GA 1ENPA 1T2DA 4WE3A 5JE8A 1U9JA 1D8AA 3CIFA 3OHSX 4Z9YA 4BO0A 4CMIB 4EGFA 1XHLA 1YB5A 4ZA2A 4JBHA 3GNSA 4YQYA 5JMWA 3GAFA 4C7KA 2OHXA 3BZUA 3ENNA 4OM8A 5FI3A 1V0JA 3JTMA 3ZI0A 5H82A 4A0SA 4CUZA 4GVLA 3VTFA 3I9LA 3P7MA 4F46A 2E4AA 2JJYA 3DZHA 3WSVA 5IXYA 3I1JA 3B1FA 3ZWXA 3GY0A 3TL2A 2OMEA 4IJWA 1Y8RA 2NVBA 3I9OA 4BGEA 3ANLA 4F45A 3WJAA 1N9GB 1SPXA 1L7EA 1BHSA 1O9BA 3IJRA 2ZB8A 3GN2A 2X4GA 2VZ0A 3ETGA 4INAA 1P1JA 3WYEA 2X1HA 4BNMA 4BNHA 5JC1A 4CR6A 1DC3A 1ZEJA 4J43A 1OC2A 1FF9A 1VE9A 3GH3A 4LCEA 1GQ2A 3KXDA 3OFSA 3DBHA 1X1TA 4IXTA 3VHRA 2I66A 4HUJA 4KMSA 4W9NA 3TJRA 3HN7A 4NH4A 4AJIA 4FJ2A 5A4DA 4B8ZA 3SBOA 3T7CA 3VPXA 3GEGA 2AEJA 3JQ8A 3F5QA 3K30A 3RUAA 3WS7A 5BSHA 4E2WA 1DEHA 2RH8A 1DC6A 4BNVA 1PJ2A 2O4UX 3HDHA 4FFLA 4GVXA 4YAJA 2B4TO 1YOVB 2BF7A 4YJGA 5B37A 1EMDA 4CM4B 4JCOA 5G0TA 2RH4A 5TC4A 2O3JA 1Y81A 2PGJA 3KYBA 3FNGA 2W2KB 3LF2A 3INRA 3DZGA 3IP1A 3U0BA 3D3EA 1DXYA 6LDHA 1K89A 1NYTA 2P9CA 3MJTA 4W7HA 1ISFA 1BXZA 4DL9A 3HDQA 4E21A 5GZ1A 5JPIA 3L0DA 4F3YA 4UVIA 3BTSA 3S2FA 3VOSA 3LT2A 5DBGA 1KS9A 5A1TA 4PZDA 1UP6A 1JKIA 4BS9A 1ONOA 4XJSA 4JQCA 1SEPA 4RVUA 4NK4A 1H0KA 3AY7A 3S2GA 1E3JA 3MJCA 2EERA 1PR3A 2IZZA 3E9MA 5CDTA 4TKMA 4CM3A 2CUKA 4XQCA 1WPQA 4Y98A 1QG6A 1P31A 4OXKA 4DLAA 2QZZA 2ILTA 2WD7A 1E7RA 2BRUA 4B4OA 4MVJF 2UVDA 2AG8A 3EY4A 2YY7A 3ZV4A 4BKRA 4IM7A 2UDPA 3T4EA 4GAEA 2QRKA 3DEYX 1QRRA 4DC0A 3RUEA 1VM6A 1XQ6A 4R16A 2G17A 3M6IA 3OJLA 4FFOA 4QEDA 3DFZA 4Q3EA 3KBOA 3R6DA 5CDGA 1BMDA 3AI3A 3BMOB 1PGJA 2OBYA 5I7EA 1V3VA 2XOXA 3GMDA 4D46A 1R4NA 1I2BA 4J4TA 1NVMB 4DRYA 1KEPA 3RI3A 3L6DA 1JDJA 5EQFA 3W6ZA 4CL3A 2FR8A 4Z9XA 4AJ1A 2BD0A 4L8VA 1H6DA 1PL7A 3QP9A 2JD2A 1DIBA 1H6CA 3L4SO 2GN9A 3WQRA 3GGGA 4BO1A 2TMDA 1KVSA 5LDGA 3H7AA 1GZ4A 3NV9A 3LVFO 3D5QA 2VZ9A 1JLLA 3TZCA 2X9NA 5CEEA 3PIIA 3GDOA 1TXGA 5AYVA 1E3WB 3ADOA 3F3SA 5TRTA 5G0VA 2C2YA 2B83A 3E6AA 3ADPA 4OGWA 1E5LA 1WLYA 1YE3A 1U4SA 3H5RA 3ZHBA 4BNGA 4F6CA 2EV9A 1HTBA 3WTBA 1ZCJA 1BWSA 2GRAA 3KB6A 1E7MA 3L4BA 3CPSA 3G1UA 4TZTA 3AOEC 1HRDA 3TZHA 2O3RA 4YPOA 2JCYA 4R9RA 1A7AA 3GZNA 3NGLA 2NLOA 2XAAA 4DMMA 3ZW8A 4RL6A 1SMKA 3QWBA 4II2A 4IZIA 3H9UA 2PH3A 3JQAB 2OGUA 4EEXA 1CWUA 2GD1O 3DZIA 3EGOA 4BO3A 2B35A 2FHSA 2A94A 3R3SA 4KDEA 1H2BA 3UXYA 1AGNA 2O3SA 1JKFA 2WYUA 1YWGO 2PLAA 4HY3A 4NJOA 1QXSA 3UCEA 2I5PO 2VRCA 4HBGA 5I8ZA 4EUHA 1U4OA 4IJUA 2PZMA 2EF1A 1EFKA 1HEUA 1MFPA 3SLKA 1R4MA 4PLTA 5F21A 1X7GA 5IN4A 1U3TA 4MVJE 2NU9A 1JWAB 3CZRA 4JLWA 4DA9A 3ROPA 1EBUA 1YGYA 2FN7A 4DLLA 1VI2A 2ZJ0A 4WLNA 3OJ0A 5KJCA 1WDLA 3H5AA 1KVTA 3PWSA 3QVOA 5CDYA 2D5AA 4CM9D 4OOFA 1Z7EA 5JO0A 1EZ4A 1T26A 1I2CA 2Q99A 1G0NA 1C3VA 3HG7A 3L9WA 5C37A 1CQIA 2HMWA 4JGBA 4RVGA 3H65A 3ZWCA 3A4VA 1YL5A 2NQTA 3LDHA 4XIJA 3WG9A 4FBGA 4B3HA 5KVQA 4ESOA 1UZLA 4Z0TA 3DTYA 4LGVA 5ENDA 1W0CA 4FW8A 1IULA 1MV8A 4NPCA 1GV0A 2J3HA 3K31A 3MJVA 4YWJA 1FDSA 1P3DA 3RC2A 4GBJA 2DVMA 4JJIA 1PJSA 3X2EA 4NQZA 2A9FA 4AJOA 5HRUA 4TROA 1PQUA 5DP2A 1HYGA 3D4PA 3BMQB 3ST7A 4YRDA 4CLEA 1WW8A 1UXKA 3IL2A 1D1TA 1ZFNA 2VTDA 3HHPA 2ZTLA 4MVJD 1P0CA 3AWDA 4GWGA 2PGLA 5DBFA 3DBRB 3GUCA 4A7PA 2EKQA 3LSYA 4J0EA 2XXJA 3FWZA 3ZNOA 4DVJA 1EVJA 4PFJA 5B4TA 1KEWA 4P38A 4PZEA 2CD9A 4XJTA 1PJ4A 1MUUA 3NT5A 5K6AA 4AVYA 1UZNA 2CDCA 4GX0A 3W4JA 5FEUA 4WJZA 3BMCA 3DXFA 4NBVA 3WMXA 4B8WA 1XA0A 4J7CA 3ONFA 5TX7A 3GAZA 4Q39A 4MVJI 1NPYA 4YAKA 2OUIA 2ZCUA 1EVYA 3KSZO 3DB2A 1DJNA 1UAGA 1PWXA 5KTKA 2P2SA 1P1IA 1UXIA 1M66A 5DULA 4NU6A 1YL7A 2B37A 5GZ3A 3NTRA 4YXFA 4Y67A 2Z5LA 3QW2A 3P5SA 3PXXA 5L4NA 1R16A 4IGEA 1ADCA 5T8KA 4H16A 4PVCA 5DF1A 3D4NA 4K6CA 1F06A 2Y0EA 3B20A 3ON5A 4TRMA 3C7AA 2D5CA 5EIOA 3PJFA 3E18A 4JBIA 3NDRA 4L73A 2OOSA 1UXJA 1U28A 4OO3A 4RDIA 3FPLA 2RAFA 3E5MA 4WUVA 1B7GO 4WLEA 3OMLA 3UFXA 1NP3A 5BR7A 1UDAA 4I9UA 3O8QA 1DIHA 2Q1WA 2GCGA 1J5PA 3CMMA 4FFMA 2GF2A 1TI7A 3CTMA 3GF4A 3NUGA 3I9JA 5A3VA 3H2ZA 3DWFA 2X0JA 1ZKMA 3DO5A 3KTDA 2VWPA 2DTXA 5CDSA 4EZBA 1NPTO 5IDQA 3WGQA 4HFRA 3LF1A 1LLDA 5A5EA 5JBIA 1UDBA 3IAHA 4HNHA 1I3LA 4U6QA 1YVEI 2CSUA 2GN8A 4D3FA 3KVOA 3OIGA 3FPCA 1R37A 3GZ4A 3OH8A 2PV7A 3PJGA 5ER6A 4I5EA 5G0UA 3JQGB 4CMJA 4UUPA 1JWBB 2QYTA 3AUTA 3CE6A 1LC3A 3ONDA 4GGOA 2IODA 4E32A 3JQAD 4J2OA 1HZZA 1X0VA 4W99A 5GZ6A 2EWMA 2NTVA 2PR2A 4E6PA 4FGSA 2PZKA 3KV3O 3M2PA 4YJHA 1U1IA 4CL8A 4UVHA 1FDTA 1IPFA 1VKOA 4Z9FA 1DFHA 4R3NA 3VH1A 1GUZA 2HMUA 3W4IA 2CNBA 1PS8A 1Q7BA 1GTMA 4NJMA 4XDYA 2GDZA 3GNQA 1DPGA 4D0RA 4MDHA 1E7SA 2Q3EA 1MXHA 4R5MA 1JW9B 4ALNA 1NHWA 4W5VB 1V6AA 3TPCA 1H94A 3FN4A 4RPKA 1XU9A 5IDWA 3WX0A 1E1LA 3IDSA 2DC1A 4ROSA 1P1FA 5CAEA 2X0NA 1LSUA 1WP4A 4IS2A 3PFFA 4R1NA 1X7DA 1H6BA 4U5QA 3EC7A 4UULA 2O2YA 3JQFC 2W2LA 3LC1O 3JYNA 4E30A 1I32A 1E3SA 1XWFA 3F4BA 4ALIA 3RUIA 4L4XA 3SEFA 2WE8A 3V2UA 4LW8A 1GEGA 3JD1A 2FSVA 1XU7A 3LT4A 5HA5A 5A5FA 3RUFA 1HDOA 2OO5A 1LLCA 3HUDA 3UCXA 4KQXA 4QO8A 5FFFA 1K0UA 1OC4A 1EBFA 5DOZA 3PDJA 3QHAA 4XEHA 3RQSA 2D2IA 1T1RA 3SJ7A 2AA3A 4EUEA 5F1PA 3KYCA 5I9MA 1NWCA 3OJFA 5IFLA 2XF8A 3W8DA 1WMBA 4RF4A 1M75A 5L9AA 1VLLA 4TRRA 2PD3A 4XQEA 3STHA 2D0IA 4LK3A 4YJFB 4TMFA 1BSVA 1LTHR 2Q50A 2JFHA 1ARZA 1LJ8A 1ZUD1 1RM5A 4J91A 3ZHZA 4XCVA 3FF4A 1HDYA 3BMNB 2H63A 1EE2A 4TWRA 4P4LA 2BLLA 1GAEO 1E77A 3UN1A 1I3NA 3MWEB 3LU1A 1IHYA 2Z1NA 5F1OA 1C1XB 3EAGA 2R00A 2V7PA 4L9RA 1XYGA 4I8XA 5TJHA 1CYDA 3A28A 3D64A 2HRBA 4IPTA 3PQDA 2CZCA 2V6MA 4ALJA 5ER9A 3AM4A 3C85A 3UICA 1Y8XB 4RF2A 1YB4A 4BO6A 1I33A 2G82A 2BHLA 7MDHA 1D1SA 1U8XX 5G0SA 1R12A 4TSKA 1YQXA 1ENZA 1FMCA 1O6ZA 3EK2A 1NQ5A 3GMSA 3U4HA 4E31A 3TFQA 4EJMA 5CPBA 1EUDA 1YQGA 1P45A 2D4AA 2X8LA 3PZBA 3UVEA 2PY6A 1WDMA 3I9NA 1PS0A 1GPJA 4DPMA 3FBGA 4CLOA 2Q4EA 4LVCA 4ZQEA 5F5LA 3KYDB 1PJ3A 4B4WA 3C3XA 4YDRA 1I36A 2PKQP 3JQ7B 3PLRA 2WDZA 4JJGA 4NBWA 3GVXA 5JAMA 4GH5A 5JXWA 5B12A 3JQEA 5ENVA 4A5OA 1N2SA 1R15A 3DC2A 1O0SA 1KY4A 1AN9A 5JDCC 3WWZA 3QY9A 4UUNA 2W4QA 2Y1GA 5DCWA 5BSEA 4XDZA 3LQFA 3NTQA 2GN4A 4PG7A 3DZFA 2A35A 3CEAA 2UV8A 2VUSA 3E82A 4JROA 5KJ6A 2ZB3A 1KYQA 4ZRMA 1A71A 4KUEA 3IUPA 4W7IA 4MVJP 2GGSA 4CM6A 2P5UA 3GPDG 3PGXA 1NX6A 4YACA 1U2DA 4ZN6A 1HWYA 3ENKA 4PLHA 1Q7CA 3O26A 1T25A 1M6WA 1B16A 5FQ2B 3ZWPA 4D45A 1NFFA 4BGIA 1IZ0A 1PJLA 4JNKA 3PFWO 3ZWWA 1Y7TA 4Y8VA 3WMWA 4CV2A 1Z73A 5JDIC 3CMCO 3L6EA 5IZCC 3DOCA 3H4VA 3RASA 4GX5A 1E7WA 1PS9A 1XGKA 2JKVA 4GGPA 3PIDA 4BB5A 5KJFA 1WZIA 3BHIA 1V3UA 2HK7A 1H9AA 3OP4A 4J1NA 3ZV5A 4AG3A 2CDAA 2Y68A 3GGOA 4H3VA 4ND1A 1ZO8A 4UAGA 4B7CA 4UVDA 4AJHA 4NBUA 1DOHA 3KZVA 3Q2KA 1T2FA 4CQLB 5JDCA 4N5MA 3GVIA 3OEWA 4AJJA 4UUOA 2Q1SA 3EVNA 1JAYA 1VC2A 2JAHA 1YO6A 4M55A 1CJCA 3PYMA 2AQ8A 1LRKA 3FR7A 4MKZA 1Y9EA 2ZYGA 3NT2A 3EZYA 4HADA 5KVCA 2X9VA 1X13A 3DOJA 1NAHA 1MC4A 2YV2A 3QWIA 1TLTA 5CFZA 2AMFA 2NVUB 2VYNA 3D5TA 1U3VA 5EESA 2P9EA 4YT2A 1Y5RA 1O95A 2YZ7A 1BW9A 1JVBA 3W8EA 4CV0A 3H3FA 4XKJA 1BVUA 3P2OA 4BHTA 1QV7A 2BMAA 4DPKA 4JBGA 4YYZA 4QXMA 4BQPA 1YRLA 3UF0A 1YQDA 3QQPA 1ZK2A 1N7GA 1KC3A 5JDIA 1GU7A 4ND5A 5HTOA 1SZJG 2GPTA 5IZCA 1O89A 3GFGA 3NDIA 1DHRA 1VJTA 1LDYA 4NIMA 1S6YA 1HE2A 1E1KA 3WGHA 1GUYA 3RSHA 3PGJA 1NBOA 1GCUA 2WE7A 4XQGA 1NASA 5ES3A 4R54A 5JW6A 4U8GA 5L7TA 4XD2A 5BT9A 2ZB4A 3IC5A 4PLWA 3EHEA 1NR7A 4GSLA 3FSRA 1B8UA 3EYWA 1TT7A 1ZVMA 5JMPA 1A27A 1A4UA 1NHGA 1SAYA 1IOLA 3VC7A 5TT0A 4TKLA 5I7FA 1Z74A 5BQFA 1W6UA 2NU6A 2OFPA 2BGMA 5ITWA 2DT5A 2Q1UA 1I5RA 3K2BA 3OIFA 3IS3A 4GQAA 2D1YA 2P4QA 1SBYA 3GDGA 3Q0EA 2WM3A 4PLCA 2LQ7A 3FTNA 4XYGA 3V1TC 4LRSB 4Q9NA 1ZSYA 4O0LA 3WBFA 4NFHA 3O9ZA 2W98A 1ISMA 2QRJA 3JYQA 2DUWA 1QYWA 4ND2A 2XPCA 1YB1A 4BNUA 1O94A 4II3A 3HFGA 1EDOA 3PQFA 4QQRA 3OETA 3TFOA 2O3UA 4GMGA 3KLPX 1E6EA 2ZYDA 2NSDA 4WLOA 2E37A 1XR3A 4RPJA 5C7LO 5JYEA 1IB6A 3ZDFA 4CM4A 3D1LA 1I3MA 4BMSA 3RUDA 4MVJA 4AJNA 4HV4A 2VT2A 1IUKA 2WMDA 3ONGA 4CM5A 3WNVA 3C8MA 2O4CA 4P4GA 5EMHA 3F46A 2DBVO 2JD1A 3KHUA 4Y6RA 4B7XA 2GN6A 2C5EA 2WEKA 1HDCA 4BNJA 3GG2A 5T57A 2HDHA 2Q4BA 4XR4A 3A9WA 3GN1A 4XA8A 4GSKA 4BNKA 2Q2WA 4XIYA 3ZWYA 3GEMA 2WSBA 3U4DA 2UUOA 4YJDA 4BO4A 4M89A 4Q3DA 3ASUA 3HE3A 5GY7A 3UGKA 2Y67A 1GL3A 1KVRA 4OKIA 3FTPA 3DAFA 3EVTA 1S7CA 1Y8QA 1DRWA 3AK4A 1ZK3A 3AI2A 1RM3A 1Y8RB 3E9QA 3ZHYA 2G0TA 1NQAO 1B0AA 5IG2A 1ENYA 4WECA 2PTGA 4R41A 1X14A 4RGBA 3VPSA 1U3WA 4J1TA 4B7UA 1VL8A 4IDGA 3WYCA 1TB4A 5C7IO 3BMOA 4NZ9A 4XRGA 3EUWA 1GEEA 1BTOA 2Y1CA 3K2EA 1T1SA 1A4IA 3Q1LA 1H9BA 3GLQA 4RQUA 5L3ZA 3DBHB 3OSUA 3MJEA 4IIUA 1MC5A 5G0WA 3QJ5A 3AM3A 2VQ3A 3DZKA 3JQ9C 3VPGA 2FWMX 3WDSA 1GY8A 2IEBA 1GADO 1N1EA 2QYSA 2VYVD 4I9HA 1ML3A 4PCVA 4J1QA 5CEFA 1N5DA 4U0KA 3JQ8B 4HFJA 1ZMTA 1E3WA 3GPIA 4WLFA 4D43A 1KETA 2BFOA 3DHNA 3TWOA 4QFDA 2PWZA 1MP0A 4BNXA 5L7YA 4YJGB 1ADGA 5AOVA 4BNZA 4M86A 1PGPA 3WGGA 1HZJA 1V9LA 4S3MA 3RWBA 4TVOA 1E1MA 2C54A 4OQZA 5BSGA 4KQWA 5COBA 2YQ4A 5A06A 1CERA 1SOVA 3Q2IA 4OSPA 2C2XA 1TA4A 4FCCA 4CV3A 3KRTA 4CUJA 5IDYA 3FBTA 4MJLA 3JQAA 2JL1A 1PJTA 2PZLA 5JO9A 4CJXA 1ISGA 2H9IA 4IZHA 1AXEA 1YONA 3E48A 1P0FA 3JYPA 1UZMA
chains in the Genus database with same CATH superfamily
3LUGA 4RNCA 1G16A 3GV0A 1UQUA 1E9FA 3IPRA 4BFCA 2XPWA 3A3NA 3GLHE 4I6EA 3DOOA 3M1LA 2C4WA 4EPXA 1H9CA 3UKDA 1NYQA 2FF4A 2ASEA 3E8XA 2XYQA 2VATA 3A11A 1E61A 5IDVA 3BPSA 4UNQA 4NDLA 1RYNA 2GH1A 3TOZA 1PLKA 2HOEA 4YJ2B 3IVRA 3QAHA 1AQNA 3MBKA 2BZGA 1Z0KA 3MA0A 5DSZA 5GONF 2X0LA 3JAKB 3QTLA 1IEXA 1IN8A 1MB0A 1QUEA 1NTOA 3KEMA 5BNWA 4INOA 4WNIA 4QRHA 1EUQA 1EZ1A 1WWKA 4TKUA 1JMVA 4WEOA 4KBFA 1DE0A 1NT4A 2O54A 1XVLA 1USGA 1L5VA 4JXZA 5SYMA 4C0WA 3EA4A 4KP7A 5DFAA 1U5TA 4IGKA 4OAQA 1OH6A 1P9WA 1R8JA 2RQPA 3FCOA 3QLJA 4RIGA 4HEA6 4QDJA 1KK0A 1EQ2A 1OD6A 4MA5A 4HW0A 5DCYA 2K2WA 4R01A 4N6NA 1L5SA 1WQ3A 3USZA 4C3UA 4KN5A 2B1JA 4IOJA 2MH2A 4GKVA 4B3RB 3WYNA 1V1RA 1DVRA 2A5LA 3OCZA 1VB5A 4P32A 1YVUA 1SWVA 5A0VA 4IJKA 3ZYZA 4GYYA 3GQVA 1JJFA 3PR3A 3U4AA 3IOBA 3OOYA 2HNHA 1V7CA 4XGNA 1N2GA 4LISA 4DIFA 3FVWA 1AMOA 2V6CA 5LIPA 1XXHA 2HWXA 1KK1A 4XSGA 5CR9A 2HEOA 1Q0ZA 5FWXB 2H6CA 4ZDKA 2EQRA 3JWHA 4KX3A 1JVSA 1GXPA 5I8WA 5JG7A 4PGFA 2QN3A 1FA9A 3PDUA 1V8DA 2ZRLA 4HQ6A 3RREA 4B3FX 1RCTE 1LFPA 1C3OB 3ZDXB 2X0IA 1YMUA 2XODA 4D6XA 3Q2OA 2W70A 1QDUA 4EZIA 1K68A 1ZH5A 4JDUA 4YRFA 1OR7A 1TEVA 2FOLA 4BH9A 2BAGA 1JAHA 5CNIA 4HF7A 2EYQA 5LQDA 4KL8S 3C6BA 4CZ2A 3NHJA 4OBEA 3RGGA 1ZK8A 4GMXA 5CRIA 1A9YA 3SICE 5ARCA 4ALMA 1FFGA 4TUYA 4N9QA 2E36A 4XYBA 2FUCA 1ECPA 5EKSA 1O3QA 3WLMA 1FXWF 1DU0A 2K9MA 3I52A 6AT1A 3CUYA 1JGTA 3IOCA 2WYWA 5B3JA 5IAJA 3HUGA 1UF9A 1P2BA 2G40A 3RJ9A 1Z6YA 3QMWA 3ITDA 2ZI6A 2WMOB 1YULA 4C78A 3QW4B 1COWA 4ODIA 3BE4A 4RA6B 5KOIA 5GOTA 5BR8B 2V6FA 3PC8C 3OA0A 3IX7A 5JAZA 2FV8A 2IVMA 5CFNA 1EDEA 2WHYA 3O5AA 3S8PA 5K45A 2BHYA 1MVLA 1RFLA 1RXVA 4CWAA 3AU9A 2JHPA 4GQIA 1ZGCA 3O4FA 3MLEA 3QXCA 2FOIA 4F04A 4HDMA 1XMJA 4DMFA 3K1TA 1I3KA 3T7KA 3K4PA 4EA7A 3DDSA 4UOEA 2XYHA 2FRXA 3JR9A 1B2LA 2F5EA 4IOKA 1ODSA 1FDUA 4CMEC 1UB9A 3R24A 3SBXA 4H35A 5AKKA 4DLPA 3PX3A 3HK2A 1NJ8A 4LF4B 2AZ4A 1P9NA 2CVPA 1T4CB 2HSWA 1ZZGA 2XF6A 5AKGA 5C1PA 3ZWBA 1XQ1A 3SXJA 4LQLA 1BS1A 4AURA 5DHRA 2ZIXA 2J6IA 2W9XA 2QX9A 2HTEA 1QGYA 1AHDP 2ZBFA 3RBZA 1DAMA 2O2SA 4ZTZB 3HQ4O 2O3QA 2EEZA 5L7WA 1T5SA 4FR0A 3IEVA 4ZQIA 2YL2A 1ZVQA 3UUWA 2E5LB 1QVWA 4EAAA 4EPVA 2AFIB 5EJ4A 1ZMBA 4L4RA 3UWMA 4IHKA 2HY7A 5BSKA 3T0YA 1KQ3A 4BIIA 5C3EJ 4ZQFA 3WK4A 4X3CA 1V26A 5HS8A 3G2KA 4KN9S 4KSYA 5FAKA 1XFDA 3GJ4A 5F3WB 1ZXLA 3OLZA 2I3DA 1MHTA 4DOMA 2JEYA 4JELA 5J23A 4YBZA 2ZT7A 3RKSA 3VR4A 4C5CA 2VXDA 3TW4A 3KU1A 3R0ZA 3D6VA 2RGCA 3D1NI 2VLBA 3K0CC 1NTRA 2VDPB 4Y2TA 2FWIA 2WIFA 3C7CB 3MT7A 3L3BA 1GRQA 3V4FA 3K73O 4HQOA 3CBGA 4JHLA 2GMWA 5ELXA 4OUDA 1P9LA 3OZSA 4ZZ0A 4A3BJ 2OCIA 3BXFA 4JJKA 5E0KB 2L69A 1V4BA 5J5CA 5T6BA 5H81A 3H19A 3QPDA 1JZSA 1L8QA 4AQYB 1PKEA 1SEVA 1SY7A 2QRQA 3S55A 3VKUA 2D5VA 4HX8A 1P2TA 4YMIA 4LD5A 1OCTC 1SZCA 1YOBA 4UE2A 1CR1A 4Q66C 3QJGA 5ESRA 3ZNNA 5J40A 5LN1A 5T4HA 4HWSA 3PC2A 4I0BA 3GGJA 2H11A 4TKVB 1SULA 3GA5A 3KVRA 3MJSA 2QAIA 4JI6B 3P27A 4RQTA 1EESA 4UHDA 2UYCA 1AOXA 1I24A 1ADFA 3BMQA 1OYWA 4RGYA 1SHUX 2GXGA 2VC0A 1GNTA 1T6YA 3WP1B 1XVIA 1F48A 4FFRA 1KQFA 2OY0A 5TQ0A 2E5ZA 4DT1A 2WKRA 4BO7A 4MW9A 3KX2A 3FE2A 2COKA 1YMVA 2YX1A 5TLSA 3X2FA 5IWAB 2QXYA 4UNOA 4EI2A 4BBJA 4NCJA 4D7MA 4IEIA 3TKLA 4UTNA 4FILA 1QYDA 2HF2A 3H1AA 5F3RA 2ECQA 1HNXB 3T6KA 1Q0LA 1SQ0A 4ZVRA 1PGOA 1BEEA 5CEJA 4E1VA 1A9TA 1N6PA 1TYBE 4RWEA 2FSSA 4YHHB 1QUFA 2P2LA 4DRXA 3FCEA 4QUBA 2D8MA 4MPTA 1CEYA 4B7ZA 2ZS9A 2OA4A 2MT9A 4FOOA 3W78A 4PR3A 1IDYA 3CVWA 1IG3A 4J4HA 3RVLA 3ZOBA 3BH7A 2GN2A 3UMCA 1EH6A 1U7PA 3OQ6A 2Z9CA 5BPIA 4FKZA 1YS6A 2IPAB 4X62D 2V7QD 3OA2A 4GLLA 4I0WB 4EUFA 4A3IJ 1JQBA 3FIJA 3I62A 3LWFA 3C39A 1NUSA 2R4TA 3GA7A 1PYOA 5DCUA 1V8FA 2XKBA 2VEOA 2OTCA 1N5OX 3FHTA 1ZOPA 1FCJA 4QSHA 1FBNA 3Q8XB 4WZAE 1B59A 1OXTA 1Z88A 1II8A 2ZXJA 1A8PA 1WPRA 1AY0A 3GX1A 2DF8A 3KQQA 1Y1VJ 2X5XA 5HFNA 2Z99A 1PUJA 1EQAA 4S1OA 2XBLA 3ABIA 4ZZLA 2XQJA 5BRNA 3U3DA 3QRWA 2BGRA 3AIIA 4EG3A 1M76A 1DT5A 5FWAA 3TOXA 1W8IA 2VSNA 4MEXF 1T0FA 1XSDA 2WWRA 5CM8B 3GRKA 1CUIA 4OBWA 3OWTA 4DR4D 3OHMA 2WTUA 3CF2A 1GV1A 1YFHA 4R0MA 1DAFA 3SXUA 1K5HA 1ZKDA 1NUHA 4QU5A 2O06A 2V7BA 2R5YA 2C95A 5LYJA 2YDXA 3CX6A 4W82A 2BFPA 4F3TA 3KYLA 1KTVA 4P0QB 4JYZA 2J4DA 2WM2A 5BWBA 5IKXA 4AC9A 3A4NA 3KKKA 5L6LB 3HPQA 4YRLA 2YS6A 2I6XA 1B0ZA 2FPIA 3L46A 3JCUC 3RRZA 3EA5A 3H9JA 4GT1A 2P6PA 1RM0A 3FXAA 1STOA 3KPHA 1E9AA 1QIHA 1MSFC 3LCUA 1YRBA 4FSDA 4PGHA 5TT1A 2MFZA 4O2BF 5ALTA 2Z8YM 2W8BB 3VZCA 3WKBA 2IJGX 3OYMA 3J81Z 2GJSA 3FXOA 3EFHA 2J85A 3COYA 1JYEA 4KQKA 4DIMA 2HA4A 1J6UA 3D7LA 5HS6A 4RIIA 1JBQA 4CQMD 3E6DA 5EIBD 1XVUA 1N33B 4UE3S 5D5HA 3BL5A 1KRXA 4ZVMA 2Q27A 3CP2A 3CCSI 2OG2A 3DU5A 1U9CA 2E2JJ 3BROA 1KI4A 1D6NA 1Z56C 1PL0A 3PIOF 4MIEA 1N5LA 1V37A 1PRYA 3RDPA 5THXA 4F11A 4TMXA 4X6AJ 3VNSA 1QYRA 3REQA 4MI9A 4AVPA 3AH8A 1KJYA 5J3JA 5TB5A 4I46A 4UUTA 3O4VA 5H4HA 4JLKA 5BYKA 4Z9YA 4EJVA 1XHLA 2GIZA 2HOAA 2PWAA 3PRYA 1GZUA 1AKEA 2ZAIA 3ZI0A 2VQEB 2FVYA 2XVYA 2CW8A 3P7MA 1A9OA 1QCYA 1GG8A 1MRSA 4IJWA 1LKXA 2VODA 1IBRA 4NYJR 1T91A 4WBNF 1KF0A 4BGEA 4B7AA 2BCEA 4EENA 3C18A 3LSMA 3JPYA 8MHTA 4CR6A 3TX6A 1BA2A 4XIGS 5DNWA 1J23A 4CFYA 3TJRA 3ZE0B 1O96A 5IP6A 4B8ZA 821PA 1D2HA 3SEAA 4F1KA 3GQBB 2BMEA 2FSPA 3DOIA 4W5OA 2Y27A 3HDHA 1ZISA 1MORA 2ECPA 2CW5A 1AO3A 4NULA 3JXEA 1PQ4A 3LT2A 2Z2XA 3ZIAA 1SEPA 1BCSA 4HX2A 3LMMA 3SJMA 2LIPA 1E8DA 3GFQA 2R66A 1OFHA 5CX4A 4LXIA 3WTSC 1X58A 2VHEA 3S2YA 1ACMA 1QDEA 3WKCA 1T43A 3GMDA 1T0JB 1LS1A 4RELA 5EQFA 2RKWA 1HC7A 2IEYA 2DFKB 2W1OA 1Z4IA 3ZD7A 3ONNA 4IFEA 4DADA 1U4SA 3DLIA 4JQFA 4YK7A 3GZTB 3CPSA 3KOXA 4FMDB 1ZU4A 3B9PA 1FBSA 3C4VA 4I8IA 4DMMA 3ZW8A 3DL4A 2F48A 2QSJA 3AVOA 2X3YA 2B35A 2PL5A 2O3SA 5C4XJ 1U4OA 4OHXA 1S3IA 1U9OA 1HEUA 3KV1A 1JEQA 3ZJYA 1VI2A 1U2TA 1W48A 5LQNA 3A9UA 4H7JA 2XWJI 1N2HA 4HF1A 4REQB 4DDKA 1UDXA 2V7XA 2NRAC 3E81A 3ABQB 2RHDA 4JASB 4WXPA 2FG6C 5HRUA 4KIGA 3A04A 1HYGA 1PK9A 4EQQA 4BDZA 1E60A 4CLEA 2CHFA 3AHIA 3PXUA 4QLCU 1EFVA 1P0CA 2WUDA 1GKUB 3DBRB 3OP1A 2H0QA 4B4CA 4NATA 3ZNOA 1Y56A 2W7NA 1OV6A 2BZSA 3JQRA 4AVYA 1UZNA 2C9ZA 4MVJI 1NPYA 2P4WA 1YTLA 2IV7A 2ZT5A 2RC4A 1JBKA 2B37A 3CO7C 3D9QX 4R2HA 2ZWPA 3DJFA 4PVCA 4X93A 5DTRA 1N0WA 1IZYA 4FGJA 3ROEA 2P8JA 1F5TA 1FSHA 5IT9E 3ZH9B 2XIJA 4NONA 3EVGA 4R1QA 5CVDA 2OOSA 4M83A 2HZ7A 1Q1ZA 3S2SA 4E2FA 3OT1A 1QE0A 1YZFA 3NUGA 4D56A 4BACA 3RE1A 1RZVA 5K1ZA 2H8WA 3ERMA 4Y6LA 5CYPA 2ZCJA 3C15C 2DPUA 3CE6A 3BGIA 3M2PA 3QU5A 3JW8A 4LJKA 4WXEA 5ALSA 4X41A 1QCZA 2FPLA 2GDZA 3GNQA 3ZDCA 3FCCA 4R5MA 3TPCA 1R1TA 3HO8A 4JI4D 1XU9A 2QZ8A 1ORVA 1ETQA 3EXG1 2EBHX 3KKZA 1Z8NA 5EGNA 4NUBA 5EEGA 3EC7A 3UW1A 2C2HA 3A25A 1JDSA 3U44B 2QMEA 3H86A 5JQGF 1DJMA 3LZDA 1Y82A 3WYFA 3RT1A 4P2GA 5IFLA 4CF3A 2D0IA 2A07F 4TMFA 5K03A 1ESEA 2P9FA 4UBNA 2PQ2A 4AF7A 2IHVA 2HYGD 2Z1NA 1IMJA 2QJOA 1NXXA 4L9RA 1AH2A 4ALJA 1YB4A 2AR7A 2QA4I 2RV8A 2XUOA 3LWNA 5AUNB 4BJTA 1PEYA 3TE6A 2JEOA 1YQGA 2BFWA 2L17A 4GZ3A 2OCKA 1M2VA 3GGCA 4KNYA 4BE4A 2WDZA 2M9HA 2QU7A 2DHDA 1XXHE 5F2OA 4UAUA 1PR6A 2XCRB 3O1IC 2PBIA 3GAMA 4JROA 5BYAA 5KJ6A 1KYQA 5E1WA 5C8VA 3M8EA 2ZUSA 3K6KA 1MIHA 5HGXA 2GGSA 4UUSB 4ZC3A 2N9UA 2EZ4A 3TQNA 3F8NA 4A9AA 4MQFA 4RZ3A 2W6ZA 5CB4B 2DRIA 4ZYHA 4KEAA 2GAOA 4Z99A 2HXGA 2RJOA 2JEZA 3BHIA 2OCEA 4IP0A 3KTFA 4UAGA 2FZ4A 1USKA 4UVDA 4E7SA 1TWAJ 2Y76A 4M55A 3U7GA 4FHGA 1IWPB 4B76A 3GLGB 3O92A 3PNMA 4C04A 3QWIA 1EXWA 2ID9A 2AMFA 2CMKA 4EJWA 2RI1A 2PBFA 4N6GA 4CV0A 2HHHD 3IP6A 4XKJA 4PZUA 1QC5A 3P1JA 3LI2A 3KB1A 1YRLA 1EP3B 3QQPA 1OF1A 5IZCA 3MTIA 4C22A 4V1CI 2GPBA 1N4AA 3UK0A 4LE1A 3RSHA 1DMRA 1TFUA 4ENVA 3PRKE 4OPMA 2CXUA 2VNIA 4PBSA 1DINA 1SAYA 4CXMA 3TVYA 1W6UA 3S28A 4QOSA 2NVTJ 4Q4LA 1SBYA 3F72A 3IV9A 4V0NA 5LLTA 3NQOA 3CR8A 4KN4X 1G3IA 2HU5A 2SKEA 3H84A 1E6EA 2E5FA 5IS2A 3MGBA 3RUDA 3WNVA 5GPBA 3R7NA 4Y6RA 3PEWA 2HDHA 2Y3IA 1QQTA 1DZ3A 4AK9A 3SIWA 2TRTA 1FDIA 4IJ5A 3IUMA 5DYYA 3HE3A 2YYZA 3JARA 4N41A 1DRWA 3AK4A 1ZK3A 2VP2A 1N32D 1BQEA 4TGLA 1B0AA 1BHJA 4R41A 4BHBA 3N59A 3CB2A 3MKYB 3EUWA 2CFTA 1DARA 2Q1ZB 2DFHA 2FWBA 2PA0A 5L3ZA 2WVGA 5J2UB 2ICAA 3VYUB 1U7DA 1FYVA 3KIPA 1TWHJ 4BVEA 2WM9B 3DWIA 5E0OA 1V9LA 1DCTA 2E5NA 4L5BA 1B00A 2FEZA 2WIBA 5DHQA 1BROA 3VR6D 1SBCA 2GBGA 4IZHA 4DBRA 1X2NA 1YHQI 1ZY2A 2R1ZA 1RNLA 3RLFA 1VQ8I 2OYSA 5BQOA 2OA0A 1PZMA 3OU2A 1YRYE 2QQGA 2BKXA 2PPVA 3GEHA 1C4OA 3LA2A 1PJBA 3SFIA 2FK8A 1VMDA 2YWGA 5BSUA 1MIJA 1COZA 16PKA 4YUYA 2RNJA 3JQDA 1KEUA 3H2IA 3PXDA 2YZKA 4P5OA 4DYDA 2J46A 5JXGA 5E9WA 2VIXA 5A6SA 2COEA 3KOMA 4F3KA 4JENA 1TTTA 2HA7A 3JRGA 4KXNA 1U7UA 4KSCA 3UJ8A 1BGWA 4NYJQ 2JGKA 1W4LA 3IEMA 3BG5A 4PNHA 2IEDA 1DRVA 3VPHA 1FX1A 2V96A 1KJJA 2OZLB 4KLRA 2YQZA 3NONA 4JSTA 4PZJA 3ASVA 4I4TF 2RK3A 3LMKA 5K3SA 1MMSA 4L4UA 2GHRA 4CI9A 1AUVA 4N5NA 5AWFC 1QAMA 5DXFA 4O4JB 3FTDA 3GRRA 3L8EA 1B42A 4DTIA 3NHRA 3T35A 2IU4A 2FZ5A 1WJEA 1QWOA 3WC4A 2QMHA 2F17A 4FEAA 4FN5A 2GSDA 4R1SA 2C31A 3T61A 1U8CB 4A1FA 3AF6A 1A82A 1W5SA 4NCNA 4WLVA 2IGBA 2OD5A 2Y9ZA 3GO5A 1XZPA 2IW5A 2Q8NA 4MW5A 4F92B 2KRHA 4UEJA 1WCIB 4NZOA 2AMJA 1YQQA 1ZD2P 2HTFA 4X7MA 4QOJA 4XGRA 2ZMEB 3CLUD 4ND8B 3RIRA 3N86A 1AOYA 1J0AA 1T56A 5HHTA 1Z2NX 2I22A 2ZRDA 3BWYA 4QREA 3ENWA 5ITZB 1ONNA 4QPZA 3B1WA 3RH0A 4J7AA 4WY2A 3SZPA 2DBZA 3AHGA 3QSGA 1U3FA 2JBWA 2BY3A 1BS9A 1WXGA 1AKUA 1OTYA 4TS4A 4D9CA 3N70A 1MGOA 3P19A 2OV2A 4XB1A 2QLLA 2JPCA 1GFIA 5FWDA 3VYWA 4FE7A 2C0QA 1LB1B 3VZRA 3ERED 1GIAA 5IHPA 4DKXA 4D0LB 3NFYA 1K7YA 2H1HA 2JA2A 2IYXA 3CX7A 4JOBA 2VJKA 2HD4A 3MTDA 3Q3IA 1E63A 3ZDDA 3NGMA 2X4IA 3A0RB 2G88A 4MGYR 4LCJA 5H9WA 3BFKA 3RTRA 3FKSD 4J75A 4MPDA 2E71A 3JQFA 4C87A 2X9QA 4YONB 2VNAA 3S40A 1ZG1A 1PR9A 4MAAA 4H7HA 3ROQA 1LFBA 3BWEA 4IHJF 3IAUA 4U00A 3ISTA 4D9JA 4PLGA 4XOUA 3K35A 4YJKA 2Q3MA 2MU1A 1L8AA 3UAXA 2GBPA 2FTKE 1QRAA 1ORHA 3F90A 3LAPA 4G0QA 3V1MA 4WCFB 3K1AB 3EDOA 1B4AA 5CG2A 1G4DA 1VHJA 3TZBA 3NDBB 4JJ7A 2X0KA 2GZ2A 4FNGA 2OR3A 4XI9A 1SIUA 3V1KA 1BVRA 3L7YA 2Q5JA 3I6MA 1VHQA 4D26A 1YA6A 2QLBA 2DEUA 3PA6A 4BRZA 5KQGA 2XZLA 5JSFA 3I34X 3G5TA 1MENA 4UBMA 1ZD9A 3K09A 5M7EA 4YRAA 1BWPA 4IDEA 2RN7A 2WWWA 5HQ3A 4FZVA 2Q49A 1OI7A 2PSEA 3TTYA 4WJLA 2N75A 5C44J 2BBWA 2JFOA 2NOAA 3FZGA 1EK5A 3DGFC 3OX3A 3F9CA 4H0CA 4QDTA 4FN4A 2CQQA 3RR2A 5TV2A 4ZIRB 3AU8A 1KSGA 3L0BA 2VP6A 1F9EA 1KH2A 1W5BA 1DO0A 1FFSA 5K0FA 2BW3A 5LP1A 3DT6A 1ADBA 1FBQA 3TX2A 2HQ1A 3RFXA 2GM3A 3A6GA 4E2ZA 3P7NA 2PYZA 2OZPA 2UXDD 1GUFA 3M1YA 2JJ1D 2YOGA 1FFDA 3ONEA 4QXOA 2A92A 2IYRA 4M38A 1VQ9I 3PQ8A 4ESBA 1GCIA 4EQZA 3L7DA 3TQSA 1TUBA 1XJWA 4PFKA 4JAVC 4RIEA 4RBOA 5TJ9A 2VPWA 3GLSA 4HAOA 1J59A 1SRQA 3T5DA 4EJ6A 2Z5UA 2E4ZA 4TLCA 3SI7A 4M2LA 2Q3CA 3OYCA 1CQPA 5F9HA 3VRHA 1BKDR 5MN4A 4F86A 3O91A 3DLPX 1JHAA 1X7ZB 2CMFA 2ZCVA 4HVLA 4F93B 2CXHA 5K5EA 4M1OA 1D0YA 3WLKX 1JFFB 4DA4A 2HU8A 1CYEA 5KNLA 1I7SB 1D2CA 1YBMA 1LWNA 1L5KA 5CXXA 1NJ6A 3WL5A 3UAWA 2FR8C 2P35A 1G1MA 4DQXA 1LRLA 1UELB 2W22A 2KQUA 1RXEA 4BQRA 4N5DA 2WWIA 2VBGA 4Y2YA 4Y6SA 4C89A 3KS9A 2GETA 3JZDA 5LKAA 1K3TA 5HM8A 3PA8A 1CS0B 4JB2A 4PYJA 4HA8A 1KDTA 1T8YA 5EAIA 3UB2A 3LYLA 5EGOB 1QG4A 2R8ZA 1LDJA 2DKOA 3FVQA 2WP8J 4DMGA 1A2BA 2XLCA 3NAUA 2RC6A 3ASOH 5A03A 4WDQA 4N3NA 3A2MA 4RVFA 3I3LA 1JKOC 4DARA 3GP8A 4RMNA 4JX9A 3F5SA 3OYLA 2QY6A 3F6SA 4X62B 2IE0A 4NNOA 2NT4A 1IYZA 2H2AA 1DG9A 5AKXA 1CEQA 5E38A 3BJZA 3LGXA 2DA7A 4WK8F 3VNQA 4LZNA 4HDKA 2DQRA 2FMTA 4KPYA 3OE7A 1EWRA 2Y30A 2P67A 3THSA 1OZGA 2VYND 5HWSA 2XF5A 4RETA 4KIBA 4XRMA 1H5QA 1GTRA 4D0PA 1NXPA 7MHTA 3OSZA 1M8JA 2PGIA 2ZYIA 3SXYA 5HZHA 3KXPA 3K9GA 4C4ZA 3AUYA 2I91A 1C5KA 1T8TA 5ERXA 4GXQA 1U8YA 1J8DA 1UJ2A 1GTG1 3B2NA 3HSRA 2VHJA 1IVYA 2O2IA 2P4HX 4FCWA 4B73A 2LY9A 4P08A 1C41A 2QAGC 4L18B 3B02A 2DTDA 1CC1S 3U17A 5JPDA 1ILEA 5FOTA 3WV4A 3PB3A 5KYXA 3D4LA 3GJ0A 1P2SA 3OYFA 3JAWA 3JPWA 3HKBB 4RTQA 3GVCA 4DR4B 2YHSA 1Y9AA 2VDRB 1WB4A 4LHYA 5FA6A 3EQZA 5KPDA 3WO0A 4LMBA 2IBDA 3CUSA 1W88B 3O75A 3TM5A 5K3EA 4RJJA 5LU8A 3DLBA 3VXKA 4KV7A 3ABKH 5BVHB 1BE0A 3ILSA 3CCCA 2ZQ5A 3DMNA 2UXBD 2ORED 4ENQA 1HZZC 3ECHA 1QQ5A 2PUHA 4BNCA 3RRMA 3GLUA 3MQ0A 3JZIA 2XHZA 4FTWA 2C1ZA 3GRAA 2P65A 5DTIA 1B4DA 4U6NA 4UXJA 4ZYTA 4WWCA 3VNAA 3I2HA 3M3PA 1ZOLA 1VL6A 4URHA 4D25A 4FFSA 5DTDA 3ISVA 1PDOA 3NRBA 5DLYA 2F8LA 3T94A 4RTNA 1QR2A 1TQ6A 2A8YA 3MUOA 5J2TF 2RHGB 4EHNA 1SANA 4EJFA 4LWZA 2W24A 2Q4OA 4E7HA 4PPGA 2MMCA 3ZQUA 2GLUA 2JCXA 2OD9A 1ISHA 2V1DA 4CQMB 1B9MA 1TL7C 1YRQA 5K0ZA 1PNRA 4G5XA 3K6JA 3UJ3X 1JVNA 2P9JA 2IHZA 4CEJB 1KVUA 3E9YA 1NVTA 2HIMA 5KYUA 4YROA 2UZ4A 4YQZA 2GTHA 3VH4A 4E2YA 3BSSA 3C2QA 2EFHB 4HDCA 2V1XA 2WNHA 1O6CA 3BHNA 1GDDA 4Q7MB 1HGXA 1LH0A 3WZ2A 3RBVA 3ZN0A 3WFIA 1YIOA 1QLJA 1OKKD 1E6KA 3FMPB 2DMUA 3UT5A 5BSVA 2ANBA 4C2BA 2DJNA 3DPLC 2WC2A 2IF0A 2V5AA 3E27A 1ZJWA 4EGJA 3JQBA 3P2YA 1STZA 3FM3A 5FA8A 2B4AA 2Z2KA 3L9XA 2CO5A 5ALQA 4IHSA 4G0MA 2AI1A 2BDTA 5AW5A 4TPKA 1VPDA 1XCVA 1Z07A 1I3QJ 2J67A 3TUIC 4L08A 1USTA 8LDHA 3WWCA 3MHPA 5CK5A 4LC9A 4YLYA 1Q0UA 1OASA 4JVLA 3WBBA 3PNOA 3EDMA 2SCUA 3C7TA 3F71A 4E11A 5JBNA 3I73A 4QYSA 1Q12A 2EKZA 3CCFA 4M46A 1DKQA 3VDRA 5AW1A 5AJVB 2IY8A 4Q3NA 2KIQA 3M1IA 1LWOA 1O95C 3WLNA 3EZ2A 3RVOA 4BGUA 4BN0A 4LECA 2WFLA 2WJPA 2OM6A 4QUAA 2YU3A 2WWFA 3HKEA 4R4JA 4RTKA 2WTNA 2W83A 4EF6A 3KJIA 3QLVA 4AJ9A 4QTTB 4CM8A 3MRTA 3X0DA 3W9UA 3SFZA 1Q1EA 3WLTA 1KSFX 3DBLA 3JSXA 3ZOKA 2M1ZA 1WB5A 3I5YA 4TV7A 3T5XA 4DSNA 3OJXA 2L18A 4LHXA 3L0IB 3TRIA 1G3QA 4QDZA 1FIUA 4II7A 2C97A 1IV6A 4LGYA 3SSNA 3R5JA 4PYRA 1MW7A 1A76A 4UD6A 1DIRA 3GMIA 5IK2D 2O0MA 4BJHB 2J9GA 4AM8A 3ZY5A 2F00A 1US8A 4FYYA 3CG4A 4R8LA 2BHSA 5KMGB 3EQ9A 3FRIA 2XT0A 3GAFA 5TVGA 1BEUB 3ENNA 3JTMA 3GRCA 2MR5A 5AVQA 5EZYF 3QVGB 4LZZA 4EA8A 3I9LA 1ZRNA 2XV1A 2PQ0A 1S3JA 4LB6B 2GFQA 1W25A 1OHHA 4GE0A 3AEYA 3C3KA 2P8TA 3BRWD 3K6RA 4NPAA 5KTMA 4KN6A 1FW8A 1XZFA 1P1JA 5LRSA 4IOCF 1DC3A 2X6WA 1HMPA 4KMSA 5WRFA 1T8UA 3ZCVA 3VR5D 2CUEA 1K6EA 2QRVB 1KU6A 2P5VA 4BNVA 1R5NA 4GVXA 1Q19A 2VASA 3K2AA 1KFJB 4IX7A 3O6BB 4LFUA 5DKFA 2EVWX 3U0BA 4MVYA 1ZGGA 2WHPA 4EYGA 2IF2A 1QJ4A 2DWPA 3FHOA 2PO5A 4F3YA 1GPYA 3BTSA 5DBGA 1KS9A 1P7VA 4FYPA 3H4IA 1AS0A 1ZNYA 3SD7A 2A05A 4RM3A 1FU8A 2WD7A 2WY2D 4RS8A 3EY4A 2XSJC 3SQNA 1JJVA 3HUFA 3JQQA 4BFLA 5KNCH 4MWCA 1MZPA 2VQ6A 3H3XA 4KIJA 3AVTA 3L6DA 4B80A 3CJTB 3CW8X 3WQRA 3N6XA 3A6KA 3LVFO 1P1CA 1A4XA 1FBUA 3ZKWA 3E6AA 3GZJA 1FC0A 3CUTA 4FOLA 3ZQQA 3SEQA 2ZIAA 2V7TA 5HEKA 2QQAA 2VDWB 3LPAA 3RADC 4JJ6A 2G7MC 3RK0A 1EM8A 2NOJB 2O3FA 1LE8A 3CJQA 4GMHA 4PAQA 3RYHB 3QSYA 2OGUA 1S1CA 3C2BA 4EM0B 5TJJA 5IVDA 1W46A 2VRCA 2QTMA 2MTBA 1YVDA 3R6LA 4D9KA 3EA0A 3CZPA 1OGYA 4JI4B 3ND5A 4RA2A 3W2VA 1U1GA 4RHCA 1NR5A 4RD1A 3D5EA 3RSQA 3QVOA 3NHBA 1YIJI 3FYDA 2K9NA 7REQB 4AZVA 1UZLA 2OGSA 4QUIA 1UPAA 3RC2A 4AT1A 1F1BA 3TQTA 5FTWA 1K7AA 4M6XA 1RR8C 4QDXA 3BRSA 3ST7A 5B7GA 1QCCA 3IL2A 4YMTA 1BHO1 4BXOB 4A7PA 3X2SA 1SXGA 4DLNA 2ROQA 2W6MA 1SKYE 4A2WA 3AR8A 3SQOA 1L3IA 1QGOA 1SRRA 3TEFA 1DKMA 1EVYA 3LSRA 5B6IA 4YASA 5KTKA 2AQEA 2XMRA 4K8RB 3FB1A 3UAZA 1G21A 3NTRA 4DSZA 2ME0A 3BE6A 5BV2P 1DQYA 1E96A 1SVUA 5D3MB 4LLLA 2HXIA 3HKDA 1SFEA 1KP9A 3UFXA 3F6EX 4B31A 3O8QA 2AI3A 1ENHA 1Y9ZA 2GF2A 4RZ2A 3DCJA 1FU4A 4D2IA 3HUTA 6REQA 3PIRA 3W3AD 2QVGA 3DEEA 5HW0A 4J0DA 4DFDA 3MKWB 3E61A 1Y1WJ 2PMKA 3BL8A 3OH8A 4UOQA 4GGOA 4J2OA 3CSSA 3KV3O 1CW2B 2ZPAA 2OHFA 1IPFA 4KK4A 2NO4A 2JI7A 4YIFA 2CXXA 4A8JA 4D0RA 4N7BA 1HW2A 1JW9B 4F38A 4BGDA 4IXNA 2CXTA 4R8RA 3THYA 3H1BA 1KMHA 4LK2A 4D81A 4U5QA 4HV5A 2AOUB 2W2LA 2D54A 3O1JC 3OYEA 1KI7A 4B6JA 1NF9A 3GBGA 5HA5A 1GZ5A 5A5FA 2OVFA 4N3BA 2HHHB 1F4LA 4LZOA 1AMNA 4C3VA 1FY7A 4LOJA 2JBAA 4YRTA 1NL3A 1OI3A 4EUEA 4DLWA 2AH5A 5GJBA 3TEMA 4PHHA 5EKTA 3V7CA 5JD6A 1U1EA 1BSVA 2FGKA 2JFHA 3AV0B 4XCVA 4WNAB 4EAQA 5KSZA 1E58A 1SJ9A 2R00A 4LCBA 2ZJ2A 4LSZA 4WD3A 3EK2A 1NQ5A 5A5DA 2H3EA 3G02A 1QRTA 4GE3A 1WDMA 3BIFA 4ZQEA 1Z7YA 3FF5A 2EKDA 3M3HA 1I36A 1F6DA 1N6RA 3PC3A 4O3MA 1NLFA 2GWHA 3FGZA 4ZOQI 2UV8A 4QPOA 5CIWA 4D8XA 3RHTA 5TXGA 3KJGA 2YVQA 2VT6A 1N32B 2YWHA 5FUXA 2AOWA 1ZD1A 4Q4AB 5DGDA 1SUCA 3Q7QA 1M6VB 1H2YA 4I2NA 5HILA 2H06A 3ZWWA 3NBXX 5AVSA 4IW3B 3DOCA 2ESHA 4AG3A 3MT8A 3D2BA 1XNQD 2G5TA 1YO6A 5J47A 5GOZA 5BR1A 1Y9EA 2GLTA 5H7XA 3L6UA 3DOJA 4P9NA 1Z6QA 2Y9YA 1JHZA 4FDTA 5KSYA 4JVSB 1YZQA 2RGVA 3K0BA 1S2OA 1KC3A 3OLYA 1J75A 5GADJ 1T8WA 1A0OA 2WE7A 4WI1A 2ZJOA 5IJWA 4U8GA 5BT9A 1X1PA 2CMPA 2DT6A 1NR7A 4ER7A 1TT7A 4DEXA 2DE0X 1P5ZB 3FAZA 2ODAA 5ICEA 1G7CA 3WGJA 1YFKA 5ITWA 2ANCA 1EVQA 2Q1UA 3EF3A 1FPQA 3Q0EA 3RAGA 1M0EA 4ZH4F 1SKMA 2EV6A 2YINC 5I8PA 1ISMA 2O3UA 4TV9F 2V9PA 3I5UA 1G8XA 1BKYA 3ABTA 3SSOA 3AB3A 4HV4A 3M7GA 2BDEA 2DWOA 4R9NA 5J1RA 3HABA 4WX2B 2EFYA 5T57A 5EWMB 4G0UA 4L85A 3OPYB 1L0OC 1KO5A 3A9WA 4IV0A 4GSKA 2ZDGA 4ZI7B 3PNYA 2IGTA 5GY7A 2ST1A 3OMYA 4CGZA 2ATEA 1X19A 4KO8A 2IDMA 1YQAA 2DB3A 1XZHA 3IB3A 4L4YA 3ZIUA 5TMPA 2FH5B 1AK2A 5C53B 4H17A 3BR2A 1XDDA 3L8CA 1WEHA 3OCJA 4OH7A 3W04A 1AKQA 3AM3A 4DMCA 1KNXA 2P62A 1ULYA 3ZCTA 3PUJA 3JQ8B 4H1VA 1E3WA 1N5IA 1U0TA 2MSYA 2QV7A 3B9QA 1MP0A 5L7YA 4YJGB 1R8YA 3WK5A 4B34A 1LVKA 5EWLA 2VH2A 5COBA 1MJHA 4LJ8A 4FCCA 4M0LA 4ZT5A 4PGAA 5CBPA 2PZLA 2Z8ZA 1LPAB 4WXMA 2H9IA 4ID3A 5EIFA 3W5UA 4BNIA 5DHTA 3CZCA 2B25A 1AGXA 2HIHA 3GJQA 10MHA 1ZRSA 4CLXA 2VJJA 1VQMI 4RTLA 4C4AA 4FT2A 1KDYA 4OBXA 2CMHA 2AWNA 2V4JC 1JFRA 3KPJA 1GTSA 4QA9A 2P0WA 4FS3A 3ACBA 2QLFA 4CKWA 2BFFA 4E03A 1D0VA 1UXGA 3ZYCA 4F3QA 2HCJB 3IO5A 3D5RC 4LYHA 1HL3A 4G7ZF 4IFBA 3C6QA 1U11A 4DIEA 3H9EO 3ZZ1A 3FTQA 3ZJUA 2H2WA 4C07A 5B3LA 4FDAA 3U4GA 3L5KA 4BIMA 3MZ0A 1BO6A 1T9HA 4JZYA 2BPOA 1Z12A 4DB4A 3EDPA 1A3CA 3KFLA 1TVCA 1TZKA 3AWIA 2QAJA 1AB5A 1EHCA 5CHEA 3JATA 4XKCA 3O4HA 3NAMA 4BYGA 5IJZA 5E3NA 2HDCA 3A9VA 2ZQYA 3DKYA 2KMLA 2O0KA 1B3RA 3UA4A 1SVIA 2NTJA 4BRUA 4WACA 4D0SA 1P19A 2PAAA 2EW1A 2HJRA 3TR5A 1YBVA 4OIPF 2GARA 4HN9A 1W49A 1EX6A 2X8BA 2ZSIA 1W85A 2ZPUA 3O73A 3PFNA 2W2TA 2FGJA 2CF5A 1JXSA 3C41J 3K1MA 4IHYA 1LX7A 1QTIA 2X9DA 1UT8A 4DM7A 1CZUA 4GOXA 2OXIA 2JRCA 4OLAA 1JDZA 3CH6A 2C7BA 2DWCA 3AEKA 4KOEC 4YRIA 1ZC4A 4BUCA 4O4LF 3KNZA 4R8KA 5DVZA 1WSDA 3QVXA 3H5OA 3WHCA 5JJLA 2OV1A 2Z4RA 1QG2A 1DGWY 1R64A 3N28A 2BHRA 3OO0A 3B6KA 1YDWA 5EN4A 3NZEA 3E70C 2H4YA 5P21A 1BNCA 2CG4A 1KAQA 5SY9A 2WSLA 2ZXUA 2BFEB 1RKXA 5KDDA 2FDRA 3ZWNA 2JSCA 1ZJJA 3HRKA 4ZKEA 2GM4A 4XM3A 2VDQB 3ZWMA 3UY4A 5AFSA 1O77A 4NJMB 1UEIA 5HJEA 3T4XA 2FZWA 2QSZA 2XB4A 2UXDB 4D9IA 5H83A 2G09A 1A8IA 1R0XA 4BFTA 3H0GJ 3G7NA 1QAQA 4ZO9A 3AF0A 3BSYA 4QD3A 4RDXA 4HXEB 3L1UA 2VS1A 3OESA 3T1VA 1IFXA 4OVKA 3OQ1A 1JDBB 3I45A 1VRWA 2QD4A 5K5QA 2JHAA 5GJCA 4F2GA 4M3GA 3P9KA 5MF6A 3C8ZA 1AUPA 4FPXA 3QV2A 2VPXA 1U5BA 2A0UA 1V1JA 4DCOA 2X13A 3O90A 2DERA 1JDTA 4UDYX 4DBQA 1IDZA 4DG9A 2A7QA 1NI4B 2DI3A 4AXXA 5DISB 3HKZN 1M10A 5A9TA 4U7JA 2FUG1 1W2HA 4BQIA 2QMZA 1HT0A 5K0JA 3C14C 4BLTA 3HXOA 4K5QA 1P9OA 2P9YA 3I2JA 2VSXA 5JH7F 4WZBB 5DGTA 5LUBA 4M9SA 3LNTA 2V4MA 5DI3A 4HYQA 4JIGA 2HV9A 5K0LA 4HLXA 3LOUA 1K86A 2VUTA 2JVHA 4BE0A 4LA4A 2C61A 2VTBA 3AEUB 1UIMA 2N0SA 2PG3A 4J6FA 1C4XA 3N1UA 1NNSA 2CXRA 3K3PA 2CJJA 3KB8A 4RXTA 3U9GA 1E92A 1Z1DA 1UINA 4WA7A 1ZSNA 4B0PA 3H9GA 1XZCA 2JTVA 2P0EA 1DAHA 1SHJA 4BV2A 2X5KO 3QEMA 4PAOA 3CMEI 3H9CA 3L0CA 4UZEA 1LV8A 1DOAA 1KSHA 1UC9A 4XLEA 3HJAA 3LSJA 1N9GA 4B4DA 2XNCA 2B0JA 1AC5A 1ILWA 2PTHA 1F4VA 5CX1B 3R9KA 2VDNB 5AHXA 5K4HA 1L4EA 1ABBA 2GCEA 4JI2D 4NYMR