3KYDB

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
545
structure length
477
Chain Sequence
SRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQDQQVLDVKSYARLFSKSIETLRVHLAEKDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords SUMO-activating enzyme subunit 1
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
total genus 120
structure length 477
sequence length 545
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
B PF14732 UAE_UbL Ubiquitin/SUMO-activating enzyme ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.520 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ubiquitin activating enzymes (Uba3). Chain: B, domain 2 3kydB02
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 3kydB03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kydB01
4L9RA 2JD0A 4BOYA 3AM3A 1IOLA 1GTMA 1KVQA 3CZMA 3HHPA 1I2CA 1NX6A 4CPDA 2C7GA 2OL4A 4J91A 5TQVA 4ZA2A 4OJNA 4A0SA 3SLKA 3DFUA 2GN4A 3GQVA 1NR1A 4B7UA 2E6UX 3UKOA 2H5LA 5I7EA 3VC7A 3DAPA 3R3SA 4IUYA 1HEUA 1R37A 2O4CA 2B4TO 4IGEA 3ONGA 4B7XA 2GR9A 4UVIA 4UULA 1PGNA 4FCCA 4AICA 1ENYA 3PTZA 3TDKA 3GC6A 1T24A 2IZZA 4CLRA 4DTIA 5ENDA 1QYDA 1U3TA 3AW9A 1Q7BA 2W2KB 4DVJA 4BB5A 5EPOA 3ZHZA 1KS9A 1GCOA 2YFQA 3ON5A 2RBEA 3RC1A 2YZ7A 4MIOA 4BNZA 4DYDA 3M1LA 4JXKA 1I3MA 5CHEA 3GAFA 4B8WA 4CV0A 4I1IA 2BFPA 1MP0A 1PS9A 4N5MA 3IL2A 3HQ4O 4TSKA 3UGKA 3PLRA 1GU7A 2ZCUA 3WMWA 3IP1A 4FOOA 2WWRA 4I8XA 4CM9D 1ZBQA 4GGPA 2GLXA 3CE6A 1LDYA 3EGOA 4NPCA 4QFDA 5H81A 3S1LA 1ISMA 2CVZA 3DBVO 4D0RA 4NHEA 3SX2A 3WFJA 4R68A 3WYCA 4A10A 5CDYA 2B5WA 2VHWA 1ISGA 4WCFC 3H5AA 3QV1A 5CFZA 3UFXA 3SLGA 4R4JA 2HK7A 4ROSA 3GNQA 2CF6A 3A28A 4YJGB 2JCXA 2D5AA 2HJSA 4IINA 4OL9A 5AYVA 1NVGA 4R5MA 3VH3A 4PG8A 3WTBA 3QVWA 2FZEA 4JBHA 4XGNA 1I0ZA 2PZMA 2OXIA 1TXGA 1UXIA 4BVAA 3UW3A 2CZCA 1A9ZA 2YDYA 4INAA 4M8SA 2HRZA 4R1NA 3U3XA 3PDUA 1FK8A 4IY1A 4B3IA 1H6BA 3NT2A 1PU2A 4E5PA 1ZJZA 3NYWA 4N54A 4PZEA 3P19A 5JYDA 2GD1O 4OXYA 2OGUA 4P8RA 2O4UX 4PLZA 2F1KA 2JD2A 1A72A 2JCVA 2VZ0A 4ND5A 1MG0A 4EEXA 5DP1A 1NAHA 1ZEJA 2UUOA 4DLAA 3ZU3A 5TNXA 3LLSA 1AE1A 3HUDA 1TA4A 1N5DA 3KM0A 1YGYA 2VYND 2DLDA 4ALJA 4DLBA 3ADOA 4E2WA 4UUMA 3S2FA 4XB1A 4FOSA 1LSJA 3D7LA 3JYLA 3BHMA 4I5DA 2EHDA 2Q2WA 3IQDB 2GPTA 1NFQA 4WLNA 4XQGA 3H65A 5ENVA 5DCUA 4N5LA 4W9NC 1W4ZA 5L9AA 3GR6A 5KCZA 3OQBA 3ITKA 2J3JA 2NQTA 4E4YA 3FF4A 4YRDA 3B1FA 4HFMA 5H83A 2ZJ1A 1YB5A 2DTDA 1F17A 4I9HA 4IGFA 1LSSA 4HBGA 1ZXLA 3WWYA 1DLJA 2VTEA 3H9JA 3QIVA 4E6PA 3Q2IA 2I99A 2I3GA 5L3ZA 2Y0CA 2VHZA 2J3HA 4QXMA 3L07A 3K30A 4DXHA 1GYPA 4WOJA 4F3YA 3SJ7A 3ANMA 1GDHA 3IOYA 1KEWA 1LRLA 2JD1A 1E1KA 3JSAA 3CKYA 1BSVA 1Z82A 2EGGA 4LW8A 2O7QA 4MP8A 4WUVA 1DFGA 1WLYA 1IULA 5JPIA 4P22A 1RM0A 3I5MA 3MEQA 3OFSA 4MJLA 4PVDA 4BO2A 1C0KA 2PWZA 4E13A 1JW9B 5HM8A 4B3JA 6ADHA 2GUGA 3B1KA 4RF5A 4RF3A 1XSEA 4IJUA 5BSHA 1VRWA 4W5VB 1P45A 1ZSYA 4TKLA 1JN0A 1Y9AA 4U0KA 4QO8A 4PG7A 3IMFA 3FNHA 1XA0A 4D41A 5L95A 1LXCA 2PNFA 3H3JA 3G17A 3WQSB 4PG6A 4LK3A 3Q1LA 1HDGO 1U8XX 3M6IA 4R69A 3FBTA 1DLIA 1R0SA 3M2TA 3C7DB 4P38A 2ZYGA 4HUJA 1YS4A 3Q11A 4JJIA 4UVHA 4IBOA 5EN4A 1R15A 2CUKA 4WECA 4A26A 4EUFA 3NJ4A 2O7SA 3ZV5A 3QSGA 5F5LA 1KYQA 1JU9A 2IZ1A 3PYLA 4E5YA 2Y68A 3KTDA 2CD9A 2CDAA 2Y1OA 2Y1DA 2E4AA 3EY4A 5AOVA 4IXWA 1EFKA 3RUFA 4L4SA 4YB8A 3QLJA 1C1XA 4JCOA 1YBVA 1RM4A 3JQGB 4RQUA 1UH5A 5KJFA 2YHUA 1O9BA 1H2BA 2OP0A 5BSFA 1U7HA 3SVTA 5A05A 2ZQYA 3O38A 4RL6A 2PZKA 1PZGA 4FFPA 3KXDA 3U9LA 1JA9A 3LSYA 1DHRA 1V3UA 1SZJG 2GN8A 1QV6A 5CPBA 3ORFA 3HFSA 1EVYA 4BO7A 1MC4A 1NBOA 1XU9A 2NWQA 3P7MA 1WDMA 2I76A 3BMOA 3ETEA 3U09A 4AJHA 5JAIA 3Q3CA 3I9MA 3ZWOA 3ZWBA 1B3RA 3KV3O 2NLOA 4CR7A 4Y6RA 1ONPA 2Q49A 3FPLA 4MVJD 4J2OA 3N7UA 3QWAA 2I9PA 4F46A 4FIZA 3KO8A 1P0CA 1UUFA 4G2NA 3GZ4A 1LDNA 1J49A 1XIVA 4XIYA 3GVCA 3WGIA 1OC4A 1C1XB 1Y5RA 2FPPA 5I7VA 3CINA 3VKVA 2VT3A 4LCJA 3ZH2A 3ZW8A 4IDDA 2TMGA 4CQLA 3L4BA 4MINA 4L0QA 4CUZA 5I8WA 1H6DA 2LDBA 4BQRA 4U0JA 2EXXA 3PLNA 5DBGA 2NUAA 3PHLA 2WM3A 2O50A 5KVSA 2V6GA 2XXBA 3QQPA 2JCYA 4I5EA 3BMOB 3I9LA 1A9YA 2IXBA 2VHVA 3C7AA 3C1AA 4YBZA 2EG9A 1P1IA 3JTMA 3TNLA 1LI4A 3BA1A 4XJTA 3WSVA 3QJ5A 5AQ1A 1JKFA 3B70A 2Z5LA 1ID1A 4IJWA 2PD4A 3RWBA 4XR4A 3WMXA 1UDCA 4H3VA 1GFSA 4ZRMA 4PRLA 4PZDA 4RVUA 5A9TA 1QP8A 1XCBA 3KYCA 5H82A 3GT0A 1MFPA 1OZAA 1JVBA 1DHTA 3AU8A 3GMSA 5K0ZA 4MPDA 4U8GA 4IZHA 1Y8QA 1TLTA 1I3KA 2W4QA 1T26A 3RFXA 3T4EA 4BO4A 3GN2A 1FDSA 1B16A 4QO7A 3LF1A 4CQLB 4TZTA 5JE8A 4DA9A 3AI3A 4WNCA 2B5VA 3DMYA 1G0NA 4IS2A 1UZMA 4TVOA 1HKUA 3LT4A 1GL3A 4ALIA 3WBFA 5L45A 3N74A 3OEYA 4BNLA 2LDXA 1R4NB 2WMDA 5EINA 1NQOA 5HRUA 1BVUA 1CF2O 4MIYA 4NR0A 4WASA 4EJ0A 5CEEA 1ULSA 2WE8A 4M1QA 3KVOA 2W2LD 3GG9A 4KTVE 4PFJA 1NFFA 1Z6ZA 4YT4A 4ZVVA 4NFHA 3UF0A 2H9IA 2HCTA 1FDWA 4HNHA 2UYYA 3TZCA 5K6AC 3VPHA 4MVJG 5C7OO 1MLDA 2GSDA 3PQDA 1PTJA 1N2SA 1TI7A 2B83A 1YKFA 4C7KA 3RQSA 4WCDA 3QE3A 1QKIA 4KUEA 1B7GO 2X0RA 1B0AA 4NFSA 3RU7A 2G17A 2B4RO 4UEOA 4WKGA 5JY6A 4I5GA 1NPTO 1EK6A 1Y8QB 3RKRA 3TZHA 4LMRA 3WICA 1HDXA 3ZHYA 3FNEA 9LDBA 4FN4A 5JS6A 3JYPA 4Q39A 1DPGA 1VJ1A 1ZZEA 4WEQA 3WLFA 1CRWG 1VLLA 4LVUA 3PWSA 1M6WA 2VWHA 4WLEA 5TLSA 1E7WA 3ZDFA 5IDXA 1LDMA 5IZCA 3EYWA 2NQ8A 4X54A 2RAFA 1X7DA 1ONNA 4FGSA 4IDCA 3NTOA 4ZJUA 4CMEA 3DO5A 2WTBA 3WGTA 1PZEA 1NHGA 2I5PO 4D3FA 2IYOA 3DTTA 3EMKA 1O0SA 1JTVA 4YQYA 5CEJA 5JYEA 5IF3A 4M49A 3MJEA 4BNMA 4S1VA 4XEHA 3NX4A 1KEUA 4QQRA 1P1HA 2ZB7A 4OOFA 2IODA 3WSWA 2R00C 4R1SA 2FZWA 3MJ4A 1Q1NA 3RROA 1LSOA 3DDNA 2E49A 4BL5A 2CVQA 1F12A 3DC2A 3TZ6A 4E33A 5BNFA 5T5QA 1AXEA 3NGLA 1T2CA 4EW6A 2OHXA 3EK2A 4TRMA 1YE3A 1EVIA 3QWFA 4IDFA 1JWBB 4BNIA 3E5MA 1DC6A 1RKXA 3JD0A 4IQ0A 4FGWA 1X1EA 2SCUA 4J6FA 4NMHA 4P4GA 3CH6A 2HMUA 1ISHA 1DC4A 3A4VA 3KETA 3ZWXA 8ADHA 1LDGA 1E3LA 5DN9A 4M55A 5AXDA 4Y67A 3RASA 4NH4A 1HYHA 3H9UA 4GL4A 5JCXA 1B8VA 1X0XA 1X14A 3GUCA 5TT0A 4XR9A 2YJZA 4J7CA 3U0BA 3V8BA 5C5IA 3ZU4A 1A4IA 3AUTA 1DIBA 2VUUA 2QIOA 2FWMX 3QVSA 3VDQA 3VVBA 3WWZA 1EBFA 4OO3A 3RC7A 1DIAA 4CR6A 4CUKA 5JW6A 2DPGA 4NZ9A 2DTEA 4E21A 5JAZA 1BRMA 1PQPA 1ZIDA 3FPCA 4JP2A 3G3EA 4A73A 1WZIA 4BGIA 4E12A 1I5RA 5CEFA 1PWZA 1ENPA 4Z0TA 3AK4A 2FR1A 3I1JA 3UUWA 2PV7A 1HDZA 2YFHA 2IEBA 3DZHA 4YXFA 4R41A 1C14A 1I2BA 1MFZA 1SAYA 2FSVA 3QVXA 1IL0A 5J23A 2DBVO 4PLTA 4J7XA 4G5HA 4HWKA 1I3NA 3K2EA 3H8VA 4II2A 4UUNA 2X86A 1TEHA 3LQFA 3DBRA 1C0IA 1G6KA 3OJ0A 1ADBA 1M6HA 3SJUA 5B4TA 1U5CA 3VPXA 1YL7A 4XYLA 1SEVA 4GX5A 4E5NA 1MXHA 1P1FA 3L0DA 4MP3A 3KEQA 1KC3A 4TQGA 4QSMA 3PYMA 1GZ4A 1E3IA 2DM6A 3VPSA 3DQPA 3TL2A 4J1NA 2EF1A 5KWEA 2EEZA 5DP2A 4IDAA 3RUCA 2NTNA 3OMLA 3L6DA 4LISA 4FJ0A 3TOZA 1DC5A 6LDHA 4RCVA 2CNBA 4Q3BA 4ND1A 4NIMA 4XGIA 4J16A 1ZNQO 3EUWA 3MJVA 3RUEA 3VOSA 1CETA 2YV1A 3WQRA 3GGPA 1B8UA 2FP4A 3JD3A 2WEKA 3ZWYA 1C1DA 2ZK7A 2Z1NA 1U3VA 3A1NA 3KLMX 2GYYA 3P2YA 3AOGA 3OA0A 4Z3DA 4ALKA 2VTDA 2VQ3A 2C54A 4BMSA 1VKOA 1FXSA 1NHWA 2Q99A 3BTSA 2WYUA 3VH4A 4CV3A 1I10A 2UAGA 4RPGA 2PGLA 2DTXA 2QYSA 1I2ZA 4XYGA 2NTVA 4HFNA 4XJSA 3EZLA 3DBRB 1CQJA 2VWPA 3HWRA 3E9QA 1S7CA 3RAJA 3BMCA 5JMPA 4E32A 5HA5A 1GYRA 3RSHA 1FDTA 5JC8A 4EJ6A 1T2AA 4ZD6A 4CLXA 1JLLA 1YRLA 4F6CA 1AHIA 3LT2A 3PFWO 1ZKMA 2DVMA 3RCBA 2NADA 5DOZA 4BMNA 4GWGA 1O89A 5CP8A 1LLCA 4DIBA 3NAQA 3OBBA 3JQEA 3M1AA 3CTMA 3ONDA 3GPIA 4PGFA 4DUPA 4ITUA 4YWJA 4GMFA 3C1OA 4R9SA 5DCYA 4CM4A 3C7CB 3JQBA 1LBEA 1JQBA 4KQWA 1C1DB 3EW7A 4CL8A 4ND4A 4RVSA 2X58A 3Q2KA 4NFYA 1HDYA 5I7SA 5G0UA 3OSUA 4IJKA 1PJ3A 3W8DA 4YT8A 1PJLA 4D79A 1RJWA 2A9FA 5KKAA 2RHRA 1ISJA 3GEDA 4CJXA 2BGLA 2OBYA 1DRUA 4UREA 2C2YA 3WLEA 4BHTA 5HBRA 4LRTB 2YW9A 1FJHA 2AQIA 4NU5A 4CL3A 2ILTA 3DXFA 4BGEA 3ZV6A 3AFMA 2I3AA 1LX6A 3DMTA 5JDIC 3GDOA 2AEJA 5JDCC 4BNXA 5GZ3A 3ENKA 4MO2A 4NJMA 1H9BA 1PJ4A 1YXMA 1K3TA 1Z7EA 2W2KA 3JQ9A 3JYOA 4N5NA 4R01A 2UUPA 5A03A 2VCYA 3ZNQA 4AJKA 4FFMA 3OQ6A 1W73A 3RC2A 1LJ8A 3PJDA 4M89A 4QUKA 4BMVA 3D3WA 1NASA 4MVJP 4YVFA 1LC0A 3BHIA 1PJSA 1CIVA 4TROA 3UVEA 2I67A 3AOEC 2NSDA 3UICA 4CM4B 1E7MA 1Z74A 2HJRA 2IDZA 3JQFC 1P44A 3SC6A 1K6JA 3U49A 4NNJA 3GPDG 2NACA 2P4QA 3DHYA 4L4RA 1DJNA 4O0LA 1EUZA 2PR2A 3GFGA 5JMWA 3ZHXA 3WGGA 1UP7A 4NDNE 1ZXBA 3D4OA 1DC3A 4YEDA 1YJ8A 2AE2A 3QRWA 4FBGA 2PA3A 5A5EA 2ZTMA 4YJGA 3L4SO 4KTTE 1E92A 2Q3EA 4ZQFA 3TL3A 4AJJA 2BHLA 2EP7A 1A7AA 4GH5A 2Q4EA 4JGBA 3RFVA 5JSFA 3HG7A 5A9SB 4FJ2A 4BNUA 1LRKA 4F6LA 3OQ1A 1ZVMA 1AXGA 2X23A 1NAIA 1NPDA 4XYMA 1N1EA 4NJMB 2YQ5A 4NQZA 1GY8A 1PJ2A 4MVJH 3VZQA 1SBYA 2GO1A 4TRNA 1UR5A 4XX0A 1WXDA 5TSDA 4EBFA 2RCYA 1X7HA 2PZJA 4WCFB 1ISIA 2A94A 4ZQGA 4WE3A 4XB2A 2Y1FA 3DZJA 1HT0A 3F5SA 4AL4A 5EJ2A 3D3WB 4WGGA 3KRTA 1D1TA 3UAGA 2RH8A 4IZIA 4KWHA 4XD2A 2P2SA 1DBVO 1DAOA 4MVJE 3ULKA 2DFDA 3C1TA 1YBMA 1VSUA 4NG5A 4BNWA 3PJGA 4I08A 4BNKA 5KKCA 1WW8A 4GVLA 4RVDA 3QW2A 2A4KA 2YV2A 4BQPA 5DF1A 1U8FO 3NJ8A 4Y9DA 3W4JA 3S8MA 1OC2A 2AMFA 4O1MA 3ZN2A 2X5OA 3VZSA 4NBWA 3G79A 4Z3KA 1PL6A 3JYQA 3WOHA 4Q3DA 5B4UA 3E6AA 4B7CA 2ZYAA 3ONEA 4EJMA 1YDEA 4E0BA 1EK5A 5L7YA 4CMBA 4CQMB 3PQEA 4ZGWA 2R2GA 3MTJA 4IQGA 3WGQA 1E7QA 4OIMA 4LN1A 4ZQHA 3V1UA 3DOCA 1QXSA 3DHNA 4FFOA 3HB5X 5ITVA 4NJOA 1SB8A 2O3QA 3UOGA 4R16A 3U4HA 4ALMA 3PRJA 5DBFA 4HV4A 1U5AA 3F3SA 3VKUA 5CDSA 3VH1A 2VN8A 3K6JA 2G1UA 3DFZA 1KVTA 3DOJA 3I6IA 3V1TC 3OM9A 4B8ZA 4MKXA 3JD1A 3TOXA 4BNVA 3PWKA 3AY6A 3GHYA 1NVTA 1DAPA 3GDFA 4FFNA 3BMNA 3VPFA 2D4AA 3O8QA 4MP6A 4OOEA 3N58A 5JY1A 4FDAA 1XU7A 3OETA 1QYXA 4YRBA 4CM5A 1Y8RB 2WD8A 1SOVA 3E5RA 3KSDO 4LRSB 5IDQA 3H2SA 1YQGA 2FHSA 5GY7A 4IM7A 3QVTA 3PJEA 3CSDA 2X8LA 4K6CA 2C7VA 3DB2A 4EUHA 3MJTA 1E77A 2D5CA 5A02A 3E48A 4JROA 3PDJA 4AJ2A 3QWBA 1VM6A 5JLAA 2GF2A 3AI2A 2OORA 2CSUA 3FRJA 3K5PA 4R1TA 1BTOA 1NFRA 3LC7O 1MA0A 2AHRA 2OMEA 2PLAA 3PHJA 4HY3A 4BNHA 5TX7A 4D3DA 1E1MA 4YAIA 2X1HA 1GADO 1KC1A 2JFGA 4JJGA 4YQZA 2CFCA 1I3LA 3AFNA 3ZV3A 3U4IA 1UXGA 1DOHA 1ZK1A 3HDQA 4RF2A 4CLOB 5T57A 4FC6A 2X5JO 1ADFA 4XCVA 1GQQA 1OOEA 3I6QA 3JQGA 3FN4A 4J1SA 5F1OA 3DBHB 3DOOA 4Z0PA 3LU1A 2QX7A 2ZATA 3K2BA 3GLQA 5G0TA 3ZU5A 5G0VA 1A71A 1BDMA 1IPFA 4C7JA 3BMNB 5TF4A 3O8QB 1K0UA 4U5QA 3WB9A 1E7RA 3LC1O 3X2EA 2Z95A 4WEOA 3ICCA 4GWKA 5JCJD 4ZICA 5KJ1A 3ZWMA 2C20A 1YONA 3INGA 2Y0DA 3ZGYA 1U7TA 3T7CA 4B3HA 4ILKA 3W8EA 2RIRA 1GV1A 4R54A 4CV2A 2UDPA 5COAA 2FR8A 3FWZA 3O9ZA 4OSPA 2DUUA 5FEUA 5KOIA 1PX0A 1MC5A 1OBFO 4NBVA 3KLPX 3KBOA 4RV9A 3DEYX 4FB5A 3OIGA 3DZFA 1HF3A 3OJEA 4YYZA 2BI8A 3IUSA 3NGXA 3WBBA 4DLLA 4CMKA 1DJQA 2BF7A 2ZTVA 4KWIA 2RHCA 3FN1A 4UVGA 1TB4A 4RJTA 5TGDA 9LDTA 3WR5A 1QYVA 2BRUA 1O5IA 4Y6PA 4WOKA 4BS9A 1I8TA 3PGXA 3HDHA 1GEEA 2O3JA 3FTNA 4DBVO 5COQA 3RBXA 3F4BA 2B4QA 4JJFA 2VOJA 4YCAA 2GERA 5ILGA 3OJOA 1ZW1A 1WNTA 4GX0A 2FOIA 5ES3A 4W99A 3W8FA 2PK3A 2YQ4A 1PJBA 3D3EA 5KJEA 4BKQA 2Z1MA 4BNFA 1Z45A 5A06A 2QRKA 3GHHA 1V3TA 4GKBA 1OAAA 4HKTA 4AVYA 2WE7A 4PG4A 2YDXA 3DAGA 4GBJA 3V1YA 2EKLA 1LQTA 1YB1A 4IS3A 3A14A 1GYQA 4KUGA 4LSWA 1VKNA 2X22A 1CQIA 3WQQA 1U1IA 1ZMOA 5T6BA 3S2IA 1ZJYA 1PZFA 5T8KA 1UP6A 1GZ6A 2GGSA 1LQUA 3B6ZA 1F8GA 1QSGA 4GSLA 2C59A 1UXHA 1VJ0A 1IZ0A 1PL8A 3MJSA 1KOLA 4J0EA 4Z6KA 1U28A 2AA3A 2I65A 4J1TA 1EQUA 3LT1A 4LGVA 4O63O 3ADPA 4RGBA 3RJ9A 2V7PA 4URFA 4DQUA 3BMQA 2QZZA 4YDRA 3F6YA 1GQYA 3W6ZA 4XGKA 1U3UA 1HRDA 3TF5A 1T25A 1NQTA 1H6AA 2H6EA 1DEHA 2NVUB 4YJHA 3LDHA 1CDOA 1Z7BA 1S6YA 2TMDA 3PWZA 4XQ9A 4CR8A 1A27A 4ID9A 4HADA 1R4NA 1ORRA 1HYGA 5EL0A 4YT5A 1E5QA 1ISFA 4I9NA 4WJZA 3VZPA 5F5NA 3GVHA 1O6ZA 3HB4X 3E1KA 5IG2A 4TRRA 3NDJA 1ZK0A 3WNVA 1F8FA 2NU6A 3C3XA 4RLSA 2DBQA 4OH1A 2ET6A 2AG5A 5JNLA 4O6VA 1DIGA 3T4XA 2Q1UA 3C85A 2H63A 2XXJA 1YJQA 3BZUA 1LEHA 4LSMA 1DB3A 1I24A 1PJQA 3JQAD 4XWYA 1NWHA 4CM6A 3SC4A 3JQCA 4Q3NA 4RPLA 3KZVA 2HMVA 4D0SA 5EQFA 5DNAA 3WJAA 1R0KA 3BMQB 1JVSA 5JAMA 1WWKA 3E18A 3F9IA 2OOSA 3I4FA 5AXAA 4MKRA 1E6EA 4YJHB 3W4IA 3I9JA 3TZQA 3JQ7A 3HADA 4PLHA 2W8ZA 3ASVA 3JYNA 1XELA 2GZ2A 1KEVA 1DIHA 2BMAA 3TJRA 4J4BA 4M54A 2NTJA 4BGVA 1PJCA 4OQZA 2DBRA 4QX6A 1EVZA 1BXGB 1UZLA 4M87A 2QRLA 2GN9A 4YT2A 2C5EA 1H5QA 1WMAA 4GAEA 1HLPA 4JK3A 3KYBA 1JDJA 1K6IA 4CMCA 4J43A 1DXYA 2X0IA 3HN2A 4N7RA 3H6KA 3AU9A 5IXYA 4WNIA 3DTYA 1I33A 3HZZA 1LSUA 4B79A 5LDHA 2PKQO 4ZHSA 2WYWA 2VYVD 3IC5A 2V6MA 4E2YA 2X7HA 1L1FA 3L4BC 3VVCA 4J9VA 2P4HX 1Q2XA 5ADHA 4FW8A 1P1KA 3GFBA 2CDBA 4OKNA 3U4CA 3K92A 1LUAA 5L4NA 4MVJF 2EKPA 3VAZA 3VHRA 1O95A 5U4QA 3I23A 3JD2A 3WYEA 4U7WA 1PR3A 1HE5A 2JJYA 2OUIA 1JKJA 1DDOA 3JQ7B 3NDRA 1E7YA 3UN1A 5BQFA 2GZ1A 1H9AA 3NT5A 1HDCA 1LC3A 5B12A 4RZIA 4PLPA 3OIDA 3WIEA 1DIRA 4YAKA 1PGQA 2I6TA 4AJPA 3JQ8A 5ICSA 1EUDA 3WDSA 5HWSA 4MDHA 4H15A 5IFLA 4K9DA 3MZ0A 2IZ0A 2HLPA 2LQ7A 2DPHA 1J6UA 2GCGA 5ER9A 2O23A 1J5PA 1NVMB 3CZRA 1T1RA 2Q4BA 4LVCA 1PS8A 2OP1A 4C4OA 2AQHA 4MIEA 3V2GA 3E9NA 4GI2A 4TZKA 2ZIZA 3VPGA 2AEMA 1QMGA 3NTRA 4HXYA 5L7WA 2XOXA 1A5ZA 1XGKA 3CUKA 1EE9A 2HU2A 1SOWA 1UZNA 2BI7A 4UVDA 4BB6A 2JFHA 1X0VA 2JKVA 3CXRA 3LVFO 3RVDA 3HE3A 3ZNPA 2NU9A 4YAEA 1WP4A 5JBIA 4OXNA 2NVBA 1TT5B 4YPOA 3O4RA 3GA0A 3GDGA 4AFNA 2HAEA 4Z0HO 1K6XA 4YAGA 1GAEO 4EI2A 3PFFA 4MVJA 3CEAA 3GGGA 1YH3A 1PQWA 2AQKA 4YTEA 4EITA 7ADHA 2BH9A 3FR8A 2PD3A 4JP3A 4KMSA 4W82A 3JQ8B 5ER6A 3OICA 3PIIA 3WS7A 5THQA 1PGPA 4K6FA 2ZB8A 5TC4A 4QT0A 4EEZA 3JV7A 1Y8XB 3G1UA 5C7LO 3DAFA 3SBOA 3WGZA 3GN1A 3GNTA 1NTOA 3LYLA 3K96A 4XQCA 3DONA 3BTVA 1Y9EA 5A9RA 1R66A 5FI3A 4WK6A 1WPQA 4J4HA 2ZTLA 3G1TA 4PN3A 1V35A 5KTKA 1HE4A 3OIFA 1WDKA 2AQ8A 3O26A 3D5TA 4GX1A 5B37A 3Q9UA 1PZHA 4EYEA 1T4DA 3ETDA 4L4XA 2EJWA 1WMBA 5IZCC 4A27A 2HSDA 4QECA 2DC1A 2PGJA 2ZJ0A 4GLOA 4AJLA 5HS4A 1XWFA 1WVGA 4CMEC 5KVQA 1KBZA 1M75A 2HQ1A 1V3VA 4R9RA 2PH5A 4PLWA 3GH3A 1OMOA 4P4LA 5ITWA 3DHEA 1QG6A 1UAYA 3UCXA 1KVSA 4QTZA 5JO0A 1HYEA 3AM4A 4RDHA 3IDSA 2D2IA 5KIAA 1PL7A 1CYDA 4NK5A 1OI7A 3S2GA 5U9CA 4KQXA 4J3FA 3RC9A 1BXKA 4PLYA 2Y67A 4RZHA 2Q1WA 3FR7A 1HDRA 4BGUA 4E31A 1IY8A 1E6UA 4K28A 4GSKA 1M67A 2Y05A 3UXYA 3L77A 4J49A 4PRKA 1PEDA 1UJMA 3IIEA 3GNSA 3R1IA 1K5HA 1NYTA 2HO5A 2OO5A 2NU7A 2WD7B 2ZKLA 3VTFA 3U4DA 1XR3A 3P5SA 3COSA 3T7EA 1KY5A 2X9VA 4IQ8A 1P33A 3RBVA 2HDHA 1XDWA 5EESA 5GZ6A 3NV9A 4XQEA 4FFRA 2QW8A 3WJ7A 5T67A 3B20A 1YDWA 2W2LA 4KOAA 5FYDA 4DQVA 5K9ZA 5I9NA 1HZZA 3E9MA 5KJ6A 3TFOA 3JD4A 1IE3A 4JN6B 3H5NA 4D42A 3AJRA 3BAZA 2VNAA 4FFLA 2NU8A 5FWNA 1ULUA 1N7HA 3HJAA 2VT2A 4IMPA 5IN5A 1QYWA 3ZI0A 1HXHA 1C3VA 3M2PA 3NTQA 2X0NA 1A4UA 1IHXA 5CAEA 1NQAO 5KNLA 1E0DA 4FD3A 4OSOA 1PIWA 1MG5A 1NWCA 2X5KO 3IJRA 4CMGA 2EGHA 2PZLA 4XYBA 4W4TA 5EERA 1Z73A 3L6OO 4W6ZA 5T64A 4DMLA 4BKUA 5IDYA 3GAZA 2BLLA 4R5HA 1RM3A 1X7GA 5A9SA 1Q0HA 1BDBA 5B4VA 1U3WA 1V0JA 2D8AA 4U6SA 3W6UA 5C37A 3UCEA 4RDIA 3H9GA 4TRJA 2A35A 1SCUA 2O3RA 3WG9A 2FN7A 1GD1O 1W6UA 4W7IA 4NI5A 4BNGA 1WAMA 1FF9A 1D4FA 2A92A 4WCFA 1GV0A 3GRPA 5IDWA 2Y66A 3I4CA 2VNSA 3OA2A 3PHIA 4BO8A 1YL6A 3GEMA 2PY6A 5DT9A 2HMWA 3GZNA 4KUHA 4XKJA 4Y98A 4EUEA 4YRAA 3TZKA 2IEDA 1H2HA 2FR0A 5IAAA 3AI1A 5G4KA 1LRJA 4TKMA 4DREA 2WSBA 3INTA 3F1KA 4AG3A 3D0OA 2VWGA 3BTUA 3TWOA 1YOVA 1UAGA 5DOVA 3WGHA 4DMMA 3K31A 1Q0QA 4Q3EA 4AJOA 2J3IA 1NXQA 1ZO8A 3JQDA 3MWDB 1D3AA 4AJNA 4Z9XA 3Q0EA 4CQMA 2CVOA 4EZBA 1P3DA 3W4KA 4AJIA 4CLDA 1RPNA 3X2FA 1Y1PA 4BO5A 3I9KA 3GVPA 3ZNOA 1NP3A 2OZPA 1PQUA 2VOEA 3O03A 1E3SA 2YHIA 4W9NA 3A9WA 4CM7A 1KIFA 5F21A 1SMKA 4GPD1 1SNYA 1TT7A 3JQ6A 3ZW9A 1TVEA 3PJFA 2HRBA 3JQBC 3UHAA 3NEPX 1KVRA 3V5NA 1HE2A 3ZHBA 4PLVA 3OH8A 4DIFA 3GZNB 4FR5A 4FPXA 3H2ZA 4F45A 2QZ9A 2Q1SA 5BNIA 3L9XA 2DAPA 5G4KB 3W1VA 4DPMA 3EDMA 1A7KA 1NM5A 1L7DA 2CY0A 4Q9NA 1U9JA 4D46A 2P5UA 1YOVB 2ZB4A 2B36A 3D4PA 4L75A 1XLTA 1Y8RA 2PFGA 2YYYA 3AUUA 5A3VA 5LC1A 2EW2A 1QORA 4LCEA 1RYDA 3DMTC 3TRIA 2J3KA 3I52A 4BKRA 2XAAA 1HE3A 5DDIP 1Y81A 1LLQA 5TRTA 3JQ9C 1HSOA 2JFFA 3LZ6A 4II3A 4N18A 1EMDA 2P5YA 3K9QO 1SPXA 3HDYA 1AHHA 1JWAB 1XHLA 1M2WA 1YBAA 1VE9A 5AVOA 4WLFA 4BO0A 2QHXA 4ONEA 2O3UA 4RLHA 5F1PA 2YHIB 1RWBA 1EEHA 1NNUA 4OQYA 3ONHA 2J5RA 2PH3A 2C07A 4CLOA 3PHGA 4TWRA 4OXKA 1KVUA 4IPTA 3KB6A 4LMPA 3DBHA 1D8AA 4HFRA 4UVEA 4G65A 2IE0A 2Q2QA 4CLRB 3HSKA 3PXXA 3UCFA 1ML3A 2QRJA 1UXKA 4ZQEA 1VI2A 5IN4A 4S3MA 1J4AA 1XQ6A 3D5QA 4KP7A 1EBUA 4E2XA 1ZEMA 4R3NA 1VL6A 3KSZO 5CPFA 1UXJA 3LC2O 5I9LA 3RUHA 1BHSA 3E8XA 1EFLA 2DT5A 1O94A 3PEFA 1R4MA 4PG5A 4BIIA 2CMDA 3DZIA 3PK0A 5DZSA 4Q3AA 2V6BA 5G4LA 4B4UA 4EGFA 1PS0A 4E30A 1DRVA 3AM5A 4BO1A 2JL1A 4HNGA 4R3WA 3DZKA 4MVJM 3B1JA 3KYDA 4B4VA 1NPYA 2R6JA 3G0OA 2G82A 1G1AA 3QP9A 5CDGA 3ROQA 2Y0EA 3LF2A 2W90A 1R6DA 3NT4A 3CPSA 3ZWWA 1I01A 4CMAA 3KHUA 1MGOA 3RU9A 4H16A 1U2GA 3GY0A 1LLUA 2O3SA 4MKZA 3PGJA 5DCWA 4RF4A 3U5TA 1LA2A 5A5FA 1HETA 2W98A 4D43A 3MOGA 4A2CA 4B4WA 1T4BA 2I66A 1HZJA 1LDBA 1YQDA 3BIOA 1CERA 3ROMA 8LDHA 1P74A 3E03A 1JAXA 4CLEA 4ZRNA 3NUGA 4DC1A 2JAPA 1N1GA 3RUIA 3AY3A 3IJPA 1Z75A 2DU8A 2Y1EA 5JAQA 5C3MA 1P9LA 4DYVA 1FDVA 2P9CA 3GVXA 1EDOA 1RM5A 1R4MB 3A06A 1MUUA 1ZSNA 1MV8A 1LU9A 1IB6A 1GUFA 3OJFA 4BO3A 5B1YA 3BXXA 3KSUA 3OJLA 1Y6JA 2VRCA 4FS3A 5JC1A 2EP5A 4H7PA 3EVNA 1B26A 3KYDB 1VPDA 4D3SA 4IJVA 5MDHA 2BFMA 3CMMA 2EIHA 4PCVA 4RVHA 4RO0A 2V65A 3IP3A 2X4GA 3NKLA 3IKVA 4QFCA 3AUSA 4JLWA 2DBZA 3RD5A 4G81A 5TIIA 5IXSA 1CEQA 4BNTA 1IZ9A 2H1SA 1B3BA 4L73A 1PWXA 4YA6A 3I3OA 3FBGA 5G0WA 2ZB3A 2BD0A 3E82A 4ALNA 2B0JA 4CV1A 5THKA 1YWGO 2NVUA 2BKAA 1CJCA 2J5QA 4RPHA 1HSZA 3GOHA 4DBZA 2PKRA 2Q50A 1AGNA 1H94A 4L8VA 1DO8A 4UUPA 3H7AA 1CWUA 1ZCJA 1ZK2A 3GGOA 3INRA 1B14A 2QG4A 5FFFA 5IJZA 1R0LA 3QY9A 2C82A 3L6EA 1EUCA 3ASUA 1Y7TA 1GPDG 3F5QA 1B2LA 4CLHA 1L7EA 3IUPA 2DKNA 1ENZA 3S55A 2BFAA 3ITDA 3FTPA 3ZU2A 4A5OA 3CMCO 4RORA 4PLFA 3F4LA 4CM9A 1P77A 4JQCA 3I9OA 4ND2A 1ZUD1 2HK9A 2DUWA 1VJTA 3ZWCA 1Q0LA 1O8CA 3IAHA 3HDJA 3WTCA 1I36A 4CUJA 2ZQZA 1K89A 4XRGA 3DBLA 1ZFNA 1G0OA 1OFGA 4YJFA 3FNGA 5L4SA 2O48X 1GPJA 1HLDA 4XA8A 4D45A 2X9GA 4CM3A 2VUSA 4AJ1A 1MXFA 3NDIA 3L9WA 5K6AA 3RUAA 3WGOA 1QLJA 5JFOA 3GMDA 4A03A 3PZBA 5L40A 1QRRA 4J2HA 2NM0A 3BYZA 3ZWNA 4BUCA 2ZTUA 2C0CA 4A7PA 2EKQA 3RFTA 5LDGA 4PZCA 4KDFA 3LT0A 3ZWVA 1BXGA 4IDGA 4GKVA 2D3TA 2PD6A 2AG8A 4OKIA 3TSCA 4UAGA 1W0CA 2JAHA 4HP8A 4R51A 2VYNA 1I30A 4UUOA 1PGJA 3PHHA 1SC6A 2WDZA 1M76A 1BG6A 4BNNA 4FSHA 5JO9A 4PLGA 2Q2VA 2FSSA 2AXQA 2P9GA 1IHYA 1XEAA 3QA9A 3IKTA 3DBLB 2G76A 3OHSX 4YJFB 1LNQA 3IS3A 4GQAA 4IIUA 4PLCA 3NRCA 3ROPA 4DPKA 3ANLA 3PVZA 2D0IA 3P2OA 4JBIA 2G0TA 4GMGA 4CM8A 4UEKA 3HFGA 2JHGA 1BVRA 5F1KA 5BSEA 1IUKA 4YJDA 2NNLD 3LK7A 1GUZA 2R00A 3ANNA 5L4LA 1LDEA 4J9UE 3PZRA 1YVEI 2EERA 2Y99A 5BSGA 1YQXA 1E6WA 2Y1GA 4RPJA 1YO6A 2HMTA 5I8ZA 2WJPA 4ZU3A 1N9GA 2GN6A 4PIVA 2D1YA 1B15A 4CMJA 1NQ5A 2QYTA 2O3TA 4P4NA 5GMOA 3EAGA 3ONFA 3OECA 1ZMTA 5T8KC 3TPCA 1ADGA 1U2DA 3D64A 2C29D 1IYZA 4OGWA 2HK8A 1NR7A 3GUYA 3FD8A 1JKIA 3C24A 1K2WA 4OHUA 3AY7A 4XDZA 2C5AA 3VH2A 1D1SA 2P91A 4IDEA 1XQ1A 4ZQBA 4IMRA 3G49A 4GVXA 4GX2A 3ENNA 3GVIA 4CMIA 4I5FA 5JCJA 4IXTA 4OAQA 3ROKA 4RVGA 3Q6IA 1IPEA 5FQ2B 3AUAA 1B8PA 3RJ5A 2EWMA 4W7HA 1E7SA 4J4TA 2E37A 4DGSA 1EZ4A 4JIGA 5GZ1A 4M86A 4CODB 4DL9A 4BV8A 2FRDA 2GNAA 3PYXA 1GEGA 4MOWA 2Y1CA 5BT9A 3S2EA 4CM8B 2EV9A 5L51A 4BKPA 3DL2A 1TT5A 5EMHA 3VDRA 4OMUA 4CM1A 1VL8A 3H9EO 2XF8A 1BMDA 3KYCB 1KY4A 2EJVA 1D7OA 4NK4A 1VC2A 1Q7GA 4Z9YA 1EQ2A 4L76A 4R1UA 2C2XA 1N9GB 2Q45A 3TQHA 4BO9A 4O5OA 3U62A 4DC0A 3FI9A 1VL0A 3RKUA 1X15A 3ZZNA 1UDBA 1VSVA 5I7FA 3EZYA 3PPIA 4J90A 2FPGA 2FMUA 3H4VA 3FSRA 4YR9A 3F46A 4FC7A 4ND3A 5MGBA 5TJ9A 1UP4A 4Q3CA 2ZYDA 1BW9A 4NBRA 1T2EA 4XDYA 4E2ZA 1KERA 3ZV4A 2OFPA 2J5KA 3BTOA 2Q1TA 2P9EA 1WDLA 2F00A 5HS6A 4CMIB 4ZN6A 1T1SA 3R6DA 3MCVA 2X0JA 4E5MA 3EVTA 2VZ8A 2G5CA 2YY7A 3SXPA 1ZK3A 4HFJA 3R0IA 7MDHA 2AE1A 1AN9A 3OEWA 2J8ZA 3GK3A 4WPGA 1GZ3A 5ICMA 4OYRA 4XIJA 1V8BA 2GDZA 2NVWA 2X9NA 4O59O 5G2OA 5AXCA 5TJHA 3ST7A 4J1QA 4BKOA 2O2SA 2VRBA 2CF5A 4AJ4A 1ZK4A 5A3JA 1HL3A 2B35A 3V2HA 4U6QA 5KVVA 4GGOA 1E1LA 3EC7A 3DZGA 4I9UA 4DIOA 4E3ZA 3WX0A 2GASA 2FY8A 4J7UA 2HKIA 3OF2A 4KDEA 2E82A 1FMCA 3DWFA 3V2UA 1ADCA 4D7AA 5BNTA 3C8MA 4IIVA 4L74A 1P1RA 3ZNNA 4NU6A 1R16A 3RIHA 4XRRA 1SB9A 4WLUA 4CQMD 2IRWA 2VZ9A 4OM8A 1XYGA 3K8ZA 1I32A 1C0LA 1N7GA 4E5KA 4KZPA 1BW9B 3BHJA 2PGDA 1KEPA 1U4OA 3H5RA 5EQDA 1W8DA 5IZ4A 4FJ1A 4DPLA 4BO6A 3WFIA 5C7IO 2WD7A 1QV7A 1ZH8A 1ZSVA 3H3FA 2PX9A 4K1LA 4WLVA 2VHYA 3MJCA 4BNYA 2EW8A 4ALLA 3PQFA 1QR6A 1M66A 3MOIA 4NBUA 1N92A 2BELA 1PSDA 2JHFA 4YAJA 4JX8A 4DWVA 2NV6A 2X6TA 1MX3A 4ESOA 2B37A 3LLVA 5U1PA 2QQ5A 1AUPA 1PJTA 1EDZA 4QEDA 1ONOA 3QVOA 5CDTA 1LLDA 5LCXA 3EHEA 5CDUA 2HMSA 3KEOA 3I9NA 3JCZA 2J6IA 4JBGA 4XYEA 2B69A 3OP4A 2GZ3A 4DQXA 3Q9NA 3QHAA 3JQAA 1J0XO 3DZBA 3STHA 1EVJA 5A4DA 5JDIA 5JDCA 1P1JA 1SEPA 2CDCA 3FNFA 4K26A 1EE2A 3WNQA 5A1TA 4J0FA 1RYEA 3FCOA 4Y6SA 1PR9A 3MTGA 5CG1A 2POQX 4FQ8A 5TS3A 1H0KA 2UV8A 5ILOA 1V9LA 5KJCA 4D44A 2V6FA 2FPIA 1R12A 1XG5A 3GF4A 4DRYA 5BR7A 2PKQP 3SEFA 1P31A 3K73O 1BWSA 1YL5A 4MVJI 3VTZA 1XKQA 3FWNA 1Y5MA 1UDAA 3ABIA 5L7TA 5CG2A 3WXBA 3I83A 2IXAA 3AOEA 2DFVA 2RH4A 3F47A 4EDFA 1Q7CA 2PTGA 3JQFA 5DULA 3VZRA 5HTOA 1BXZA 1GR0A 4NBTA 3WIDA 3AWDA 2VHXA 2D59A 3PIDA 5EIOA 1X1TA 3FHLA 4Z9FA 1T2DA 3TFQA 3UH1A 2VWQA 3GEGA 3KUXA 1JAYA 1F0YA 2IYPA 3RUDA 1HDOA 1E5LA 2E48A 5KVCA 1E3WA 2ZCVA 3DR3A 5I9MA 4TVBA 2VUTA 1F14A 3PP8A 5FI5A 5DBIA 3WYBA 4BV9A 1H93A 2YUTA 4HX5A 4JNKA 2Y93A 3ZWPA 3F1LA 5FF9A 1GUYA 2VYVA 3JQAB 1YB4A 4B4OA 3ZWAA 1T2FA 1QLHA 1QYCA 5A04A 2WYVA 1LTHR 2DQ4A 5TT1A 1DSSG 3H9QA 4RQTA 4TMFA 2HUNA 3RI3A 3CIFA 3TN7A 2XPCA 1BGVA 1FDUA 1E3EA 4YACA 3ICPA 1H6CA 3ZCXA 3PI7A 1P0FA 2Q46A 1KETA 2AW5A 3KOUA 1E1NA 2BFOA 3RBZA 4BNJA 2GRAA 3D1LA 1MB4A 2BGKA 4Y8VA 1V6AA 3QWIA 5COBA 4RVFA 1E3JA 4UEJA 3GRKA 2O2YA 3WGYA 1GQ2A 4AJEA 1SO8A 1HWYA 1E3WB 5L53A 3BMCB 4IDBA 1X13A 2P68A 1ARZA 2UVDA 1F06A 1U4SA 3ETGA 3MWEB 5F3RA 5AXBA 2OBNA 1DFHA 1WZEA 2YV3A 3D4NA 2BGMA 3HN7A 2AEFA 4WLOA 3HNPA 4CMHA 4RPKA 1C0PA 1DFIA 1ENOA 5G0SA 4GLLA 2VRCD 3QWHA 3GG2A 1DRWA 1GCUA 3R3JA 4XZ3A 1HTBA 1PGOA 5JXWA 1N8KA 4PVCA
chains in the Genus database with same CATH superfamily
3P2EA 4M0PA 3K4JA 4NV1A 1BKDR 1KSGA 3X1DA 4CPDA 4ZA2A 3HM5A 2F3SA 3HCCA 4WCVA 3ZQLA 3LHDA 3DTVA 1A1SA 3VC7A 3DAPA 4B71A 4DWWA 2JTVA 4O4HA 5J2TA 3ZY4A 3DE4X 1KXZA 2CMPA 5I7UA 1K6EA 4BB5A 2F5EA 3NWTA 2R47A 4DYDA 5JPDA 4JXKA 1T4GA 4UDOA 3USES 4UTOA 2WIFA 3ABTA 3SX2A 1MKYA 5GONA 3NNDA 4JBWA 2WMNB 4OGLA 4KVFA 1SMYF 1D8TA 4R5MA 3QVWA 1C05A 2WJZB 5K3BA 1IDZA 4KC0A 2NT4A 4P8RA 1ZI9A 2C83A 1RP7A 2YIVX 3AFHA 1YGYA 2ZBKA 1HG0A 4WLNA 5KTRA 1NFQA 4N5LA 1P5RA 3EGIA 1P75A 1SFOJ 4Z2AA 3TRKA 1XDSA 2I4LA 3KP5A 2Q3MA 5EPEA 1R5GA 1HTWA 5L3ZA 1JE1A 5EZGA 1SFKA 3F72A 3N2NA 1EAMA 4RGYA 5JPIA 2I29A 3MTAA 1EIWA 2E1MC 2VC2B 3EDPA 4PPGA 1WHUA 2PV0A 1D4ZA 2ZT8A 3URKA 1A8IA 4R6WA 4X63A 4NWIA 3RQIA 4CF7A 3O4IA 1CS4C 1LVHA 4IRHA 5SYMA 2F5VA 1HDGO 1R18A 4KGVA 4R69A 3GFVA 5D4RA 5FL7D 1EVLA 4B44A 2XPWA 1A04A 2K6PA 5B2ZA 4WKPA 1M1ZA 3E2IA 2B8JA 4DN6A 3H8JA 2W6IA 4UAUA 4FCWA 4W1UA 3INNA 2C61A 1SG6A 2FETA 3KZ1E 4C3ZA 2I76A 1U7UA 1EFPB 4S1OA 4EPRA 3OYIA 1G5HA 4DA8A 4N3CA 1F38A 2XVCA 4AQDA 4F46A 2G63A 3GZ4A 1ISSA 2RHDA 3BSSA 4GLFA 1OC4A 4E4TA 4JSYA 2IV7A 2BY3A 1Y5RA 3JPWA 3D7NA 4AMZA 5I7WA 3BJIC 3B6MA 4QPJC 2AKAB 1CS0A 2XCLA 4E4HA 3ABMH 4PZJA 4F2HA 5DBGA 1LPSA 1Z39A 3P27A 5EWMB 2JIOA 3FJYA 3MG9A 4HATA 3CO5A 3C1AA 1X1CA 4K6MA 4NQWA 1CQIB 4IIBA 5JRJA 4MXDA 4NV3A 3KZXA 1NC1A 2JUGA 3MXTA 2OCPA 4B73A 2XE7A 2WAAA 3NU1A 5CPRB 4ZCQA 1Z34A 1V1MA 4TVOA 1SIWA 4LYAA 5JZBA 2Y4OA 3EQ8A 4PFJA 3ANYB 4ZVVA 1SVMA 5CA1F 3TZCA 1NOKA 1VRCA 2DPYA 3R0JA 1BGXT 1B0AA 3G2QA 2ZYWX 1W1WA 2OQIA 3I5YA 5JY6A 1JE8A 1XL0A 1ABBA 3NBAA 3RNOA 1NSFA 1M6WA 1E7WA 1JEEA 2C9YA 1P1CA 1SUSA 4RJKA 4ZJUA 1MU0A 2IYOA 3DTTA 4YQYA 5C7YA 3AUFA 2VBYA 1Z6RA 1B41A 1XS9A 3N4MA 2DF8A 1RWQA 2Z16A 2HS5A 1LSOA 2NZXA 2XNHA 3TZ6A 1SA0B 1T2CA 3WJ1A 5CA1A 1IJKA 2CQXA 2R6HA 4AZ0B 3ZLUA 2QUAA 5ECGC 1USGA 3CGWA 1MAAA 4JR2A 4Y9RA 4GL4A 4GDFA 2HWYA 1OTYA 2VH1A 3SGLA 3ZU4A 5CD9A 3UB2A 5BWNA 1KONA 3WHBA 4F2GA 4QQ8A 1DIAA 4WADA 2YZNA 4A73A 4MI6A 1WZIA 2ZJAA 4JA0A 4MWDA 2Y1LA 4PO3X 2VSYA 2DA7A 1ZL2A 1C14A 5J23A 4BVEA 2XB6A 1HYBA 2I3DA 4G5HA 1WQ1R 2X86A 1R6UA 3QK7A 5IVHA 4OI0A 3TGLA 1VIYA 1HLGA 5KWEA 1T0PA 1DUXC 3RUCA 2QAIA 4AUNA 1YJXA 5JECA 2CNBA 2OV3A 1L7XA 2FP4A 2JSPA 1V45E 3RC3A 3B5IA 4B9EA 4K9OA 4CV3A 1X4PA 2QTVA 4TVKA 1ZPDA 2WD9A 3RAJA 3ESCA 5GGYA 4KZKA 3MWEA 5EIHA 1YCDA 2JA5J 2PVSA 2E2IJ 5JHFA 2NADA 4PO8A 4C4PA 4IZ6A 3V80A 1LLCA 3JQEA 5EZSA 4Q3LA 3PXUA 4A0YA 5IKMA 2Q1XA 4O2BF 1IVYA 3Q2KA 5I7SA 4D79A 2A9FA 2PS9A 2HQRA 1UK8A 4EHNA 1A2KC 4JQFA 4QRIA 1K8RA 1MJAA 4BNXA 4EA9A 2V0NA 4UTVA 4IJAA 2CLKB 3BCUA 5ALLA 1OXUA 5E17F 2V7FA 1F2UB 1W30A 1T2UA 4PAGA 1UMCB 1ECBA 3WGGA 3D6JA 1Q2UA 1N6RA 3QPWA 2PWBA 5I9SA 2J0QA 2HW8A 4YJGA 5JASA 1TA9A 4N3AA 2WICA 2GBIA 1Q0RA 4MUBA 4M3DA 1ZVMA 4LF9B 1NPDA 2XYHA 2J30A 3F6SA 1GY8A 1PJ2A 1MJGA 4MQLA 1X7HA 4ZQGA 3LUKA 2R4UA 3D4IA 3N97A 4AL4A 1ZISA 2BPOA 3UAGA 4A6DA 1DAOA 4JYZA 3B2NA 3FKSD 4HLYA 5DF1A 5C8YB 1SZPA 5ICEA 2OD9A 3JALA 5TS2A 5SYAA 4CMBA 3PQEA 1DS6A 2BBSA 3DOCA 4BFYA 1EI9A 1S72I 2J33A 1L9KA 4ZDWA 4N9IA 4HV4A 5HX7A 3UGQA 4HL6A 1M72A 3VH1A 2R11A 3I6IA 1FLNA 4NOJA 3VR4A 3S27A 3P0HA 4Q34A 5EJ9A 1IC6A 1RRGA 1BO6A 2R25B 4QBGB 1IFXA 2PS3A 1JAIA 4LGWA 3AXSA 1KGDA 3L8EA 3U7HB 4IM7A 3DJYA 4YLEA 1E0SA 1KI2A 5G41A 3MJTA 3E48A 3EXG1 4DZZA 4V3CA 2ANBA 2L82A 3K5PA 2F4VD 4WZBE 3PHJA 1KFKB 4ZQCB 3AFNA 5KNBH 2Q8NA 3T5CA 3C8DA 2AZMA 2EG5A 4QDXA 4X3PA 4AXXA 1SUEA 2PFBA 2NPFA 4WEOA 1JGSA 4TWBA 4ZICA 5F0HA 3SQOA 2X40A 3ETHA 2QX6A 2XGMA 3M3HA 3JSOA 4OSPA 5AIAA 1THGA 1OBFO 4IMIB 1SRQA 1QIJA 2C4WA 4P35A 3DEYX 4TUYF 2ZWMA 1PV2A 4O3FA 1NNI1 2RHCA 3KSBC 5TGDA 4Z7QB 1XTPA 1UZAA 4H0CA 1MAHA 1YKGA 3HDHA 1TQPA 3I9V2 5IOZA 2B4QA 2WWHA 1JNYA 2BY2A 2PTHA 2YS9A 5LA6F 3HYTA 5ES3A 3CX3A 3ZGLA 1NLZA 5MHTA 1YR1A 4CEHB 3PV0A 4HUTA 2FFAA 1IHPA 2CJPA 2Q6OA 3K05A 4IS3A 3RE1A 2R8XA 2HWWA 1I1NA 1VG1A 1N0VC 2XAHA 1SKYB 5T8KA 3HPGA 3CW2A 1PL8A 1SHZA 2NSHA 1B74A 2OAQ1 4DSZA 4IW3B 1NZDA 1P19A 4MUNA 2QZZA 3W6ZA 4D9GA 1X3LA 5TY0A 1KJQA 4Q93A 1QS0A 1QPGA 5LA6A 4BFUA 4Y1RB 1REPC 3HB4X 3Q8MA 2IYQA 3RYFB 4DJAA 3MD0A 3P9XA 3GT4A 2VSNA 3BJZA 3QBEA 3L41A 3LUGA 1LEHA 4F6RB 2GYUA 5EJ6A 1UWCA 1MMNA 3IKJA 1NVKA 2A05A 2JVGA 1CB7A 1D5WA 1Y8ZA 5E4JA 4H1TA 5DM7F 3DH3A 3L84A 5AWFC 3O74A 4E03A 2J7PD 2KBFA 1JEYB 1FC3A 2X8AA 2BMAA 1KL7A 1VHWA 3AL2A 4HH0A 5TARA 3LA7A 1RHJA 4FFSA 1H5QA 1BMFA 1GR1A 5F08A 4WNIA 4ZJYA 4XTRA 5JPCA 2WYWA 2VYVD 1R9NA 2X7HA 1L1FA 4E14A 1X19A 3O1JC 1O97C 1Z7UA 3U4CA 3IA2A 5A0TA 2JJ2A 4Z9AA 1OCOH 3I23A 5C81A 4DDWA 3EFHA 2M1ZA 1YBHA 1HDCA 1LC3A 1UWVA 1FVFA 4GZLA 3UK2A 4P98A 2OQRA 2VLIA 5F35A 5ESRA 3RYCB 4LVCA 4AIIA 4C4OA 4NCHA 1U9ZA 2O3FA 2WJ4A 4ZO9A 5B5SA 2DPUA 3RPQA 2QRQA 1HC8A 4KNVA 3UJBA 2JFUA 3FOAA 5CCDA 1QPZA 2XAGA 2WPDA 2W22A 1V8FA 1PNOA 1VJ5A 4EI2A 2NUPB 1JBEA 5FPKA 1JPUA 2XQVA 3BCHA 1EGQA 3JQ8B 2PN6A 3HTXA 5HGJA 4HO1X 4K6FA 1T0UA 1BQEA 4ICIA 5A9RA 4CNBA 4GMHA 5FI3A 2E35A 2B61A 3IEMA 1AK9A 2NV0A 1YU9A 4MR8A 4EYEA 3OR1C 1CLEA 1WMBA 4EJOA 2XBUA 4YCDA 1MC1A 1M75A 5HNFA 5ALUA 3Q5GA 1QG6A 2FP3A 3AM4A 2RCNA 3ZHUA 5K0CA 1CYDA 4HHEA 4J3FA 3QLVC 2O20A 1BEZA 3S2DJ 4HAYA 1M67A 2OE2A 1E2BA 5EMMA 2P2YA 4GFDA 4J49A 4QNNA 3K4PA 2IIBA 2BEWB 1TDJA 1S9HA 2HDHA 3OAAD 1APLC 4UBLA 5GZ6A 5I5GA 4FFRA 2IH5A 5IT9K 1R3UA 4FHGA 4C6TA 4YRVA 2EINH 1CD5A 1KQ0A 3RS4A 1POWA 3JVDA 2B1GA 4G8DA 1EZZA 4BZQA 5CAEA 4UUSA 4LJYA 1A7UA 5EXDA 3A4TA 1BE0A 5EERA 4GMDA 1OPXA 1NI3A 3EXIA 1V7PC 4LB6B 4UZSA 5TMBA 5AK5A 4RDIA 3HZRA 1I39A 1B8IB 4AF6A 1Z1DA 4WCFA 3GBPA 1A50B 4KWEA 4R79A 4LKOA 2UV1A 2XT9A 4EUEA 5DHPA 3TZKA 2ZSIA 3U9TA 4DR4B 3PGMA 3G68A 3F1KA 5AIPA 1OV6A 4CCOA 4AYBN 1XCJA 4RC9A 4XX1A 4UB8C 1N9ZA 4CLDA 2K9NA 1C0EA 1TUIA 1GZ5A 5DYNA 5FRNA 3HKBA 4OHKA 3FTFA 2XDWA 1SNYA 2YSRA 4Y0AA 2PLFA 1BOAA 1W0JD 1QAOA 2JLCA 1U9JA 4UDNA 1A9TA 5FORA 3BK2A 2K9SA 4EB3A 1HNWD 3BIJA 3BUSA 2VHQA 4LCEA 4BKRA 4IAOA 4NNPA 3COWA 4QDKA 4UQLA 3DBIA 2M0CA 4PHTA 2XNSA 2Q5EA 5KYKA 1GV2A 2W2TA 1G2PA 3TS1A 3SQMA 5F7OA 1QRTA 3BXEA 1LE8B 1WBJB 4F85A 1DPRA 2FJ1A 2XF6A 3CVJA 2CEKA 2QL5A 1UXKA 1UBRS 5AI0A 3U4GA 1J4AA 2CE7A 4K40A 2Z83A 2Y0MA 1R4MA 2GBPA 2CMDA 4EAAA 4E30A 2B8WA 4MI3A 1X1PA 4Y3OA 4PQEA 2BGNA 2ZVQX 2ZRAA 3IEIA 2ZRIA 4X65B 4MV3A 5BN5B 3O91A 1U2GA 3S8YA 4GNKA 3I04M 5CJPA 3FYUC 1JG3A 1J8QA 1NQUA 3I5XA 2GZDA 4NVRA 5EGNA 4C4XA 3KCCA 2CNLA 4BRWA 1S3JA 3EVGA 1EDOA 1AGXA 2NSYA 2C7BA 1ZS9A 4H35A 2VRCA 5H2FC 4AU7A 3BDIA 3T5BA 4ZDIA 2XYVA 3IKVA 1P4SA 4QFCA 4BC1A 2AXEA 4V0RA 4V03A 1JUPA 2B0JA 2JW5A 3KP2A 3T06B 4WN9A 1VI0A 2NVUA 2LY1A 2Q50A 4TGLA 1XMJA 2ZS9A 4JYPA 1YBFA 4LXIA 2PYDA 5IJZA 3TTWA 4BP9A 3MOSA 3W2TA 2XWJI 2RN7A 1TOAA 3R9IA 3B9BA 3FTPA 2OZ6A 5J1UA 4TTSA 1XD2B 1RCUA 1O8CA 4G5RA 3LBYA 5L6MB 3LLMA 1W36D 2PUGA 3A6JA 2X9GA 4ML3A 2IHBA 4LG0B 4IXNA 2HM7A 1STOA 4ME6A 3LT0A 5ECDA 2HPAA 1TO1E 1S4QA 1NUAA 4IDGA 1SZDA 4R51A 5DHTA 1RPJA 2XROA 3F8SA 3IPXA 2OZVA 4A36A 2GZAA 3IAM6 3IOEA 4CVNA 5F1KA 2ISQA 3CCFA 3VO2A 5A4AA 1U5TC 3CXUA 3AILA 3HJCA 3RYRA 5AVVA 2PLNA 3VI3B 2PVCA 1ZMTA 3TPCA 5C1PA 1JTYA 4U2DA 4B3XA 2P91A 2AX4A 1QCZA 4GVXA 4YYEA 2DBBA 3IAS6 4RPIA 4I6JA 5FQ2B 4J0KA 1LEAA 2Z4TA 4XJVA 3M70A 4AC9A 4EEFG 4IRGA 3OOUA 3OOYA 2J4FA 1AOXA 3SKVA 1CJKC 4R1LA 2B2XA 2TMKA 4F9TA 3K0EA 4X0EA 3DV0A 5CLQA 4C6SA 1AMOA 1EGVB 4U8HA 1AWCA 2QTNA 2R6AA 3ZLTA 1K83J 1OE0A 3EGEA 4HTFB 4YP7A 1UIRA 3AHFA 3CNNA 3P0FA 3A6HA 1K68A 5EAIA 3UG7A 1QR2A 3RBAA 1OISA 2ELKA 2F2EA 4LY6A 1C06A 2CFTA 5TJHA 1GTZA 1QIGA 1VHQA 1A9SA 2VRBA 4D2IA 4HDAA 1E1LA 2HEGA 4RACA 4DIOA 1OB5A 3MRTA 4K0RA 4J7UA 4B80A 5TMDA 3BG6A 3A3PA 3DWFA 3DSRA 4R1PA 4NS1A 2NMVA 1QTNA 2VZ9A 1JA1A 3F8FA 4E5KA 3ZCUA 4KFRA 4QELA 4P92A 2MABA 2NUTB 2ICAA 3GCWA 5IYDJ 4ALLA 2H92A 2VHJA 1YV9A 1Z7LA 1T33A 2K85A 3LPDA 1SPBS 2BMVA 1A82A 3JCUC 4KYWA 3GTGJ 1RTTA 1QB7A 3E22B 5KC9A 1ZD2P 3I9NA 1MNDA 4EF6A 1FSZA 1J0XO 3WZ2A 2WWWA 2O0YA 4DW6A 2Q6KA 3WNQA 4PO9A 1YRBA 4C29A 4QM7A 5BSKA 4L95C 1J56A 4GOLD 2F59A 1ANKA 1PNRA 3OS2A 1USWA 4XLPF 2QX9A 2EF0A 2SKEA 2FAXA 1UT6A 4N48A 5FXMA 4GM1A 3MTIA 4AO8A 4Q4JA 3ZDXB 1M54A 4NL4H 3ECOA 3ZXUB 4Q21A 4MKHA 2QQFA 1E98A 2O52A 4RQTA 2HUNA 2FUNB 3GD5A 3PGKA 4WA7A 1WF3A 4JFAA 2RG7A 3RBZA 4BNJA 3KJEA 4LBWA 1MB4A 4U2FA 4RVFA 1T1EA 1GQ2A 5HKLA 2MYPA 5L3RA 4QWQA 3GUDA 3LOCA 1QYIA 1T6NA 5TVGA 2P68A 2HYGD 2FHPA 1V9CA 2PX3A 6CHYA 2YV3A 4YMWA 1U5BA 1Z63A 4WLOA 4RPKA 2XNJA 2W6QA 1AKMA 5G0SA 3DKRA 1D0XA 2XGEA 2JGRA 4QM6A 3BLYA 2AJBA 2E6UX 2A14A 1DQUA 2BZ1A 2V7BA 1KY3A 3QFFA 1ZY2A 4B7XA 1GNLA 1VLMA 1U3DA 4FCCA 4HDKB 3RS2A 1TU0A 5ESDA 1I13A 4AT1A 5B5EC 1H66A 3OT4A 3RC1A 3J80Z 1E99A 3MYYA 1GU7A 4KISA 3CH5A 1ZBQA 2GLXA 4S0XA 4CDGA 3DBVO 4CT4B 3QU4A 3I59A 2D5AA 3IMEA 1NVGA 3A6DA 1A9PA 1QIEA 2CZCA 4MGKR 4TYQA 2Z6UA 1OPRA 4W7SA 3HIFA 3AXTA 1ISRA 5IJWA 1PU2A 4EMUA 2GRUA 2VPWA 2H9YA 4KPEC 2JD2A 3G1LA 1NAHA 4DLAA 3ZX4A 5HIAA 1T43A 5FWYB 1MBHA 4FOSA 2W2MA 2EHDA 1FFWA 3OQBA 1N5OX 2CJWA 1GTVA 1CUSA 5DYYA 3D8HA 2DXIA 4JI3D 4YRNA 4X1KA 2LIPA 4H4CA 2YIDA 2HNHA 4BLQA 1BX0A 2OCEA 5HFNA 1KEWA 1DFGA 5DCLA 5JWOA 2DB3A 1QHXA 4JVLA 4PVDA 4EJUA 3DFFA 1W4MA 1KJNA 4TQAA 2JGDA 4HYTA 5LGTA 1ZITA 4L5CA 3KP7A 3G17A 2IBTA 2QOEA 4PG6A 3THXA 3ZDRA 4BE4A 3HLYA 1J07A 4M6XA 3HP4A 4IHVA 3QSGA 2GAFA 5FKNA 1JU9A 2CDAA 4OHMA 1RM4A 4G84A 3GXBA 4QL3A 2IHZA 3AERB 5BSFA 2FWBA 1QUEA 1HSJA 1IQ0A 5DGHA 3JQRA 1UT5A 1OX4A 3UWDA 1NKTA 4MQEB 3MMZA 3AR3A 4BO7A 2X8BA 3ETEA 4XRMA 3EYYA 4WOCA 5JAIA 1U8AA 3ZWBA 3C3MA 1W76A 3O83A 4CI9A 3BZ6A 1VBNA 1XIVA 1QDUA 2N1BA 1I5ZA 2VT3A 2UYCA 1PAUA 2DQZA 3WYDA 1GG5A 2IGOA 2H1WA 4Y13A 1J97A 2Q5HA 1EE1A 4PZPA 4B3BA 4NENA 1C30B 2R85A 3H0GJ 1P1IA 4L0ZB 2FG7C 1Z0DA 4IJWA 3A4NA 3PGVA 4PZDA 1QQ7A 3GMSA 5K0ZA 3NCHA 2FKAA 5IP7J 2L4MA 1Q19A 3UJDA 4TYNA 1FDSA 4QO7A 3LF1A 4B7AA 1JIQA 3W7AA 3CR7A 4RH0A 3LT4A 4BXUA 1GL3A 3UJAA 4L02A 5IJ0A 4B0OA 2MINA 5CEEA 5IPFA 3IQIX 4RZ3A 5TPWB 3IV6A 4Y2QA 2YRFA 1TYZA 2I91A 2Z1DA 2X1DA 2GA9A 1N2SA 1P3Y1 3QE3A 3NHFA 5FAKA 2XUJA 1FX7A 2WWYA 1ZHFA 3WICA 4TL9A 2W2PA 1XSDA 2ZR8A 4K5QA 2C5BA 4ZPJA 2XKBA 4C78A 1NU8A 2CCGA 4Y2SA 4D3FA 1D2CA 3LXMA 1RZ3A 4P7FA 2DCUA 4QVIA 3MJEA 3RVKA 1KJ9A 4QQRA 2ZUUA 4JT2A 1G66A 3RROA 4QPOA 2ZRLA 1Z3CA 5BNFA 2VA8A 3MA0A 2QRZA 3FXAA 3VRHA 1RBMA 1FIAA 3I53A 2VQ6A 3QE2A 4RM2A 5K8TA 2D0PB 2WFLA 4WKBA 1L5YA 3GFTA 4AQYB 3WL4A 1LEBA 4XR9A 4EO7A 1Y89A 4GWLA 4LHZA 1W7PD 2QV7A 1DIBA 4AYTA 3UYLA 2RHOA 5JH7B 1QGUB 3AV0B 2FRDC 3BEOA 3LPCA 4XUDA 2Q1YA 1I3NA 2VS1A 1VGQA 1U5CA 2HNKA 5JIBA 3CCSI 2EEZA 3I72A 4GMXA 3AEUB 3T35A 4X3CA 5AP9A 2YXLA 3KTAA 4I1RA 5KYUA 5E79C 4BNCA 3AEKB 3TCXB 1C1DA 1OI3A 1WUYA 1DV2A 3H2YA 1VKOA 3BTSA 2WOJA 5AW7A 1Z6PA 3C4QA 2OGWA 3DD1A 1S7CA 4X90A 5EE0A 3GRZA 4Y2XA 5D5HA 1T2AA 1KSJA 4I50F 1QRSA 5FT9A 3ZD7A 1Q95A 1Q15A 1OFHA 3INYA 3FFWA 3N05A 5BMZA 1P9WA 4GP6A 1XDDA 2GNPA 2DUJA 1JQBA 3LYHA 4M8KA 2X58A 4Z0NA 5A5VA 2DOKA 2RQPA 4IJKA 1V5EA 4Q6BA 3R44A 4FILA 2O2GA 2BGLA 3K9CA 3U7EB 3CNEA 5LVAA 3STWA 5ICFA 3LPNA 2GZSA 1O7JA 1CUFA 3HI6A 2A1IA 1J0AA 2PUAA 2E1PA 3SU8A 4JMLA 1YXMA 2GAJA 4N5NA 3JQ9A 2WJ3A 1NH3A 1STZA 4EY8A 4FFMA 1W73A 3RC2A 4C0AC 2RC5A 5B58T 4AI6A 2KISA 2XUFA 4I50A 1YITI 4KLZA 2RGDA 4F38A 4OLJA 1Z74A 4X84A 1GPNA 2R84A 3JAMZ 3NRVA 4G26A 2OFWA 3ZQGA 5DFAA 4G56A 5EXXA 3LWFA 4NESA 1P8JA 5H4GA 1TWCJ 2RC4A 2PA3A 3TEDA 1A5SB 4RWEA 2P7IA 4KTTE 4Q19A 3A2MA 3AT1A 1LRKA 2HVQA 4EKYA 3VXKA 3TLXA 3BB4A 3O2NA 3KXKA 1G6HA 1DKOA 3F9KA 3D3WB 4WGGA 1O6CA 4XD2A 5BW5A 5T6MA 3WWDA 4BH9A 4QYIB 2OB2A 4HAXA 4L57A 4OMZA 1G64A 2WU0A 4LRUA 2JFBA 3S8MA 3HP1A 3CRW1 2VLAA 3VZSA 4O5VA 1XZLA 4Q3KA 4KMOA 5I01A 1UBJS 5DSTA 4L9JA 2CV1A 1E7QA 1R88A 2ZIVB 3ZHQA 4JODA 1MJFA 3V1UA 1GPWB 3U4HA 2WHPB 5JVGF 3M5WA 4P31A 5CT8A 5CDSA 3K6JA 2DN0A 2WADA 2B0LA 2Z33A 4MP6A 2WF7A 3GCDA 4M3NA 4RD4A 4OLAA 3VOTA 2XRYA 2A3NA 1XWWA 2XWBF 5CLHA 3TINA 2UUZA 5HZKA 2OBFA 4AKGA 1JL3A 2NXEA 4QXOA 3ID6C 1XTVA 4JXXA 1H9CA 3CC2I 1YB2A 1ST2A 2A6PA 1KH1A 4XAQA 4ZTFA 3UO8B 2MHCA 3C2HA 1CHDA 5G0TA 4RMNA 3BMNB 2GF9A 3WB9A 2P11A 5EYRA 4OI4A 1TADA 3ICCA 5KJ1A 3SE7A 3LXXA 3T7CA 1QFYA 4UVCA 2BOVA 4D5GA 5C8VA 2R6GA 4MQBA 3RT1A 4QUJA 3OZSA 5LZ4A 1N25A 1DX9A 2J5XA 3QFRA 3BSWA 3OIWA 13PKA 2VJMB 2Z5FA 4EPYA 2IV3A 1H8AC 5K20A 1YUNA 1YRWA 3V42A 5CA0F 1X92A 5E1BA 3TBIA 2VBZA 2QJWA 4P80A 3EUEA 2YQ4A 3BFPA 4P6VF 4BNFA 5CFNA 2O8EB 3V1YA 4UARA 4OEHA 1BC5A 3HI4A 2EX0A 2G36A 1L7QA 2RFLA 4Q7LA 5ITZA 3RVMA 2IYUA 1QO7A 2JUCA 3DV8A 2CVFA 2DJNA 4GSLA 1R58A 1V1JA 4QSHA 1KOLA 3AEZA 1ZRFA 3ZGOA 5IUJC 3CZ4A 3QUCA 3ZEIA 2WT8A 5BRAA 4G5FA 4MR9B 1RQRA 1CUIA 1U8RA 1R0RE 4L4YA 2HHHB 4BBRJ 2TMDA 2H0RA 5CA0A 4HB2A 4YROA 3GFSA 5KVAA 1GFIA 1RXYA 1WUHS 1T9AA 5DD4A 3L3BA 1TQIA 3C85A 3OZDA 1BAPA 2ADOA 3JQAD 2XRLA 2C5HA 2PX0A 4REMA 1AQ6A 3AQ4A 1PNTA 3K0BA 1VHLA 2EJCA 3NB0A 3SFZA 3TJRA 3ZV7A 4J4BA 1AQIA 4UPEA 2KMUA 1VE5A 1U1CA 3G8BA 3D7SA 4P3XA 2LTPA 5BOXA 1E2EA 2NU6B 4PSVA 1P4JA 3H6KA 4BDTA 1ILEA 2ZJPF 2ZIUB 1Q91A 2WVHA 3JXEA 4LPKA 4B79A 1GTL1 3CTPA 2C4MA 1E59A 3NOQA 4NC6A 4E2YA 3LM8A 2E1CA 1JAHA 2CXSA 5D87A 3ZVKA 4N7MA 3DGFC 4R6XA 3LBIA 1NMSA 3UN1A 1SUAA 2F5FA 2HQBA 3OZIA 4IH1A 3WIEA 4WZ6A 4WQMA 5IRCD 3WDSA 1RWNA 1GGFA 4ZCIA 2Z57A 3BE5A 1C8VB 2DQKA 4IO0A 2YXBA 3MCWA 4JVSB 4UZFA 2FMKA 3NTRA 4TTPA 1Z5ZA 2J0UB 1RRKA 3LQ2A 3WL8A 2RKBA 4Y7NJ 3IESA 1WP4A 4IDQA 5ALNA 3HBNA 2J9YB 4JOQA 3PDWA 5B7QA 1X9IA 4GOOD 1WS6A 4HX9A 1UJ4A 2Y4NA 4GXNA 3VNAA 1PT9A 4ZDOA 4MV7A 4G09A 2EKDA 3Q8KA 3Q9UA 1O7FA 4EWLA 4C3OB 3QPLA 1VI6A 1VYVA 3I76A 5EXSA 4YFXF 4M7WA 2DTZA 1W5CC 5JO0A 1HYEA 3DHWC 2LTAA 3AFGA 4OU0A 2F1HA 3IPLA 3K20A 2OAZA 1PR2A 3RKYA 4HAUA 4WY8A 1BXKA 1QQIA 3UXYA 3W6KB 1L5MA 3HTSB 5B53A 4YRPA 1BEUB 1V3QE 1VMDA 4LYDA 3R1IA 3H0DA 2WD7B 3RU3A 4R3UC 3U4DA 4POOA 2X9VA 1HDEA 2DRIA 3RBVA 1Q1HA 3LFUA 3OYKA 4GKKB 1F0NA 5T67A 1NRXA 5FYDA 3N5CA 2WP8J 2FW1A 4UMDA 2QA4I 5AH0A 3ABRB 3ILHA 4TLEA 1H9GA 1NQAO 4BQOA 2BBYA 3T4PA 2KBEA 2Q0HA 4CFYA 3T9FA 3TOSA 1D7AA 2OUMA 2AV6A 5F9MA 8ABPA 2X8JB 2JRCA 1B0PA 1NXOA 4O4HF 5J2TF 3CC8A 4COOA 3PD1A 3LP6A 4Q7KA 4UUAA 1FF9A 2CSXA 5IDWA 1NXPA 2FGJA 1RR8C 1PW7A 4C87A 1Y6ZA 4DUZB 1NUUA 3INTA 4WACA 4IOAF 4ZVMA 5EP3A 2O0LA 4HN4B 2NYVA 3DT6A 1RT9A 3T0IA 5HSGA 5GONF 1IQPA 1PCXA 4IUDS 2ZS8A 3LI2A 4RFSB 2BDEA 2E3JA 1SFRA 1TCUA 3ZNOA 4A8JC 3O03A 2YHIA 1EESA 3PJFA 3DE7X 2V1XA 3UQZA 1VLQA 1M6NA 3D3KA 4PLVA 4WD3A 1TZ2A 4F45A 1KFJB 5BNIA 3L9XA 2DAPA 2CLOB 3BL6A 3L5OA 1I6WA 2FE4A 3WJ2A 1UCRA 2Q2EA 3K1JA 3EVDA 3ZKWA 1QORA 2W2QA 4UAVA 3L8DA 3IRQA 2JFFA 4YFKF 1SPXA 1E9DA 1JWAB 4TV9F 5AVOA 1PN3A 4ONEA 4RLHA 3REOA 1NNUA 1TJPB 3ONHA 2YYZA 4CLOA 1RBQA 4AY3A 2HU5A 1ZU4A 3IAUA 4NV0A 4UVEA 2VT7A 4B4KA 3OE7A 3HSKA 4TPKA 5FPTA 4GPAA 5LXTB 2BTOA 3KZCA 3D3NA 2UU9B 4KXLA 3M4ZA 3KFLA 5JD3A 3BY6A 5NULA 3QXGA 2LR8A 3ML6A 3PL5A 3DZIA 4Q3AA 2E1MB 3IBSA 3KCQA 1DT5A 3AM5A 1VPVA 4TWJA 3L1KA 4MVJM 4B4VA 4GM0A 2RGRA 4RJ2A 4D4GA 4TV9A 3BK7A 4HF0A 2X5NA 3K1AA 2JIZA 2BR5A 5A5FA 4A6PA 4MRVA 1CERA 4QYWA 1JAXA 4YRKA 4RHYA 1NMYA 3AY3A 3IRUA 2ADFA 4B2LA 1AVTA 2P9CA 2QDXA 2QTMA 4UXNA 2OG2A 4XRSG 3OYBA 1MV8A 4V0MA 1Q83A 3TYXA 3VYRB 2GB4A 4C05A 5JC1A 3RH0A 5FADA 3CMMA 1WPXA 5K3FA 5A5GA 2IDJA 1Z2PX 4C3JJ 2A86A 4GOJA 3KTFA 2NVQJ 1G8XA 4UASA 4ZK2A 2W8BA 5EKXA 3ZBTA 2XNDD 3INRA 4Q00A 5E4TA 1ECJA 1L4EA 3H9CA 2OORC 1SXJA 4CLHA 3SVLA 5AMXA 3WB1A 5KSYA 4CEJA 4L5AA 3OQPA 2CUFA 4UHJA 4XM3A 1ZUD1 1Z77A 1VJTA 5EE9A 5FLKA 3PC8C 3EEQA 1JLHA 3HDVA 5H5JA 2X6YA 4IWXA 5JJCA 2VPZA 4M1WA 3GLFE 4KK4A 3QOXA 4A03A 4H60A 4CKZA 4J2HA 2GEFA 4CG1A 2CMFA 3O1HB 1AZTA 5FOQA 1AKHB 3EPZA 1FYEA 3BOSA 1JG1A 2DLCX 1W0CA 4X44A 2FPRA 2WDZA 1M76A 4DNQA 4UCFA 5KPJA 2XDYA 3IKTA 2HBYA 2XBLA 4C4TA 2EFDB 3NQ41 3TNYA 5YASA 4BLPA 4CKCA 2NNLD 2PGNA 1YZYA 4J9UE 4S0HB 2DR0A 4JENA 3VHXA 1T3SA 4B7ZA 3HDDA 1THMA 4A0XA 4P4NA 2DPXA 4ESHA 2JLXA 2PCJA 1WV0A 2PX6A 2Q9CA 1IYZA 1M1YA 4UAJA 1MO6A 3WMRA 4HBZA 3SR0A 2EYUA 3C24A 3RQ4A 4ZQBA 2R5YB 4G9EA 4CMIA 4IQ4A 5JCJA 5FLXA 3T6KA 2M9HA 1ABFA 2E37A 4RK6A 4MOWA 2QSUA 1SD1A 1DEKA 2OV8A 2VJBA 1BMDA 4U9HS 3G2OA 1RAAA 3DKKA 1OXMA 3SIPA 3IIMA 1Z47A 3QF4B 5GJBA 3CF6R 2HLDD 2HFKA 9ANTA 5K8VA 2ZYDA 4BMYA 2AL7A 2BUCA 1T2EA 2FU5C 4KE6A 3BKWA 5HDGA 2NW6A 2K27A 1QDLB 4E5MA 4EHBA 2VZ8A 3SXPA 3S1NJ 1NUTA 1UBNA 4O59O 3CZQA 2PL5A 2EWVA 5JLJA 1ZK4A 1SHLA 2NV2B 2Q27A 1S5PA 5JSZA 2NQ2C 1BQ4A 1X8LA 1JUSA 1BS1A 1BC8C 3CN7A 3DLTA 4GR5A 3R6GA 2D1VA 4N39A 4MV4A 1PWYE 2Z2SB 2VONA 3UBMA 1QVVA 5LD2C 1BH6A 1NUSA 1UIMA 2FUG1 2ZXEA 3UA3A 4ND8A 4MRMA 4JX8A 5HLIA 3HSRA 2VO1A 4HYQA 1WV1A 3B53X 1FRQA 3VR6H 2XV1A 5K0EA 3R7LA 3FM9A 3BAFA 2CFIA 2AMLA 1F9EA 2GZ3A 2IUEA 5JDIA 5B3JC 4IHWA 4K26A 5A1TA 4B3MD 3RYTC 4J0FA 4Q4HA 3MTGA 2UUBB 3HFRA 2NVTJ 1XRQA 4D44A 2FFBA 1QIMA 3CRZA 1UDAA 3I83A 2PTGA 1RXCA 1JKOC 5CITA 2YOFA 1C8KA 4HNUA 4EM0B 2PLRA 1F14A 4QE3A 2V58A 5DBIA 1E5XA 4JNKA 2Y93A 1YB4A 3ZWAA 2C1XA 3K5HA 4HDNB 3GFMA 3LSPA 1S6LA 2P2DA 2I03A 4YGXB 3J7AF 5ALDA 2XPCA 4P83A 1ECGA 4LFCD 1YR7A 1A97A 4G2TA 3D1LA 3HUTA 1KEZA 3SC2A 4KI0A 3W5SA 4FOPA 1XZEA 1MZVA 2WIJA 2FOLA 5HDKA 3DMHA 2GXBA 3B3FA 3KU4A 1SFEA 3GIDA 4IQJA 1OJLA 2GWRA 2IVFA 3PE3A 3DYBA 3DOUA 1OBHA 5DNWA 5KTYA 1PWHA 4BVJA 1M2VA 1J5ED 1B6TA 4ZQIA 1NOJA 2C7GA 2AFHA 1HZZC 5CXUA 3DFUA 5T4EA 5I7EA 3F3KA 3IDQA 3BR2A 2O4CA 4LDZA 5B1AH 3PTZA 1T5LA 4LF6B 4DTIA 1UBSB 2R751 2CXQA 3M1LA 3IGFA 3RSFA 3HRUA 3UWMA 4B34A 1M7GA 4K9SA 4CM9D 4II7A 4GGPA 1X80B 1GAXA 2V26A 2J6BA 2OZUA 4I36A 3BR5A 2BYVE 5CFZA 1L7AA 3SLGA 4NDLA 3C98A 3G2KA 3J81E 3PF9A 4AZ3B 1B43A 5CLGA 1JU4A 4ZAWA 1SKMA 2R5FA 4R1NA 1TC3C 3LUFA 1BX1A 2O5CA 4QYMA 3VBEA 1G5IA 1NK3P 4XL9A 3G0DA 4GI3A 1B0UA 5AI4A 4HDCA 3KVRA 3W0LB 1AE1A 2PZBA 1KI3A 3RHTA 2QJTA 2EK5A 3STVA 1U9IA 1LSJA 2GM5A 5DNVA 4K3UA 1FYLA 2CO5A 1W4ZA 1Z0ZA 5FIUA 1NNSA 4RQAA 4HFMA 3X1WA 5HODA 3VSCA 4OGKA 4E6PA 2R7DA 2I3GA 2Y3IA 3B36A 3G8AA 5E6UB 5IT5A 1MMFB 4UNSA 1QTQA 3V4ZA 3ZD8A 1N2ZA 5CVRA 1SIUA 4YMVA 4KYIB 5JS2A 4RVCA 1NTCA 1FB5A 1Z17A 4L28A 1C7FA 3QWLA 2AI1A 4I02A 3FNHA 1Z0KA 2Z9DA 4D41A 1WJAA 2DMUA 1OPCA 3F6RA 2OHVA 3ADBA 4HGNA 3R6SA 2YWEA 3HYRA 3FE2A 3ODGA 3ERED 5T4BA 1K78B 1U4NA 4ZKEA 4NCXA 1L5FA 1R15A 2CUKA 3KB2A 3MXOA 4B1RA 3MD9A 4UB6C 3TLEA 3LCUA 3P71T 5LLTA 1J24A 4L15A 4REQA 1GPLA 3DE5X 3U13A 1UH5A 4CKEA 5A05A 2N42A 1PZGA 1A5TA 1FY2A 1TM4E 4L9WA 5I7HA 3QOYA 3G9XA 1IHUA 5DSZA 2R8ZA 3L6CA 2MSYA 3UAWA 3CRRA 3GTQJ 3DAHA 4GKAA 3EUFA 4NKRA 3GLLA 2O8BA 4XIYA 4PWYA 2IWHA 1C1XB 3T99A 3ET5A 3RGWS 5J5AA 4Q15A 3UPUA 3KJXA 1ULBA 2J85A 1P4WA 2DPMA 3FPAA 2OWEA 4GD3Q 3U7QB 5I4BA 3Q5EA 4D4LA 3FUWA 1RI3A 4LJRA 2B7BA 5K5QA 3KALA 1LI4A 3NWJA 2L9RA 4XVHA 1ZM2A 2GHRA 4OG2A 3KYCA 3LX5A 1RP1A 1KJIA 2ZT7A 4RABA 2CMHA 4NMLA 4HWRA 4BCDA 4BNLA 1KH2A 3F71A 1R4NB 5EINA 3D6UA 4O02B 1X3ZB 1PUEE 2IHVA 3GG9A 4KQJA 4PZUA 2OBBA 2ZM5A 5KPDA 5A6SA 4KR7A 3UJNA 2Q9BA 1QG4A 5KX5F 3BJEA 1S3IA 2LR0A 3EVCA 2ZCJA 2G17A 1R1UA 4FUQA 1T3TA 4OHWA 3ZE7A 4WEQA 2CUEA 3D0QA 1LDMA 2F8MA 3RM3A 2RAFA 1KO1A 3KJHA 3WAKA 1FSPA 1JLKA 2OAP1 3V7FA 4NCKA 4GNRA 4RB2C 1WG8A 1NJFA 3BKXA 2R00C 5IBCA 3S3NA 1JHOA 3FOWA 3QPCA 3HP7A 4DDVA 2PMUA 3EXHA 2CXRA 4IYJA 1EKEA 4G37A 5KX5A 4P4GA 3CP2A 2HMUA 1E61A 1HFWA 3ZRGA 2X1EA 5D51S 1LDGA 1ECCA 2PKYX 3H9UA 3KL2A 1EJ0A 1XJ5A 2NO9A 4KK3A 3HCAA 3VU9A 1ZIDA 2I9KA 2OBPA 1UDWA 1EUDB 2WPNA 5FO0A 5CEFA 1ENPA 3AK4A 3HU1A 3UUWA 3KJGA 2QQEA 5FLVA