3KYDB

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
545
structure length
477
Chain Sequence
SRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQDQQVLDVKSYARLFSKSIETLRVHLAEKDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords SUMO-activating enzyme subunit 1
total genus 120
structure length 477
sequence length 545
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
B PF14732 UAE_UbL Ubiquitin/SUMO-activating enzyme ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.520 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ubiquitin activating enzymes (Uba3). Chain: B, domain 2 3kydB02
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 3kydB03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kydB01
4YRDA 5KIAA 4AJ2A 3B20A 3ROQA 1H6AA 3BHIA 3UOGA 3L9WA 3ITKA 1N1GA 4R1SA 2VYNA 1UAGA 1TEHA 3NRCA 3TF5A 4W9NC 1SOVA 4NMHA 1G0OA 2NU7A 4YR9A 2Q50A 1N9GA 1PWZA 4B7CA 4CR8A 1SCUA 3RUHA 2PZMA 5TJ9A 1P33A 3F4BA 2C82A 3L6DA 1YO6A 3HHPA 3W6UA 3HB4X 4CMEA 5IG2A 2OL4A 4JIGA 4W82A 3PTZA 2JD2A 1LLCA 1T2AA 3DOJA 4JNKA 5COQA 2HMWA 5DBGA 2B0JA 3V1UA 2X6TA 4IUYA 2ZYAA 1NVMB 3RC7A 1GU7A 3B1FA 3TPCA 2BFPA 3ZNOA 2BRUA 4NQZA 3RUAA 1CDOA 1SC6A 1WZIA 2VQ3A 1NPTO 3GNSA 2VZ0A 5DP2A 4JJFA 2YV1A 1QG6A 4KZPA 2HMUA 4FBGA 3EZLA 2CF6A 1BGVA 3EVNA 5HS6A 5A05A 4ZQFA 1PJLA 5DULA 4XGNA 1R66A 2Y99A 3RKUA 3ZW8A 1ZEJA 4R1UA 3LF2A 1BHSA 2B5VA 2O3RA 3EDMA 4K6CA 2NU9A 1FDVA 2P9EA 4Y8VA 1NYTA 3CKYA 3UF0A 2EKQA 3BHMA 1JWAB 5G0SA 4CM1A 3JQAD 2HJSA 3VPFA 3SLKA 3OEYA 3V8BA 3O8QA 2OMEA 4WJZA 5GZ3A 4M8SA 3DAFA 3F6YA 1SO8A 1PX0A 1GD1O 3U4CA 4UULA 5IZCA 3RBXA 4I8XA 4EYEA 5DN9A 4E4YA 1HE4A 2H1SA 4YRAA 2HQ1A 5DDIP 1T2FA 1DB3A 4PRLA 3F5QA 3QJ5A 1T24A 3U4HA 3KEQA 5JDCA 3MTJA 1ZK0A 4HFRA 2X0RA 3JQ9C 1Q0HA 5IAAA 2PKRA 2YQ5A 3HUDA 2QZ9A 4RZHA 5GY7A 3K8ZA 3QRWA 2YQ4A 7MDHA 1P3DA 4DWVA 1RYDA 1JA9A 1ZIDA 4OO3A 4E5YA 3PEFA 4CM9A 1RM3A 3JQ8A 2PD6A 4O1MA 5THQA 1R6DA 2XF8A 4MVJF 4ZRNA 5G4KB 1NR7A 1PGQA 3HSKA 3WICA 2XXBA 4CUKA 4IJVA 1D1TA 3S55A 4WK6A 4JP2A 5DT9A 3QWHA 2BFMA 1P0FA 4M87A 5IFLA 1LRJA 2FSVA 4YT8A 4FFPA 3GQVA 3KTDA 4TRNA 6ADHA 3HNPA 4IDAA 3S2EA 3QVWA 4BNWA 4R41A 2Y0CA 1E0DA 3W8FA 5IDXA 4A0SA 2DPGA 1W4ZA 1VKOA 2C59A 4EJ0A 4I5GA 2W8ZA 1UP6A 2FN7A 2JAPA 5JAQA 4B3JA 2IDZA 1ZFNA 1JWBB 1XELA 3MOGA 4BNHA 4EGFA 5JCJA 1XR3A 4YVFA 2PY6A 3ANLA 1TLTA 1NASA 4BB6A 5JYEA 4CV3A 1AHHA 2H9IA 3QSGA 2EHDA 2ZTVA 4OM8A 4TSKA 5I8ZA 5A3JA 1FJHA 1X0VA 2DLDA 2EP7A 3WGZA 4XKJA 3H5RA 3F47A 1TT7A 2VHZA 1B15A 3Q2IA 3DB2A 4RVDA 4Y98A 1OBFO 3PFWO 4HBGA 1AHIA 2HK7A 3KO8A 5IXSA 3FI9A 3NX4A 1EFLA 2B37A 2BGLA 3GK3A 3OH8A 2R2GA 1HZZA 1IY8A 4MIEA 5U4QA 3RC9A 1NQ5A 1SB8A 1EK6A 4XB2A 5CDYA 1R0LA 4DMLA 2VYVA 1IPFA 1G0NA 4H16A 3JQDA 3HN7A 4MVJI 4DPKA 4XR9A 1XA0A 2P2SA 4GLLA 2TMGA 4D3SA 4ITUA 4EUHA 1BDBA 1HKUA 3MJEA 2LDBA 4RPLA 4NR0A 1BXZA 5JDIA 1P1JA 3CTMA 1YXMA 1GYQA 4TKLA 6LDHA 1DLJA 2VWQA 5BQFA 1PGPA 3HDYA 1ZO8A 1PJ2A 2B4QA 1GUFA 3SEFA 4J4TA 5B1YA 3ZWXA 1MV8A 1Y8XB 5CAEA 2X23A 3A28A 1A4UA 3D7LA 1ZSYA 1ADBA 3JD3A 4IY1A 4LRTB 3TOZA 3AU8A 4IDBA 5I9NA 2AE2A 1JDJA 1EQ2A 1KVRA 3WB9A 1HE5A 4IDCA 1XLTA 4Y67A 1E5LA 1A27A 1R4MB 3PQDA 3JCZA 1IHYA 3WG9A 5A9RA 1QKIA 1GEGA 5DF1A 1CETA 1PJTA 4HXYA 1Y8RA 1X14A 2NV6A 4PZCA 1DFHA 1T2DA 5A06A 4Z0TA 4OKNA 5F1OA 3ONGA 3PP8A 4WGGA 4MPDA 2CVZA 5BNFA 1NAIA 3OIFA 3QWFA 1ZKMA 3E8XA 4J0EA 2EGGA 4FC7A 3AFNA 4FFLA 4A26A 4D0SA 4N7RA 3DZBA 2GUGA 1B16A 4D7AA 5T57A 2DVMA 3SJUA 1QR6A 2PZKA 1GV0A 1KIFA 4EI2A 5DOVA 1UXGA 3TFOA 4NFHA 3D0OA 2DQ4A 1D7OA 1LQUA 4YQYA 4AJ1A 1NQOA 4S3MA 4OQZA 5ENVA 3WYEA 3WSWA 3DHNA 1XDWA 1P45A 3D5QA 3GHYA 4FGSA 1NFRA 3ABIA 3ORFA 1UXJA 4HX5A 3QVXA 1YDEA 2HDHA 1PJSA 3F1KA 4J1SA 2A9FA 3KHUA 3PWKA 4UEKA 5C5IA 3R1IA 4ZN6A 1CYDA 3WGTA 1E1LA 3ZWWA 1HTBA 2XPCA 1PQUA 3WGOA 4IJKA 1Q7GA 5FYDA 5HM8A 3NGXA 3KEOA 2P4QA 3G1TA 4EUEA 1VJ0A 3IQDB 1H0KA 2PFGA 3QVTA 4U0KA 2X22A 5JYDA 1YKFA 3QVSA 2X9GA 3ZH2A 2RH8A 1KETA 3NYWA 1NWHA 4MVJD 3UHAA 1O8CA 4CMKA 3ZU3A 2B69A 1Z82A 3FD8A 4BNIA 1GFSA 5TGDA 8LDHA 1WZEA 1RYEA 2X1HA 3EVTA 4WUVA 4BS9A 1ZCJA 4RVUA 3GGOA 2DFVA 5ILGA 2X9VA 4QSMA 1BW9A 4YCAA 2J3JA 4WECA 3JD4A 5T6BA 2O50A 4BNFA 1ISHA 2EG9A 4BNYA 3QA9A 3BZUA 2PV7A 3B6ZA 5C7LO 5HS4A 3UAGA 3EAGA 3M2TA 1TVEA 1IB6A 4BNZA 2GZ1A 5ER6A 1DIRA 2NLOA 1EVIA 2Q45A 3CEAA 4DBVO 3MJSA 3ZWAA 4OHUA 2DU8A 1WDLA 3DOCA 4GI2A 4K9DA 3PGXA 2FHSA 4YJHB 1XEAA 4TWRA 1Y7TA 4JBIA 3PJDA 5TIIA 1YWGO 1GAEO 1PJ4A 3HZZA 5BSGA 4KQXA 4UUOA 2I3GA 3RD5A 5IJZA 4WCFA 1PQWA 1OAAA 1R4NA 4K28A 3DBHB 4BGUA 1JQBA 2NTVA 3ROMA 1J6UA 3I23A 1V6AA 4J1NA 1P1KA 4NK5A 1C3VA 4E13A 1HLPA 4UVHA 3JD0A 1EQUA 3PPIA 5LCXA 5JAIA 1U8XX 3BTSA 3OJOA 1LDEA 3HDJA 1HT0A 3G79A 4RVHA 3L4BA 4XR4A 4RPGA 3ICCA 4J1QA 4Z9FA 1PEDA 3L6OO 4XEHA 1KVUA 4RQUA 4BOYA 5C7IO 3O26A 1BXGB 3U9LA 4Q39A 1H6CA 2JD0A 4CQLA 1P44A 1SMKA 4J91A 3DO5A 2PZLA 1ZZEA 3NAQA 4R9SA 1GYPA 3FNEA 3H7AA 4N5MA 2F1KA 5EMHA 5A3VA 1M2WA 3GT0A 1ZNQO 1VSVA 4GLOA 2YHUA 3PHHA 4BNKA 1DRWA 3AI3A 1GQQA 3G1UA 3FNFA 1E3EA 4GKVA 4W5VB 4BO6A 1V3UA 1LQTA 2A35A 4LGVA 1QYXA 3JQEA 4CUJA 1MA0A 2Z1MA 3GDOA 4BGIA 3MTGA 3JQAB 1IULA 2NU6A 2OGUA 4GX5A 3OECA 4CV0A 1WW8A 1PL7A 1N7HA 3IAHA 1JU9A 3KBOA 3DZGA 5K6AA 4J2HA 2O3TA 3U4IA 3V2HA 3ZU4A 1YB4A 3JQ7A 4RDHA 1JW9B 2AEJA 3RAJA 4E21A 5C7OO 5HRUA 5BNTA 1RM0A 4GSKA 4A10A 4CLOA 2JHFA 1T2EA 2YFHA 4BNLA 1N8KA 1UH5A 4W4TA 4JJGA 4HP8A 4IGFA 2V6GA 3L6EA 3ZDFA 2JFGA 3TZQA 4AJOA 4G81A 2VHWA 5FF9A 5H83A 3HJAA 4XQGA 1UZLA 3I6QA 5BNIA 3IIEA 3RUFA 3W4JA 3C1OA 2FSSA 4IJUA 1WLYA 3KLPX 4UVIA 3RFXA 2QQ5A 3F46A 1HRDA 3FBGA 3ZHZA 2WYVA 3WIEA 1V9LA 3I9MA 3V2UA 1V8BA 2O7SA 2QIOA 3T4EA 1O89A 1DFGA 1MFZA 1HDXA 2NTJA 2GN4A 5JXWA 4BNGA 1E6WA 5ES3A 5KJ6A 3M1LA 4HY3A 4XYMA 2EP5A 3IP1A 1H2HA 1T2CA 2GZ2A 4IXWA 1UP4A 2HU2A 4TVOA 2JFHA 5JSFA 4PVDA 4Y9DA 3P19A 4XGKA 1P1FA 3WDSA 1QYWA 2DM6A 1HE3A 1KY4A 1U3TA 1K89A 1H9BA 3M2PA 2VT2A 2BFOA 3IP3A 3JQFA 5GMOA 1RWBA 2I3AA 3DZHA 3D64A 4XZ3A 2PR2A 3JYLA 4JXKA 1ZXBA 2VUTA 4B3HA 4CM8B 3RFVA 4KDEA 3VVCA 2YJZA 4IMRA 3D3WA 4G5HA 4MP8A 5JO0A 2OORA 4JBHA 4M55A 4XQCA 4CQLB 1R0KA 1XHLA 1U3UA 1GUZA 2AQ8A 3FPLA 3DBRA 1HYGA 3EK2A 3GZNA 2EJWA 4LSMA 3WJAA 3RWBA 4I5FA 1GYRA 1HDCA 1QORA 1P1RA 2IEDA 3HFSA 3ROPA 5A4DA 2Y67A 8ADHA 1GCUA 3JD1A 4NBWA 1CJCA 4E0BA 3AM3A 3HG7A 4E32A 4ZJUA 2ZYDA 2Q1TA 2J3KA 2VWPA 3KSDO 4FFOA 4J2OA 3D3EA 4XJSA 1OZAA 1QLJA 5AXBA 3WQSB 4ZQHA 5IZCC 3X2EA 2NADA 4WCFB 3ULKA 3LYLA 2UAGA 1QYCA 1I5RA 2Y1OA 3S1LA 4CV1A 1JVBA 4BO1A 1UXKA 5DCYA 3RSHA 2CD9A 4NBTA 1ZK3A 2WE8A 4O0LA 1PQPA 3GLQA 4ZVVA 1I2CA 1CQJA 3VKUA 4JK3A 1G6KA 4YPOA 2PA3A 3PIDA 4GWKA 5KTKA 1JAYA 3A4VA 1TI7A 1U2GA 3RU7A 4NH4A 4Q3AA 3ZW9A 2C20A 1O94A 4PLWA 1ENYA 3GAZA 2OBNA 5B4VA 1BW9B 3VDRA 1T1RA 3VAZA 2J3IA 3BMNA 4W6ZA 2EEZA 3VC7A 4ND3A 3ZWBA 2WSBA 1LBEA 3VKVA 4BL5A 3BIOA 1EDOA 3EW7A 2GF2A 2WWRA 2CF5A 2FZWA 4XA8A 3O8QB 4OXYA 5HA5A 4RORA 3AM5A 3M6IA 3DEYX 1E3JA 2VRBA 4QQRA 2VN8A 2JFFA 1OFGA 3NDJA 4JCOA 1LSUA 5LDHA 3TRIA 4FFNA 1XKQA 2W2LA 2NVBA 3DMTC 3FSRA 3GUCA 4IIVA 4E5NA 3FRJA 1NHGA 1FK8A 3L4BC 5EJ2A 4MIOA 5IXYA 5G0VA 3IJRA 3T4XA 5CFZA 1DC4A 2AA3A 2RAFA 2D3TA 1E92A 1QV6A 4BO0A 5JPIA 2BGMA 3GMDA 4HUJA 4E6PA 3FN1A 3VH2A 5HBRA 2G1UA 1JN0A 2WTBA 1LX6A 1DC5A 3VVBA 4GPD1 3GDGA 2X5KO 4ALMA 2CMDA 3WMWA 2HLPA 1X13A 2IZZA 2AG5A 4L4XA 3OIDA 5ADHA 1XQ6A 4CM7A 4M86A 3IKVA 5A9SB 4RLSA 4I1IA 1CRWG 2B83A 3H2SA 4CMHA 1X1TA 1NQAO 2O3SA 3UH1A 1E7RA 3G0OA 4PLYA 4YAEA 4BIIA 3FN4A 3ZWOA 1OOEA 4BNTA 2PNFA 3H6KA 4UEOA 3ZV5A 3ZCXA 3D5TA 4WNIA 1K2WA 3KLMX 1U28A 4EUFA 4EDFA 4YJGB 1EFKA 1LLUA 3MJ4A 3SC6A 5ILOA 2VTDA 4LN1A 4TRJA 5B12A 1YOVB 3L77A 5JDIC 4JBGA 3VPHA 3UCFA 4MVJA 4WLUA 4W7HA 5KNLA 3NTRA 1Y6JA 2R6JA 4GVLA 1WDKA 2AQKA 5AVOA 3UUWA 4E5MA 1P1HA 2EKLA 3W4IA 4IQGA 2QG4A 1H93A 3R3JA 3RJ5A 4BGEA 3PJFA 2QRKA 5FI3A 5A5EA 2AEFA 1C0KA 1IE3A 3GC6A 4P8RA 3ASUA 2EGHA 4Q3BA 4GL4A 3C7CB 5KJEA 1VKNA 3NEPX 4IIUA 4A5OA 1YGYA 4OQYA 5FQ2B 3MJVA 4YT4A 2WMDA 3C1TA 4NU6A 2Y1DA 3GPIA 4L9RA 4XDZA 4BO2A 4E12A 4E2YA 3GPDG 1IPEA 1ULUA 3OFSA 2V6MA 2J5QA 4XWYA 5CPFA 3U09A 1R4NB 3DTTA 3GA0A 5JAZA 3I52A 1B8UA 3BMNB 3W6ZA 4IDDA 3ONEA 1RM4A 4ZD6A 1QYDA 3ZZNA 2Q2WA 1YL5A 3JQCA 2GCGA 2H6EA 3KYDA 4K6FA 5JDCC 2EF1A 5U1PA 3DHEA 4DRYA 1QYVA 1T26A 2OZPA 1UDBA 3JQBC 4BGVA 4AJKA 2UV8A 2DBZA 4FGWA 3B1JA 3Q1LA 2Z95A 2AG8A 3WGGA 1D1SA 2P4HX 2YFQA 2Y93A 4IDGA 1GY8A 4I9HA 1P74A 2UYYA 2WJPA 3GN1A 2FR0A 2FRDA 1QP8A 2D1YA 3GNQA 5H81A 1I33A 3DDNA 3I4FA 3OETA 1TT5B 1SPXA 4JP3A 3GMSA 2QX7A 3X2FA 1U8FO 3MZ0A 2AMFA 4WE3A 3PHGA 2ILTA 5CEJA 4XX0A 3GHHA 2J5KA 3TFQA 4B4WA 1CF2O 4DIFA 1NFQA 1VL0A 1DIBA 1M66A 3V1YA 3BA1A 1M6HA 3ASVA 3EZYA 1GZ6A 1DIGA 4QO7A 3TNLA 2IYPA 4C7JA 1WNTA 5AXDA 1H94A 3GVXA 4J4HA 3WNVA 1DO8A 3JQGA 4CLRA 3KSUA 4P4NA 2GPTA 1E1MA 4QEDA 4CV2A 7ADHA 4J90A 4B79A 1KBZA 1J0XO 4FDAA 1Z45A 1EEHA 1KC1A 2AXQA 1I36A 4CMJA 2BHLA 1DOHA 5KKCA 2W2KB 4M54A 2HRZA 3C3XA 4B8WA 1IL0A 3LZ6A 5G4KA 4CMCA 3BTUA 5TT0A 4R01A 1XCBA 4J43A 4BO9A 1NM5A 4BO3A 4RPHA 2CFCA 1O6ZA 1FDTA 4EJMA 4ND4A 5I7EA 1E3WB 3JD2A 1E1NA 2C2XA 3LC1O 2NVWA 4PLFA 3TZHA 2VNAA 1MXFA 4TZKA 2HKIA 3BYZA 3LQFA 3SXPA 4NZ9A 2R00A 4WCDA 2D4AA 1XIVA 3LK7A 5G2OA 4CM4B 1GEEA 2YV2A 4BUCA 1DIAA 5JNLA 3JQ9A 5L4NA 3KYCA 2J3HA 2EXXA 2PZJA 2Q1UA 1MP0A 4IZHA 3LT4A 4RVSA 1CIVA 4H7PA 5AQ1A 1ZEMA 2PKQP 3FTPA 4MKXA 2J6IA 1Y9AA 5CDGA 2HMTA 2HRBA 1WDMA 2CSUA 5CP8A 3AUTA 4DIOA 2Y0DA 4WEOA 4WLVA 2FP4A 3RU9A 2C54A 2ZTMA 3AI1A 1NBOA 2PD4A 3FHLA 2VZ8A 1M6WA 4DPLA 4BNNA 3ONHA 2TMDA 5C37A 2P5UA 1KEUA 3H8VA 3ON5A 2D2IA 4MDHA 4NG5A 1WMAA 2HJRA 1E7SA 1SEVA 1R37A 2V6BA 3RQSA 2G82A 3JYPA 1XG5A 2EIHA 5EERA 3DBVO 3ONFA 3OSUA 4EZBA 3F4LA 4FS3A 1LLQA 3OEWA 3EMKA 4II3A 1F8GA 4YT5A 2C7GA 3BTOA 1UP7A 1H2BA 3AOEC 2BFAA 3I9NA 2QYSA 5IF3A 2FR8A 2A4KA 4YXFA 3ANNA 2VCYA 3D1LA 5F21A 3WX0A 1YBAA 4PLCA 3NTQA 3HQ4O 3CSDA 3CXRA 1ONPA 1UR5A 3MOIA 5L53A 2RH4A 3VTZA 1A7AA 1DAOA 4EEXA 1ENZA 4GMFA 3OJ0A 4DL9A 3IL2A 3NDRA 1HE2A 5JW6A 4MP6A 1PJQA 3H4VA 2VNSA 1HDOA 2DT5A 4QUKA 2ZATA 2VHXA 2P68A 1M67A 1Y8RB 3H9UA 1ZUD1 3RBZA 2GSDA 3C85A 1SZJG 1KVSA 2XOXA 4DIBA 4GGPA 2PTGA 5KVQA 4WLFA 4R9RA 4CM6A 3EY4A 3K9QO 5DBFA 3TL3A 3G3EA 4CMGA 4WKGA 4KQWA 2X5JO 4QTZA 2E48A 1FDSA 1ORRA 1YQDA 3PI7A 5TC4A 2YW9A 3CPSA 4M89A 3ZWCA 1ZH8A 2PWZA 5AXCA 3EC7A 3MEQA 5JLAA 4DC1A 3WTCA 2I67A 3K2BA 5KVVA 4K26A 5CDSA 5BT9A 2CDCA 3RCBA 3IS3A 2Y1EA 5JC8A 1F14A 1MGOA 1H6BA 1TB4A 3ZNQA 4NI5A 2PH3A 5IN5A 2OO5A 3DZJA 2A92A 3BAZA 1U4OA 4G2NA 5TRTA 4L76A 3TN7A 4RF5A 4AJNA 4A7PA 1MC4A 1I30A 2FWMX 1ENPA 1PWXA 4XRGA 2Y1FA 1I32A 1J49A 3H65A 1RPNA 3FNHA 4GX1A 5L45A 4RL6A 5I9LA 3PJEA 1E7MA 4NU5A 4RV9A 5F5LA 4YB8A 1GCOA 2O23A 2PK3A 2NUAA 3BHJA 4HFJA 4HNHA 2J5RA 1DIHA 2DPHA 3ANMA 3CZRA 3UVEA 4FFRA 4I5DA 3ZHBA 4ND5A 5BSHA 3AOEA 3ITDA 1HF3A 3I9OA 4PGFA 4ZHSA 1L7EA 4MVJG 4F6CA 1K6JA 4DC0A 2CY0A 3JQ6A 5JO9A 4J7CA 3N74A 4CLEA 3WBFA 2IODA 4AJJA 1F06A 3CH6A 3CE6A 3ZWYA 4BNJA 4Z0HO 5KCZA 4Z3DA 3PK0A 2C29D 4NK4A 3LT0A 4TRRA 3RI3A 5ENDA 4EW6A 1E7QA 4TVBA 3WS7A 4BKUA 4OIMA 3DZIA 1Y5MA 2EKPA 3VPXA 3OQ1A 1UZMA 2HO5A 4ONEA 5KVCA 4ND2A 2Y1CA 2AEMA 1UJMA 2X8LA 4AJPA 3ENKA 1C0IA 1P0CA 4XQEA 5K9ZA 3Q9NA 1HDRA 1SNYA 4A73A 2WD7B 4KTTE 4C4OA 1U2DA 3A9WA 1JKFA 3LDHA 2FR1A 3G17A 1KC3A 1A4IA 5CG1A 4IQ8A 1PZGA 3AFMA 2D5AA 1U9JA 4OGWA 1DJNA 4YTEA 3Q11A 2FMUA 2Y66A 3I3OA 1B3RA 3JYQA 2CDBA 2GLXA 4BKPA 1ISGA 1D4FA 3F9IA 3PFFA 3TZCA 1PR9A 1EUZA 4BKOA 4E5KA 4L73A 4I9NA 1MG5A 4PG5A 3W4KA 5DNAA 4CQMD 5KVSA 4PG6A 2G76A 3I5MA 2IEBA 3GDFA 1W8DA 1VLLA 4MP3A 4D42A 3DC2A 1C0PA 3CUKA 1C14A 3QW2A 4TZTA 4Y6RA 3UCXA 3ZV6A 2O4CA 1E7WA 1TXGA 3WGIA 3WSVA 3P2YA 2JJYA 4YJFA 1YQGA 4GBJA 4EEZA 4ESOA 3FPCA 3BMCB 2ZB8A 1KERA 2CVQA 2QW8A 1IZ9A 4IBOA 4AJLA 3W1VA 4IS3A 4PG4A 2YHIA 5ITVA 2FZEA 1QXSA 4JX8A 3VZRA 2V6FA 4GGOA 4XYGA 2BF7A 4ZRMA 4PG7A 4Y6PA 1VL8A 5COBA 3LC2O 2BELA 4A2CA 3ZHXA 3RVDA 5L4SA 4CLOB 4UREA 3DBLB 5EPOA 4B8ZA 5L51A 3KOUA 2QZZA 4PFJA 1EVYA 1NQTA 3DFZA 3K30A 4BKRA 3PJGA 4BNVA 2E49A 1B14A 1H6DA 4HKTA 1E3WA 3PYLA 1DEHA 5L3ZA 2JCVA 2Q1SA 5KOIA 3A14A 3H3JA 1KS9A 4OSOA 3PHIA 5TX7A 3NKLA 2Y1GA 1OC4A 3E6AA 4S1VA 2BLLA 3QY9A 1E77A 4DLAA 5JC1A 1U7TA 3GEGA 2DBQA 3K6JA 3IC5A 3NGLA 3ETGA 3ZU5A 2QRLA 4ROSA 5EQDA 3ZNNA 1R12A 3ADPA 1C1DA 5TS3A 1XU7A 5K0ZA 3GFBA 4KUHA 1I8TA 2OXIA 2G5CA 4CPDA 4CUZA 3I1JA 1MX3A 4DXHA 4A03A 3UXYA 1C1XB 4PRKA 3BTVA 1MLDA 4Z0PA 1A7KA 4R3WA 1PS8A 1N2SA 4NJMA 4OL9A 1BMDA 4GSLA 1OMOA 3GG2A 2JKVA 1X1EA 4XRRA 5G0TA 1PGJA 3WWYA 1AGNA 3KYDB 2AQHA 2RBEA 1PIWA 5CEEA 4YACA 1Z6ZA 1LDMA 1NVTA 3HDQA 2YDYA 4XJTA 3ETDA 3ZWMA 3F5SA 1F0YA 2BD0A 4L8VA 4PN3A 4HADA 5ICMA 4YT2A 3SVTA 1BRMA 3CINA 2I5PO 1DJQA 4OMUA 1Y8QB 4J1TA 2GD1O 1WMBA 3PYXA 3C1AA 1K3TA 2VYND 2IRWA 2ZJ0A 1IZ0A 1I3KA 3NT4A 1Q1NA 5DCWA 2VRCD 3JQGB 3K92A 3DAGA 3PWZA 4RQTA 3PQFA 2RCYA 4IM7A 1NNUA 2Q49A 4BB5A 2O3UA 3RUIA 3E82A 2E37A 3EHEA 5CHEA 2WD8A 3DBRB 3GZNB 1NR1A 1LDYA 2WYUA 3KRTA 3DL2A 5F1PA 2QYTA 4HWKA 4B3IA 1PS0A 4NHEA 4KWIA 5L40A 1V3VA 4II2A 4FB5A 1KVTA 4QO8A 1LDGA 2CZCA 5ER9A 4IQ0A 1B7GO 2OP1A 3EGOA 1LDBA 5CG2A 4MJLA 3H9EO 3UW3A 5DBIA 3AUAA 3EYWA 3LF1A 4WPGA 1D3AA 5THKA 4KUEA 1T4DA 1YDWA 4C7KA 3D4OA 5K6AC 3IKTA 2C7VA 2IYOA 3AWDA 1S6YA 4YDRA 3AUSA 1Y9EA 3ETEA 4P38A 4R1TA 2I65A 4FFMA 1C1DB 4GH5A 1VI2A 5G4LA 3UKOA 4CMBA 4IGEA 1UZNA 2NSDA 4Q3CA 4FIZA 2NQTA 4AJEA 1ZXLA 3MJCA 2AHRA 2DTEA 2GDZA 1KOLA 3WJ7A 9LDTA 3DQPA 4BO7A 1M75A 5B4TA 5AOVA 2FPPA 4XYBA 3C7AA 3KM0A 1B3BA 1ZMOA 3H3FA 3Q9UA 4FOOA 3RUDA 3WFIA 1O9BA 2GN8A 4B7UA 4J6FA 3HB5X 4IXTA 1VC2A 1ZK4A 3FNGA 4IINA 1NAHA 1A5ZA 4LK3A 4W9NA 4XYEA 2ZB3A 3FBTA 4X54A 1NXQA 3GR6A 5T64A 4I5EA 1YB1A 3MWEB 2P91A 2HK9A 4FJ2A 1EUDA 1YONA 5KKAA 4D3DA 2FPIA 1ULSA 1ISIA 3WIDA 2SCUA 1OI7A 3JV7A 5I7VA 4R4JA 4DBZA 3GUYA 2YDXA 1OC2A 1W6UA 3DBHA 2JD1A 2DUUA 2PH5A 2LDXA 4H3VA 4Q3DA 1YE3A 5COAA 1RKXA 3S2GA 1ZK2A 3IDSA 3H9JA 4JQCA 3WFJA 1FF9A 2YUTA 3RUCA 3OF2A 5J23A 1FDUA 3KB6A 4INAA 4UVEA 1HEUA 3FWNA 2BI8A 2PKQO 3GVIA 3AY3A 3JQBA 1GR0A 3KETA 3JQAA 3WQQA 1VPDA 1B2LA 3INTA 2O2YA 3F1LA 3KYBA 5JAMA 1ZW1A 2Q99A 3H5AA 1X15A 4PZDA 3ZU2A 2Y05A 1ADGA 1EBFA 2VWGA 1CERA 3DOOA 3VH1A 1HYHA 5FI5A 1WPQA 4FD3A 4O5OA 1KEVA 5L7YA 3PYMA 1BDMA 1DLIA 1LXCA 2DBVO 4U6SA 2VWHA 3LT1A 3VZPA 3GY0A 2W90A 2ZTLA 4FC6A 4QECA 4O59O 1LC0A 3UFXA 1PR3A 4F45A 2Q2QA 4U8GA 1ONOA 1DC3A 3ROKA 1GZ4A 1DC6A 3QWAA 4RDIA 5IDYA 1G1AA 1HXHA 4YJHA 2B4RO 4IJWA 1D8AA 3GFGA 5HTOA 5I7SA 1JKJA 1RJWA 1ZVMA 2POQX 4AVYA 3L0DA 4D45A 3M1AA 2UUOA 4YAIA 5JY6A 1N1EA 4E2ZA 2GNAA 1I3NA 1YQXA 1LUAA 4JROA 2X7HA 4M49A 3NT5A 1ISMA 1HSZA 3EUWA 4KMSA 3RC1A 1Q7CA 2DTXA 3T7CA 1YS4A 4BMVA 2GRAA 5LDGA 3K96A 4CLRB 4RCVA 5EQFA 3WLFA 1NP3A 2WDZA 4AJIA 1Q7BA 3I83A 4BHTA 4Z6KA 3OQBA 3LU1A 3Q6IA 2E82A 1U3VA 1ADCA 2BH9A 4QX6A 1NTOA 1ZJYA 1UDCA 4J7UA 1NPDA 3C8MA 1JLLA 4Z9YA 5EIOA 2LQ7A 4XGIA 3PQEA 1BVRA 1F17A 2Q3EA 3QP9A 3IUPA 5JBIA 2Q2VA 2Q1WA 1PSDA 1RM5A 3GRKA 4GKBA 3WLEA 5JFOA 3E48A 3E03A 1V0JA 4Q3NA 2ZKLA 3RIHA 5JCXA 5C3MA 5EESA 2JCYA 4GVXA 3SX2A 3U3XA 1UXHA 3D4NA 2AE1A 5DCUA 5B4UA 4CR6A 4J4BA 3OP4A 2EERA 2UDPA 1ARZA 1I2ZA 2E4AA 3FTNA 4IS2A 2WYWA 4BV9A 3JTMA 4R5HA 4FQ8A 3GRPA 1PS9A 4GQAA 3L9XA 4RPKA 3UICA 4DUPA 1CQIA 1EE2A 2G0TA 2X0JA 1AN9A 1H5QA 3I4CA 1K0UA 4E33A 3L4SO 2HK8A 1C1XA 4NNJA 4FSHA 3W8EA 5KJFA 1BSVA 1DHRA 2BGKA 1U3WA 2QHXA 4BO8A 3SC4A 2HSDA 3ADOA 4RPJA 4HFMA 1N7GA 4XDYA 4ZQBA 3PRJA 3FR8A 3FF4A 1O5IA 4N5NA 1MC5A 3CMMA 3E9QA 3MJTA 4YQZA 3WTBA 1R4MA 4UUMA 3LSYA 2HAEA 3AI2A 2ET6A 3OIGA 3COSA 1X7DA 4E2WA 3DTYA 4TMFA 4YJFB 1PJ3A 2DFDA 3LVFO 4R16A 3GH3A 4W99A 1LU9A 2GN6A 3ZI0A 3GVHA 5L7TA 1R16A 1SBYA 3PZBA 2ZQZA 3B1KA 4NPCA 3AW9A 2GR9A 2QRJA 1K5HA 1DXYA 2I76A 3AUUA 3BMOB 4YAGA 4H15A 4KP7A 1LSJA 4J49A 4BNXA 4N18A 4OOEA 4UVGA 2DAPA 1O0SA 1YOVA 1LRKA 1DDOA 1X0XA 4PZEA 2RIRA 3K2EA 5IN4A 2CUKA 1A71A 5GZ1A 3KYCB 4JLWA 3P2OA 3QLJA 2GGSA 2Z5LA 3QHAA 3C7DB 1BXGA 3STHA 3NV9A 1VRWA 4W7IA 1P31A 4K1LA 4Z9XA 2VOEA 3GGPA 3PDJA 1WP4A 3OQ6A 1B8PA 3ZWPA 3KZVA 4UUPA 3RASA 3VTFA 5EINA 4B4VA 3PGJA 4ALLA 4AJ4A 1GUYA 1HDZA 3UCEA 4CM5A 2ZJ1A 3TL2A 1AXGA 5A04A 3V1TC 3NDIA 2O3JA 2NM0A 4OOFA 4RGBA 4GX0A 4MINA 3RBVA 2P9GA 4CM3A 4PLZA 1SOWA 2P9CA 4PIVA 2Q4BA 4CODB 3RUEA 3VOSA 4PVCA 1MB4A 1E3SA 4R51A 4F3YA 3TJRA 5L9AA 2H63A 1MFPA 5F5NA 3U0BA 4LVUA 4QXMA 4JN6B 3KUXA 1E7YA 1YL6A 3V5NA 3SLGA 5IDWA 4PLHA 3DXFA 2NWQA 4B7XA 1PZEA 3GG9A 2PGLA 1PU2A 5MGBA 3RJ9A 4CMAA 5L7WA 3VZSA 1N92A 3PLRA 3QE3A 2VTEA 3OBBA 2FY8A 1YRLA 3E18A 1GV1A 5CEFA 2AW5A 2D8AA 3E9NA 3S2FA 4ALNA 1X7HA 3ONDA 1T25A 2O7QA 3BMCA 3L07A 1EUCA 1ZSVA 3VH3A 2CDAA 1U4SA 4IZIA 3LLSA 1YBMA 1Z7EA 4PCVA 1N5DA 1U7HA 4NBRA 2D5CA 3DWFA 2RHCA 4UAGA 4NBVA 2Q46A 3ZNPA 3AU9A 1NVGA 1GZ3A 4HV4A 2PX9A 1Q0LA 1ZBQA 1I24A 4MOWA 5TJHA 3HDHA 4DYVA 5MDHA 3OM9A 3DZKA 4E3ZA 2VZ9A 2I9PA 1O95A 3PZRA 3WBBA 3N58A 3PHJA 4YA6A 4QT0A 3IUSA 4DLBA 5FFFA 1V35A 2IZ0A 5F3RA 5CDTA 2RHRA 9LDBA 1EDZA 4M1QA 1AXEA 2O48X 4BO4A 5I8WA 3O9ZA 4DQXA 2BI7A 1H9AA 5T67A 2X5OA 4CM4A 4BMSA 3G49A 1GADO 4I9UA 1EK5A 3LLVA 1Z7BA 4WASA 4J9UE 4KOAA 4LRSB 5EL0A 4DVJA 1PL6A 3VZQA 3A06A 1EMDA 5A03A 5AYVA 5KJCA 1CWUA 3WR5A 2JAHA 1ADFA 5JMPA 1DPGA 3PDUA 2UVDA 1BTOA 1VJTA 4N5LA 2ZK7A 4P4GA 5I7FA 1GPDG 1R15A 2FPGA 5JMWA 3ICPA 4JJIA 3ZV3A 4FW8A 4D41A 1P77A 3JQ8B 3KXDA 5BR7A 1EBUA 1IOLA 1BXKA 1I01A 2X4GA 4R54A 4U6QA 3C24A 4WCFC 4DREA 4AL4A 3E5RA 1HL3A 1B8VA 2O4UX 5ITWA 2NU8A 4RVGA 5G0UA 1UUFA 3TSCA 1QMGA 3NJ8A 3PXXA 1DBVO 1SAYA 5A1TA 4YJGA 3HN2A 1LJ8A 2V7PA 2DC1A 3R6DA 4GWGA 2HCTA 4YAKA 4LCJA 1WVGA 1NX6A 2GZ3A 5IZ4A 4WOKA 4D0RA 3ZHYA 3VH4A 4GMGA 3D4PA 3R3SA 3V2GA 4Q3EA 3CIFA 4E31A 2CVOA 3HFGA 2YYYA 1HZJA 4TKMA 1ID1A 1F12A 1YVEI 2IE0A 1WXDA 3OHSX 4DQVA 4J16A 2A94A 2J8ZA 1P9LA 3INGA 2DKNA 1LRLA 1TA4A 3WYCA 4R69A 4LMPA 4QFDA 4CQMB 2D0IA 4UEJA 1UAYA 4YBZA 3PIIA 1U1IA 4B4OA 4TROA 1DAPA 4B4UA 3I9KA 5TQVA 1PZFA 4RZIA 2X0IA 2ZB4A 1YH3A 3O4RA 1NHWA 3BMQB 3LT2A 1LEHA 2F00A 2JCXA 5A9TA 3UN1A 1KY5A 4KUGA 3AOGA 1N9GB 4MVJE 1K6IA 3H9GA 2JL1A 2H5LA 2VT3A 3JYNA 1Z74A 4ZGWA 2OFPA 4QFCA 1E6UA 4ALJA 1F8FA 1B26A 2YHIB 1MG0A 4YRBA 4Z3KA 3IJPA 1E5QA 2VRCA 4CLXA 1LC3A 4FJ1A 2FOIA 2GO1A 4MVJH 3BMOA 1ZMTA 2ZB7A 4Q9NA 4UUNA 4R5MA 3P7MA 4DYDA 4YYZA 5T8KC 2GN9A 4LMRA 4LSWA 1EE9A 1GL3A 4ND1A 1S7CA 4L75A 1HETA 3H5NA 1YL7A 5JS6A 2WEKA 5BSEA 2CNBA 4FJ0A 2EW8A 2UUPA 2DTDA 4ALKA 1FMCA 3WGQA 3WGYA 3ZWVA 4LW8A 3R0IA 3OICA 2ZIZA 4IDFA 4RF4A 3QIVA 1L7DA 4NBUA 5I9MA 2PGDA 1XSEA 4RLHA 1BWSA 2OUIA 1XWFA 3Q2KA 3GAFA 4JGBA 2DBRA 2VYVD 1YB5A 1LLDA 1DHTA 1ISFA 1I0ZA 3WGHA 4EBFA 3A1NA 4DTIA 1A9ZA 1LTHR 2X0NA 4XIYA 5IDQA 1U5CA 1KEPA 2WD7A 3NJ4A 4IPTA 4PG8A 5JY1A 4OKIA 1Q2XA 4YEDA 3TZKA 2C2YA 3NT2A 4TQGA 2NVUA 3PWSA 4WEQA 3ZGYA 4OYRA 1LNQA 1I3MA 2Q4EA 4PLVA 2NQ8A 4HFNA 2EW2A 3E5MA 4LISA 3SJ7A 4E2XA 1LDNA 3D3WB 3AJRA 4WOJA 1JVSA 1HYEA 3E9MA 4F6LA 4OXNA 3TDKA 4CM8A 1Y81A 4XYLA 1IYZA 4ALIA 1TT5A 3CZMA 2JHGA 4MKRA 5ICSA 4YJDA 4NDNE 3VPSA 4AG3A 2OOSA 2HMSA 5KJ1A 3DHYA 1LI4A 3FCOA 3QVOA 3E1KA 3H9QA 1Y1PA 2PLAA 1UXIA 1KYQA 3WYBA 4D43A 4FPXA 4CMEC 2O3QA 1Y8QA 2O2SA 1XQ1A 1I3LA 3QWBA 5CDUA 1VL6A 4P4LA 3TQHA 4BMNA 3GN2A 4EJ6A 4HNGA 5U9CA 3HE3A 3OJEA 1FDWA 4J0FA 1GPJA 4KWHA 4MVJP 4F46A 1PGNA 4TRMA 4R1NA 3H2ZA 5DOZA 1J4AA 4PLGA 2PD3A 2NNLD 2P5YA 3GEDA 5CPBA 2BKAA 4BO5A 3LC7O 4NJMB 4ILKA 5FEUA 3GF4A 3RFTA 1P1IA 4CMIA 2B36A 3GOHA 5FWNA 4CJXA 4L4RA 4I08A 4J3FA 1K6XA 1WWKA 3WNQA 4YAJA 3DZFA 3MWDB 4MVJM 1GQYA 3WOHA 4AFNA 1DRUA 3VHRA 3ZWNA 1W0CA 1CEQA 2YZ7A 4RF2A 5B37A 4BNMA 3GGGA 2G17A 2ZTUA 4G65A 3K5PA 1ONNA 1IHXA 5JCJD 2Y0EA 3I9JA 1YJQA 5KWEA 3GNTA 1SB9A 4DLLA 4O6VA 3GVPA 3PHLA 1SEPA 3RC2A 1HDYA 4CL3A 4FR5A 2W98A 4YWJA 5T5QA 1M76A 4ZQEA 1ZSNA 1QV7A 3JQ7B 3WMXA 2ZCVA 2B5WA 3DFUA 2D59A 3S2IA 4MO2A 3GVCA 2ZCUA 4CM9D 1ZJZA 3PVZA 2C5EA 3OA2A 1GQ2A 1HDGO 1L1FA 4MIYA 4R68A 4WLEA 1X7GA 3PLNA 1E1KA 2AQIA 3N7UA 4MKZA 4RF3A 4XCVA 1BG6A 1Q0QA 4RJTA 2C07A 3FR7A 2WE7A 4OJNA 4KDFA 4J9VA 4ZICA 4U5QA 3ZV4A 2GYYA 3U62A 5A9SA 3JSAA 4BV8A 4D44A 4E5PA 4UVDA 2OP0A 2V65A 2X9NA 1T4BA 1EVJA 2R00C 4D79A 1LSOA 1ZK1A 3GZ4A 1PL8A 3DAPA 3QWIA 3OJFA 4U7WA 4CLHA 4D3FA 4LCEA 3W8DA 2W4QA 3Q3CA 2NACA 1E3LA 2EWMA 2IXAA 3AY6A 5L95A 4DGSA 2I99A 3F3SA 4FCCA 5TNXA 3WWZA 1YJ8A 1EZ4A 1U5AA 1Y5RA 1J5PA 5DZSA 1W73A 3Q0EA 3JYOA 2GASA 4BQRA 3KVOA 3I9LA 4OXKA 4A27A 4BNUA 2C0CA 4CLDA 5EN4A 1T1SA 3BXXA 1LSSA 5BSFA 4PLTA 4CL8A 1HSOA 4OSPA 4L4SA 3IOYA 2DUWA 3TWOA 4O63O 3INRA 3HADA 3T7EA 4RVFA 3K73O 2IZ1A 2YY7A 1Z73A 3HWRA 2HMVA 1QRRA 1VSUA 1WAMA 4GAEA 4E30A 3ST7A 1A72A 5TT1A 2W2LD 2C5AA 2I66A 3GEMA 1LA2A 1PTJA 4L0QA 3DR3A 4XB1A 4DPMA 3QQPA 4U0JA 1PGOA 4NFYA 2XXJA 1NPYA 2WM3A 5T8KA 3DMYA 4OH1A 5TLSA 1NFFA 4CQMA 2BMAA 1I10A 2GERA 1DSSG 2PGJA 3ZN2A 5TSDA 3OMLA 2B4TO 1E6EA 3RKRA 2E6UX 2EV9A 1JAXA 1YBVA 3MCVA 2VHVA 3DMTA 2W2KA 4J7XA 4XQ9A 4BVAA 3U4DA 1FXSA 4NJOA 1EVZA 2HUNA 3WQRA 1R0SA 5F1KA 2OHXA 4CR7A 1V3TA 1ISJA 4ID9A 4N54A 4CMIB 3O38A 1DFIA 1XYGA 3O03A 3VDQA 2YV3A 5JE8A 1JKIA 4P22A 2NTNA 5H82A 3CMCO 3P5SA 3I6IA 1AUPA 4IMPA 5GZ6A 4AICA 1MXHA 1DRVA 4IDEA 4RO0A 1ENOA 3U5TA 5A02A 2ZYGA 1VM6A 5HWSA 4DA9A 5AXAA 4NFSA 3RROA 1A9YA 3DONA 3U49A 3JQFC 4ZQGA 3SBOA 1QLHA 2VHYA 3AK4A 4FN4A 2XAAA 4LVCA 3TZ6A 3TOXA 4BQPA 1PJCA 1HLDA 5L4LA 2NVUB 2I6TA 1B0AA 1PZHA 3K31A 4DMMA 1GTMA 4OAQA 4DQUA 2X86A 4WNCA 2IXBA 1PJBA 2VOJA 3ENNA 4D46A 2VUSA 5TF4A 1XU9A 1KEWA 4WLOA 2ZQYA 4XIJA 5LC1A 1JTVA 1QSGA 4KTVE 4URFA 1KVQA 3BMQA 3AY7A 4AJHA 3NTOA 4PLPA 3NUGA 3QV1A 1AE1A 1HWYA 2VUUA 2X58A 3KSZO 4ZA2A 2B35A 1XGKA 2Z1NA 5DP1A 5G0WA 3FWZA 3DBLA 3KV3O 3UGKA 2OBYA 4GX2A 4NIMA 1BVUA 1GDHA 4R3NA 1IUKA 1I2BA 3B70A 1ML3A 3AM4A 3IMFA 1VE9A 3OJLA 1C0LA 4ZU3A 4EITA 2Y68A 1VJ1A 4FOSA 3WXBA 2EJVA 4WLNA 4BKQA 1NWCA 1Z75A 1MUUA 3OA0A 3S8MA 4Y6SA 1E3IA 4XD2A 4L74A 5A5FA 3VPGA 1UDAA
chains in the Genus database with same CATH superfamily
3ZQUA 1WB6A 2Y1WA 3UOGA 1ZVQA 1AURA 1REQA 4NMHA 3U48A 4AIKA 1M73E 1EESA 2B2XA 5LHHA 3IPRA 5D1HA 3TUZC 1YYVA 3LVBA 1MSFC 1KP3A 3PFHA 3KFVA 2B0JA 4ZTZB 3TW0A 3ZNOA 1YF3A 4UNQA 1RR6A 1QG6A 4KZPA 2GH1A 4FBGA 2YIDA 4IDHA 2CVPA 3SFVA 1MAAA 4K6CA 2O54A 3UF0A 3U7FB 3AJDA 1IN5A 2ZAIA 2CLMB 3VPFA 2D1VA 5HCIA 2J48A 4NEHB 2OMEA 3P4XA 2JIMA 3KJZA 3O93A 3MT7A 1PX0A 4KG7A 3QQAA 4HSRA 4IVQA 4TSFD 4YLGA 2HPMA 1AVTA 3HV0A 5DN9A 2YY5A 1ZUNA 4DCCA 2A5YB 2OD7A 3TGNA 2B8WA 1ISPA 4NABA 3U4HA 1QK5A 4HQ6A 1ZK0A 4BFXA 1FTSA 1XTQA 3Q7IA 1FTWA 5GY7A 2QZJA 2O1SA 1GUBA 5THQA 3MTEA 4B82A 4DEVA 5AP9A 3NEJA 1M9NA 4OFWA 5A2QA 5F3DA 3OTGA 3QWHA 2ZUCA 2JCSA 1S7GA 5KNDA 1YQQA 3HM5A 4YT8A 2W82A 4C2BA 1E0EA 1M6VA 1VKOA 3CH5A 1AKHB 1GDDA 2UZ3A 4J94A 1CYEA 3KKEA 1FMLA 5JAQA 4B3JA 1ZFNA 4IO1A 4BNHA 2AJDA 3L1PA 1IAQA 3U4AA 4I7EA 1AHHA 4LDRA 1MRZA 2FX0A 3FHJA 3H5RA 3M1IA 1WCV1 2VHZA 3HXTA 3PHBE 1HO3A 4OSEA 1DP4A 1TF2A 2ZETA 5DHRA 3CO0S 5EXSA 4LOCA 1ZBDA 4ENRA 1U7OA 4PC1A 2VYVA 4DCGA 2V1UA 2JVHA 2RHWA 4HMPA 4Q1DA 4NR0A 1P1JA 1DADA 2P35A 3K05A 4MRMB 1Z8FA 5BQFA 3RZDJ 4NC8A 1C30A 4UV8A 3JREA 3TLCA 1NOIA 4CN8A 1ZSYA 1Y5NA 2QZSA 5I9NA 3OYHA 2QR3A 1KVRA 4ZV9A 4RZXA 3B3QA 1PD1A 4I36A 5A9RA 1R5OA 1GEGA 2Q1ZB 1X14A 4PZCA 4G84A 4XLZA 4MPDA 1UC9A 2QZ8A 4MIMA 4FFLA 4Z2YA 2IW1A 2WQ6A 2R60A 4QBKA 5K8CA 2B78A 3H2JA 4C22A 4G7HF 4IIBA 4OQZA 4BAUA 1E5VA 4RA9B 5F2OA 5M5WJ 1QGED 1L4MA 3IPCA 4KMUX 3ZCPA 1Q92A 3E6CC 4EUEA 4OAOA 1UMCB 5K0NA 4RTSA 1U9OA 2YU9J 1EINA 3CW2A 2X1HA 3FIUA 1A9OA 4XWAA 2J7PD 2OF7A 1T5IA 4MV0A 2J3JA 4YCAA 4YQEA 5T6BA 4U7HA 5ADVA 3TUJC 2CYYA 3T5XA 2J33A 3U26A 2OAEA 5AICA 3MT8A 2VFAA 3MK31 1X92A 2IYXA 2UZAA 1Q15A 4PO8A 1IVNA 1LBSA 3PJDA 4N65A 5TIIA 1VZ2A 3U4MA 2O5CA 2QQ9A 3ZGKA 2JFUA 3R6GA 3UK0A 1L5WA 4ZAGA 4BGUA 3CLTC 3BTCA 4ZDWA 1HT0A 3G79A 3THWA 1NRJB 4R2LA 3ICCA 4Z9FA 1C3EA 4RQUA 1DQSA 3JRWA 1ZZEA 4L16A 3FNEA 2GTHA 3V55A 3FBWA 4P5PA 4F3QA 1Z0SA 2JCGA 4P9NA 4U63A 1PDNC 5ERGB 4LPKA 1J56A 4O08A 2FW6A 3CZ9A 1X1PA 1Y42X 3H92A 4C3ZA 3RGGA 1MABB 3GEEA 2RBKA 4RDHA 1BJAA 2I4RA 4DKJA 4GRAA 1T2EA 1XCMA 3OZXA 4KQGA 5G41A 3NRBA 3Q40A 4XK4A 1WLYA 5FQNA 1XXLA 3BJ6A 2NP7A 3I9MA 1OI4A 1D03A 3V2UA 5I01A 1NBEA 3T4EA 2ZRCA 1W85A 5ES3A 5EXXA 2A57A 2ZE7A 2HU2A 3R7NA 4LGTA 2BGGA 5A2GA 2BZSA 4XGKA 2DM6A 4KMRA 2QUKA 3TNJA 2BFOA 5LM3A 1TUGA 4M6XA 4JVOA 3DZHA 2XMQA 2VUTA 3T5PA 3RFVA 1T1JA 2YJZA 3LT5A 2HV8A 3M7IA 1R0KA 3UWOA 3AR8A 1AKHA 3GT7A 3JVDA 2UZ0A 2XD9A 4EV0A 2F4VD 3NEUA 2GK7A 3T38A 3D59A 1GCUA 1Q74A 4GL2A 4E0BA 2ZWOA 1PEKE 5DWDA 5AXBA 1C9YA 5ERIA 2D2XA 1RAEA 2UAGA 5AW1A 3IPXA 2FN3A 1VECA 2P27A 3OPYA 4NBTA 3AEZA 3DOFA 5FP0A 3BDVA 1GRRA 3Q98A 1NW8A 2IEKA 2FEAA 1ORHA 2DYKA 3GAZA 2RGVA 4JJEA 4B6SA 2FF7A 2RDPA 2FZWA 4XA8A 3M6IA 3TRKA 3AG4H 1ITYA 2AYXA 4M3DA 2QCOA 3U3ZA 3G1OA 3DMTC 1TNTA 1IDN1 3FRJA 3VHXA 4DDTA 4J6EA 5CTAA 1TM2A 3IUOA 2ESNA 1WETA 4Q7EA 2YXEA 1QIDA 1I7NA 1OX4B 1TYDE 3T52A 3WMWA 4H31A 1SRQA 5E1WA 1CRWG 1RQ2A 4YMLA 2ZJ8A 4LNUA 3PICA 1UCRA 1D9ZA 5ADUS 4HJRA 3SC6A 5F27A 1YB6A 5HCUA 5JDIC 2GEFA 3N8NA 2CV1A 1A8HA 1AUXA 5IHXA 2AO9A 1GPLA 3T0IA 2JA1A 4FGUA 3VPDA 4QA9A 1EFVA 3ZBPA 1U98A 4YJ3A 3P71T 4P8RA 2EGHA 2K2WA 3JVUA 3VR1A 4OQYA 2MD5A 2WSYB 3W5JA 1USIA 2E4YA 4BO2A 1LVKA 1DV2A 2VDOB 2V6MA 1L8XA 3GA0A 3RJMA 1B8UA 1HG1A 2XIQA 2F9FA 1ZCBA 2GVDC 3T3DA 2PG4A 5WRFA 3R3UA 4FGWA 2ZBPA 5E2BA 3QVGA 4JJAA 2FR0A 3ID6C 4I0AA 1DKLA 4N8EA 3DEHA 4LBWA 3N70A 3CCEI 3FFXA 5FR2A 4QO7A 2QM8A 2PXCA 5JHHB 2LFBA 3GVXA 3R3WA 3GJZA 4BMYA 4CV2A 1DBSA 3I9FA 5FWAA 2JI8A 1F9NA 1TZBA 2BCJQ 1YTYA 1UADA 2X6WA 3GLVA 4KN5A 3KSBC 4C3IJ 4RK4A 3EVGA 1QH8A 1R0RE 1IV6A 1F2TA 1SUEA 3GBVA 1JQ5A 4WCDA 4BUCA 4RLQA 2PUGA 3M9WA 4Y1RB 3UHJA 4O02B 4RD0A 4PYOA 1YT5A 5DM2A 1Y9AA 2Y0DA 1UXOA 1V16B 2WHPA 1JT2A 3OJWA 1IM8A 1JE8A 4XQ0A 2VF4X 1SEVA 3RQSA 1QKKA 3F4LA 1UOPA 3ODGA 3KUCA 3U1VA 1JG1A 2A4MA 4RDCA 1KAEA 3WK6A 1RXCA 1AU9A 2DMTA 4P4SB 1ELOA 3B9PA 1HDOA 1IXKA 3K4LA 3C3CA 2Y0BA 1Y7IA 4GGPA 4DAOA 2GWRA 3DDWA 3X1WA 4YK7A 3KAQA 3TL3A 2F43A 1P6UA 3W90A 2X5JO 6ABPA 2XVAA 4A0HA 1AMOA 1YOBA 2QLLA 1M8FA 2Y1XA 4MQUA 5HKKD 5JLAA 5CDSA 3NBUA 2L02A 4IXMA 3MWMA 5FHRA 2GLOA 4E07A 3W8RA 5C53B 1A36A 3FNHA 1GARA 2O23A 4B3FX 5E3JA 4Y2RA 2CXUA 2D1RA 4MVJG 2W37A 4L07A 1NF2A 4CLEA 3WBFA 4KFSA 5KCZA 2BEUA 1CUBA 2VJJA 2QYHA 2VF7A 5K9ZA 3AJEA 3Q9NA 4JJ7A 1KYTA 2J0EA 1FQKA 2OZVA 4PQRA 4ZZLA 4JT8A 4YRCA 4WL0A 1UBRS 1QTIA 4C4SA 4GYYA 3BM5A 4MWZA 3KVNA 1QVVA 1UBUS 3PD1A 4RHFA 3W0LB 1TXGA 2C7RA 4LF8B 2CVQA 4CCSA 3V8JA 2R4UA 4F6RB 4C78A 2R7KA 1NVKA 5AW3A 5H9WA 4Y3UA 4A2CA 1YKGA 5HP4A 4B8ZA 4OX9D 3DFZA 1OCRH 1H88C 1DEHA 3F97A 4ZT4A 4R7ZA 2XUFA 3ESWB 8ATCA 1QH9A 4EI7A 3IDFA 1MW9X 3QG5A 2P6UA 2I22A 1ANKA 3IAAA 3R7FA 4CHTA 5FWXA 3GG2A 4P7GA 1IJWC 1PIWA 3VI3B 5CEEA 2ZOSA 1X1DA 3TG8A 1KJ9A 3FPAA 5BN4B 2P7IA 1K68A 2G70A 4FUTA 4YMTA 3IQZA 5C8YB 3A1CA 2O2CA 4X5OA 4DTCA 5K3EA 5CHEA 3EHEA 3I53A 3P94A 1JTEA 5AIPA 3HGTA 2G83A 4V0LA 4ZV7A 4YUXA 1EFPB 1BR4A 4BBAA 4KRFA 2VJ4A 2FSHA 5BQ5A 3J80E 4KISA 1H4VB 4G4GA 2R7AA 3IH2A 2ZUVA 1ETUA 2J5XA 1K4MA 1R1DA 4K40A 3AUSA 4UU8A 3FWYA 5G4LA 1JA0A 2BP7B 4IV8A 4Q66C 4PCAA 1JR2A 1VCNA 5AOVA 2PO5A 3KM0A 3RUDA 2DODA 4MQFB 1IFXA 5IRCD 3HJCA 9MHTA 3IQFA 4ON0A 4ZOQI 1E32A 4W8HA 3PO3J 2UXDD 1SQSA 5EYPB 2XUOA 2SCUA 3EIQA 2JH8A 5I7VA 1R1VA 2Z83A 4DBZA 3QU5A 4QYIA 1JEEA 2EP8A 4OX9Y 3QODA 1COZA 1ZK2A 3CF6R 1PVVA 3WFJA 3V80A 4YELA 1GXSA 1TMGE 4PPFA 2FP3A 3FWNA 2BI8A 4Q03A 1QWOA 1SC9A 4B80A 3TCKA 5C5CA 1Q1BA 1QZEA 4TT3D 1KEVA 5LOVB 4PK4A 1BW5A 4V19K 4RIFA 3H2GA 2E21A 4QECA 3UFXA 3ZVRA 3M49A 1G1AA 1SXJE 2B4RO 4DLPA 2FPIB 2AIRA 3C6YA 4RY9A 2ZULA 4DIUA 4AMYA 2HIMA 2A05A 3IEPA 4JROA 1UKVY 4YCJA 5SZIA 2MLGA 4QT4A 4PZLA 3HWX1 4K6GA 2DTXA 4TV8F 4CLRB 3R0JA 3D4IA 1QO7A 4JDUA 2H9YA 2QROA 3I8XA 1T5LA 2QVGA 2BFFB 1GNLA 1U9NA 2Q3EA 4Q7KA 5JBIA 1ZG5A 1K6MA 3WLEA 2CXQA 2DQYA 3SX2A 3O2JA 1UMCA 4M9XA 5LQDA 2R4GA 5JNWA 3L4KA 1KU2A 3ZDDA 3BRWD 1C1XA 1QVUA 1DHRA 1P18A 3L1IA 1E61A 2PVCA 3AG5A 1N7GA 2W6QA 3FR8A 1BOFA 3X3HA 4LG0A 1FFHA 2AFRA 4BE0A 3COSA 1PJ3A 1HY3A 3ZI0A 5C80A 2ZYRA 4P3YA 2EBFX 1MGPA 1I1QB 1VZ0A 5TB5A 1ODLA 2FN9A 1MBFA 5FB3A 1ZWLA 5AVTA 3QXXA 3CRQA 1VIOA 3PO2J 2FG7C 2CBZA 2ECQA 2DAPA 2GKOA 3H1BA 1A71A 4YEJA 3ABUA 4R2MA 3QHAA 4AU7A 4CETA 2V97A 1AGXA 3O3KA 1FY2A 4CDMA 1K5PA 4ALLA 1XCOA 3V1TC 2OBBA 4J0GA 4O3MA 4CM3A 2IDJA 3C2HA 3D6AA 3V6MA 3F8TA 1X7XA 3RUEA 4EKDA 3OPNA 4ZZIA 3P96A 2VRNA 3KUXA 2DUNA 5E8RA 3EXG2 1OAKA 3UB2A 4RD4A 4TYPA 4QDXA 1GFZA 4WSOA 2GYWA 2H9AA 1SFRA 2V98A 4EJ2A 4ALNA 1AD2A 2WJWA 2BFEB 5DCMA 3RPEA 1U4SA 2SICE 1ORIA 3Q15C 4NBRA 4FHEA 3ZNPA 1KDOA 2B8NA 4OXRA 2I9PA 3JTHA 3PFYA 2QTAA 3T99A 3ICEA 5FD5A 1C8LA 1NRIA 2IDKA 2M4GA 4X65B 2Q27A 1VMAA 4BMSA 2JPDA 1GTRA 2GZSA 2OCCH 4MMXB 1Q0ZA 2P5KA 1BTOA 1K7XB 5I7FA 5B5EC 1RHMA 4UUBA 5BR7A 2JKZA 1CQZA 2FFQA 2MYUA 5G0UA 2FW1A 3K5WA 5FV7A 3U3DA 2VKTA 5JVGF 1KI6B 2Q21A 2AQFA 4AY2A 1WVGA 2ZI6A 1KMHA 3ED5A 4D0RA 3DFFA 3V2GA 4OMZA 1AF4A 4J0HA 1IUOA 1ID1A 2LKSA 1LFAA 2DKNA 2JFZA 2BXYA 3ANYB 4JENA 4CQMB 3C1DA 4UV9A 4KMFA 4JFRA 1TBXA 3I01A 3ND5A 4B4OA 4KK3A 3AR4A 5AKZA 1R1UA 4ZOAA 4MVJE 2BGCA 2XGSA 2IYUA 3AH8A 4IOKA 3ZQHA 4D96A 1E89A 4QFCA 5GONB 4DLVA 3M81A 2G4VA 1E5QA 1J1IA 4FM9A 4Q9NA 1W1IA 1WIWA 1EE9A 1VLJA 4UDNA 3FDJA 3R0IA 2BBTA 3UHOA 2ZIZA 3C5EA 4LI0A 1BWSA 1XWFA 1Q6ZA 2CUEA 5AW6A 3PVCA 3QKSB 4NBLA 3WGHA 4FZJA 4ABTA 5KU7A 1U9IA 3C15C 1UJ4A 2WD7A 4IPTA 1DNPA 3IMKA 1V95A 2NIPA 3QHQA 3LE8A 1KSHA 1JKOC 3RLIA 3ESAA 3D2LA 5JECA 2ECBA 1G8FA 2IIPA 5EMMA 2XB8A 2AH5A 2OHHA 2EPFA 4W6QA 3PUKA 3WYBA 4PZAA 1YJAA 2AF4C 3GFRA 4G8BA 3TQHA 1RQXA 4N0QA 1W88B 1FDWA 1F5SA 4UOZA 5DOZA 4YUYA 4X64D 3H2KA 5EE0A 4AUMA 2UUAD 1AB5A 4NJMB 1G38A 3PE6A 3G8BA 3GF4A 2KLHA 4PAOA 1WWKA 4YAJA 2RGDA 4L6AA 1CEQA 5B37A 1AKWA 2ZSHA 2FVYA 1IHXA 3I9JA 1YJQA 5KWEA 3IERA 4XSVA 5J59A 1MMFB 1DBWA 1M76A 2GM9A 5T3YA 1ZSNA 3THYA 2CYBA 2OM6A 4MO2A 3GTQJ 3LPCA 3OA2A 3N8IA 2AQIA 1FVOA 3FCCA 4RJTA 3OOPA 1I39A 4BUZA 4TKVA 5DHQA 4IILA 4PSUA 2C03A 1N2CB 3BWMA 2P4EA 3JSAA 2A1TS 2CQNA 3CH4B 5IUNC 2K7FA 1M1YB 5LQCA 5H3HA 3Q3CA 4LWZA 2IXAA 5L95A 1E8DA 3E6BA 3WWZA 2DFKB 5DZSA 4ESFA 4A27A 1F9AA 1T1SA 2LSOA 3FXUA 3HVRA 4BJ1A 2V7FA 1I4EB 3BR5A 4IHJB 4KC0A 4RVFA 2QQ8A 2GN1A 4X8MA 2HA0A 4NQRA 1CR4A 4PSWA 2PKWA 4DPMA 4U0JA 5BVHB 2W93A 2BYTA 1P3JA 4B32A 3VSKA 3LP8A 4EY7A 1RSZA 4HC4A 3IH5A 2F3PA 5BO5A 1A8SA 3A04A 2B7LA 1A7UA 4TQAA 1WI9A 2R9VA 5SY6A 3FBIB 1M2VA 3TLGA 1NATA 4HW0A 4L08A 4HZFA 2MIIA 3KOXA 5K7HA 1UG2A 1A2OA 2GAJA 2JB9A 5KWJA 2V7QA 3TOBA 4MRVA 1NVDA 3BXFA 3HSRA 3ENNA 4EGJA 3MS2A 2R7FA 1BRTA 2RI6A 2FCRA 1X7YA 1AKVA 2DGDA 4XNFA 5G0WA 5E1OA 3UFXB 4PXAA 3UGKA 4MLDA 5JSKA 3B70A 3M4ZA 2Z3ZA 1ZHOA 1YW9A 3OIQA 1ZG3A 4RYLA 3H99A 4V0OA 2WB4A 2Y48A 2O0JA 1JLRA 2VBFA 2EWNA 5GAHJ 1QRYA 1PFGA 2NW6A 5JZ9A 1XCLA 4NV0A 1H5NA 3QXCA 3ZX5A 2FDXA 4B6OA 3OTOD 2ZQ5A 3O8RA 5TJ9A 1VMDA 2JC3A 4DB4A 1WW3A 2WHEA 5CM8B 2EVWX 4W82A 2CYAA 4GKJD 1LLCA 4IOMA 2A67A 2HMWA 2YOGA 3KU1A 4I1VA 2BFPA 1Z8NA 4LVOA 5LQJA 2EFJA 2VQ3A 3VV2A 3GNSA 1Y9JA 5ETJA 3MT0A 3EQLF 1H42A 1PNQA 4WX2B 2H2DA 1Z6RA 3ROUA 4CM1A 2XUKA 2FSFA 4WJZA 3TQFA 3LRTA 2QX6A 3KWJA 3CC7I 5DDIP 4GZLA 1DB3A 2QVXX 1VYUA 2WJVA 1LNWA 3HXKA 5JDCA 3GYBA 2CMKA 1ZHFA 4G0VA 4UBNA 1J20A 3OQHA 4YCNA 1IBLB 4DMRA 1JA9A 1OR7A 4HOYA 5BN4A 3DP7A 4L15A 3HCWA 4HX4A 5MGNA 3PCTA 2WHXA 3BULA 4A0SA 1L5VA 3DD1A 3O91A 5FLXK 3BK2A 4DMUB 5AI0A 2Q9BA 1Z22A 2IDZA 3DCNA 1XELA 3OFND 4B3AA 4KOEC 1XLWA 2PZBA 4YWHA 1L3CA 4X1YB 3QSGA 5CB6A 4AULA 1GNSA 1CRQA 3FCAA 4J16C 5FAKA 1MMSA 3T5AA 2ICAA 3FJ1A 3PFWO 4JHXA 3A4YA 2K5UA 1NQ5A 4Y2PA 1GNRA 3F2VA 4GLLA 2Q3DA 2V0CA 2TMGA 1HKUA 3KB8A 3IODA 3DMDA 2J5PA 1DU6A 4ZALA 4Y6OA 2NG1A 3SEFA 2VO1A 1CJUC 1ZS9A 4LB5A 3HGQA 4D25A 1GPH1 1UC5B 5JD3A 4AVZA 4C0BA 2ESHA 1PT7A 2YBDA 4G5FA 1PJTA 3RG8A 4I6GA 4P7BA 3NFRA 3NNNA 4FCWA 1DINA 2OLEA 4KPUA 4WGGA 3QWFA 2Z16A 1B16A 2R6R1 2DECA 5GGYA 2YVAA 2DVMA 1QR6A 2C57A 1XCJA 2FFAA 1SCUB 4JB2A 3T5TA 1DCKA 5BQOA 3D5QA 3FZNA 1A2BA 1VG1A 2B9VA 2STWA 2HJ9A 1Q5PA 1V9CA 3ZWWA 1CC1S 4PY2A 2BDTA 2C4KA 3QVSA 4MIKA 4BVFA 3V97A 1NWHA 1QRSA 3N28A 3N2GA 2C9MA 1YVPA 1T2UA 3OPYI 5D7BA 1ZLYA 1GSHA 1F36A 4A5SA 4QSMA 1KI3A 3GBPA 4PGGA 4JUCA 3IXQA 1YJWI 3KOYA 5ER6A 4TYWA 4KE8A 2Z2IA 2LBFA 1NJ5A 4QVKA 2DU8A 4QTUB 2ZRBA 4XPIB 4YJHB 4TWRA 2DOAA 2HU8A 1HQCA 2CEAA 5DU2A 4AMVA 1C3VA 5JAIA 3JD0A 1CZHA 3BTSA 4E46A 4P4SA 1C2YA 5A2QZ 2YN4A 4US0R 1SC7A 1WKVA 1Z91A 1BXGB 3FMQA 1M83A 2DWOA 4QOHA 2A3SA 3DO5A 2PZLA 4HAIA 5E8JA 4OQEA 3L09A 3A32A 5LWQA 2YHUA 4G1UC 4S2EA 1DRWA 3G1UA 1LJUA 4EGZA 5EKSA 2P40A 3BGSA 3QVJA 1C9DB 4GVPA 2YS7A 3U4IA 5FKKA 3JQ7A 2D1HA 2OWDA 4E21A 4A10A 2O07A 2CNWD 3GAMA 3QM1A 1AU7A 4C6TA 4CG2A 1HTWA 1Z0XA 3I30X 4MV5A 3EYAA 5IK2A 4XN3A 4G09A 3V7RA 3IA2A 5TV2A 1V8BA 1IF1A 2G36A 3VO1A 1NQUA 2MOKA 2YXBA 5CVEA 3U7RA 1HMPA 1UP4A 5LLSA 5E2IA 1DEXA 4LFAB 3REOA 1QYWA 5B2EA 1EH7A 3AZOA 5JO0A 4XQCA 1QQBA 1QANA 1XZKA 3TZBA 1WWXA 2XYVA 2YY6A 1HDCA 2IS6A 1Z2CA 2DAOA 3KQTA 2ZYDA 1E9BA 3GCDA 4IHJA 4YFVA 4TXNA 2NVXJ 2UZ1B 5TE9A 4Y2YA 2W57A 1X42A 3U7QB 1YDFA 4PYJA 1HXDA 3B1VA 3O2NA 4HSGA 5CVCA 4FYVA 1LBEA 3L9FA 2H5JA 2CZGA 3U19A 1I6LA 2FKAA 2VN8A 3BCUA 4GPIB 2WADA 5F1JA 1T8RA 2OG2A 4FGLA 5IXYA 1J59A 1DC4A 3VO9A 3WA6A 3Q9SA 1Q3TA 3WHCA 3DV8A 2ZSHB 4EZEA 4GM1A 5IF9A 3OIDA 2P67A 4EGCB 2AN9A 2CL5A 3UH1A 1MIHA 1LX7A 1HEYA 1OOEA 1UF9A 1QFJA 3JW8A 2QUZA 4ER3A 5LP6A 2OFFA 4EB6B 3R3HA 3HRUA 4DLRA 1NUAA 2BY1A 1P1HA 2EKLA 4ZHQA 2CC2A 4IQGA 4BRSA 1C0KA 1UBJS 3AAFA 4E70A 1NVVR 1C7FA 3C7CB 3OPQA 3NEPX 3JWJA 3TKLA 4EMUA 2V9ZA 3L43A 1ZOOA 1ZYRF 4P81A 5HFJA 3FSGA 2NMVA 1IPEA 2F3UA 3TIGA 2J5QA 2O5VA 2Z43A 3I52A 2JLUA 3VYRB 3HBAA 2BTQA 3CUVA 4TZ0A 4ER0A 3UC5A 4N3NA 2O8DB 3KPWA 2GA9A 2IQIA 1SURA 5E8GA 8MHTA 4MA4A 3INNA 1PZMA 1O57A 3BL8A 1N2GA 4X24A 1SJ9A 1X9GA 1SPXA 3A4CA 1U8FO 4KQFA 3B5EA 3WI7A 4AMUA 2ZI5A 1EK1A 4N8DA 2OTLI 4EPWA 2XXAA 2AUMA 4P4NA 2IS4A 2Z2SB 1NN3A 4I3HA 2AOUA 1EEHA 4JC8A 2Q3JA 2AXQA 1N36D 1I36A 5KKCA 3NHAA 4N5IX 3GEHA 4BE7B 4BJ5C 2JFBA 2LBFB 1M6YA 4PO1A 1O6ZA 2PJRB 3RFFA 3OCXA 3IP6A 3JD2A 4HO1X 1OFIA 2D5VA 4LJ6A 2HKIA 4DRZA 4U4AA 3WNCA 1RQNA 3LDFA 3KOWA 1P73A 2ATEA 1YR1A 2J3HA 3VZBA 1YIDA 4DNOA 3P9XA 2PKQP 2I7CA 2IXGA 3VC3A 3HH8A 4PBSA 1YRNA 2VA9A 3WLOA 1M6WA 4DPLA 3KWFA 1HV8A 3AQIA 4ZZ1A 5FUVA 1XG5A 2QW0X 3CLQA 1Z3XA 1UFOA 1XB2A 2ZI7A 2RK4A 3TP3A 4F3CA 5KO2A 5IF3A 4KIGA 4ZYDA 4DR3D 1ONPA 4EEXA 1HE2A 5JAOA 3L46A 1M67A 2HPVA 3I76A 3RBZA 1JJFA 3TUIC 4DIBA 4IGAA 2PTGA 4RNCA 5IVPA 821PA 4LRUA 1QNLA 3Q2OA 2DPDA 3TCXB 5JS7A 1FDSA 4G0OA 3CPSA 4Y2QA 5CD1A 4Q9KA 3K2BA 2RC5A 5JC8A 1F14A 2PGAA 2VJMB 3WIVA 3I0TA 4N5DA 3ABTA 3PD0A 2NV0A 3E3MA 4A7PA 1I30A 3WL8A 3FYHA 3HZHA 4GI1A 3S2DJ 3SIRA 5HSGA 3HKZN 4RV9A 1GCOA 1QJCA 2H7YA 1YR9A 3UUEA 3DB1A 1JRLA 3I9OA 1DEKA 4KI0A 1L7EA 1G7CA 2CY0A 1LWOA 4AJJA 3Q3GE 2MBFA 3S1QJ 3H05A 2C29D 4NK4A 1K86A 5TPWA 3KNZA 5HNFA 3WS7A 5IU6A 4ONEA 1QP4A 3R09A 1HDRA 3E0XA 2J4DA 1U2DA 1JKFA 2FR1A 1UHWA 4UHFA 2X0LA 2FMUA 4O4IF 3IEIA 2YJ3A 2GLXA 5FFXA 1D4FA 5G3ZA 1U8ZA 3ROZA 4BEWA 2C4VA 1U1DA 1NVVQ 1SUDA 3IAS2 2W25A 3W34A 4KPEC 4FASD 5I48A 2DA7A 1OYOA 3FGOA 3ZKWA 4YUVA 2P6SA 2B3DA 4YRFA 2B25A 1W19A 3WTVC 3DS8A 4N12A 3I1YA 3RWMB 5JI3E 3C2BA 3BCRA 3HYCA 3T3PB 1O08A 3M8EA 2R86A 3D1NI 1MJFA 4BKRA 4B3RB 3N0XA 1D2AA 2RGAA 2CSXA 1JHHA 3VOEA 5BUSA 4ZVOA 3P2MA 2VCHA 4FLFA 2QRLA 3MELA 5TS3A 5T4BA 5AKJA 4AI6A 2F5FA 1OLTA 2TECE 1ODDA 3ZY2A 4BE4A 1N36B 3WADA 3W2IA 4EH1A 1PS8A 3GLXA 2WZCA 2GPSA 4XM0A 1PGJA 3SHVA 2RBEA 2G1JA 1A8UA 4YACA 4N3AA 1XTBA 2YDYA 5GV8A 3BSSA 2N3ZA 3F5SA 3QJGA 5JU6A 4ZYUA 1MSEC 4GF5A 1Y8QB 2XNHA 1RYYA 5HUQA 3K92A 1ZELA 4EUNA 3LUGA 4KH0A 2WAOA 1DI0A 1WCWA 4GG1A 1JR3D 4D2IA 4DNXA 2HQRA 1ZGWA 4QO8A 1U3EM 4KPGA 2Z9BA 3DR5A 2INGX 5EKUA 1FFEA 4WPGA 4W9MC 2QTLA 3L7KA 1IWOA 4XDGA 3TL6A 1GXSB 4C0XA 4AZTA 3W2FA 3F78A 1GJRA 1AQIA 2M6LA 4LG3A 2O8NA 5EMKA 5BORA 3RIXA 1IW7F 2R8ZA 2Y31A 1ZMOA 2SCUB 2GN8A 2HCJB 2PT7A 3THRA 1ZK4A 3FNGA 3VO8A 2DWQA 1FP7A 3AHHA 1MW8X 4RTRA 4M6WA 5K1YA 5MF6A 1Z7UA 1U2QA 3QHPA 4Z5XA 2V7TA 3GRVA 1OI7A 2CH0A 5AKXA 4O4IB 3HXQA 1Q7EA 4LDQA 3IT3A 4CTOA 5FNVF 2AGVA 1V3FA 3DE5X 2ZYUX 5FNVA 1ECLA 3JQAA 3T4PA 3KYBA 1TECE 1EBFA 2WOOA 2OLJA 1NDQA 2APJA 1LXCA 2DBVO 5UKDA 3LT1A 4OV6B 2VBCA 4DEYA 1IZ1A 3WOVA 1DC6A 3FY4A 2GFHA 1HXHA 4QPJC 2HOAA 5I7SA 3F22A 4YMGA 5C8DA 4XWGA 2ECFA 4YYEA 4YAIA 3TR0A 5HJ7A 4Z4QA 1RPTA 1M2HA 1G7RA 4BHBA 3D6VA 4O6JA 2H6BA 4M49A 3NT5A 4B6QA 1A5TA 1LVAA 2R48A 4TKVB 4YCDA 2HPHA 4C7BA 3DF9A 4PFSA 1D4ZA 5EVJA 1CQXA 2QKYA 4MRAA 1N2JA 4DA7A 3WLPA 2XJ4A 3DE6X 1J9EA 2VPZA 2GI4A 3GCWA 5FD8A 3B1YA 1KJNA 4MJ7A 3PQEA 3VAYA 1PVDA 1RM5A 4IMJB 1STOA 4NCXA 3OZCA 1SR8A 2VDWB 5K5OA 4OOIA 3QPWA 2AD1A 4LOLA 2C92A 4F5DA 1ARZA 2C5SA 1AF7A 4R5HA 1S29A 4GZ6A 5LQUA 1NXWA 4RPKA 3UB4A 3UICA 4NP6A 3PLAE 2G0TA 1YX3A 2HK8A 4DWJA 2PGXA 4CEIB 3BDAA 1OLSB 4NARA 2CJPA 4N5NA 4YQZA 1J75A 3L0YA 3KTAB 1O96A 4K9SA 2A58A 5D5WB 2PX5A 3K1YA 4FEYA 4CIDA 4IWYA 3LVFO 1P9QC 1SBYA 3OMWA 3B1KA 3NXSA 1K5HA 4KP7A 4DLSA 1KSKA 4BY1J 1PYGA 1WFXA 1B6GA 5I6DA 4MLOA 3VR3A 4OHYA 2VHQA 3RAGA 2YASA 4DCSA 5AO9A 1U0JA 3RBVA 3SF8B 2F3TA 3BH6A 3VZDA 1MB4A 3GLFA 1D9XA 3U0BA 3U44A 1R10A 3ZVNA 2ODPA 3UYLA 1HNXB 4RM2A 3GG9A 4HPWA 2XB2A 4CMAA 1AOYA 1GQRA 3X1XA 3QE3A 1JJVA 2BZ0A 3QFTA 2H7VA 2F4VB 5KYTA 1UJ8A 2X3FA 2YS6A 3L07A 1TYZA 1ZSVA 3D8NA 3NDBB 5HMLA 2C4NA 1XFDA 1MT0A 2ZMEA 1NVGA 1J0EA 5AM3A 3A02A 3QEOA 1OI2A 3H11A 3JZFA 4QT0A 1UL1X 5ILVA 1ECBA 1AXEA 3AP3A 4QWMA 3VDNB 4ZC3A 1H9AA 1UMDA 3G49A 4I9UA 4LRSB 2I4LA 3WGUA 5LYYA 3CRW1 5AH0A 4C88A 4XWOA 4N40A 5SY9A 5B53A 4FQGA 3VSAA 1R15A 1X9HA 5CNKA 3CX4A 4JJIA 4X92A 1BXKA 4WCFC 2VXZA 3TLBA 2GOXB 3CTAA 2NU8A 1LI5A 1I0IA 2X7XA 3PXXA 1KZHA 2HGSA 3LQQA 1LJ8A 5F4ZA 4BPRA 5AJZA 4IWNA 3DE1X 3D4BA 2GUWA 1NG9A 5ENZA 3VJKA 3BBLA 2KJBA 4RSRA 1P2FA 5EJCA 4HDAA 2A59A 2Q3HA 5G40A 5DPMA 2PVPA 3BWXA 2F4NA 4HB4A 5TQVA 1N57A 5I5EA 4OGFA 2FUEA 4ZKDA 4MQ6A 1QO0A 1NJ1A 1TLLA 1N9GB 4GUDA 3ZLJA 1J9IA 4ZGWA 2OFPA 2OSBA 2GEUA 1T9HA 5KTSA 2KRCA 4K6HA 1BVHA 4YYZA 4H08A 2RARA 4WXPA 2P2CA 4Q9HA 3GCMA 4LW8A 1M1UA 5T3UA 4DIQA 1T13A 5K3FA 4NBUA 2Y0SA 4P35A 1T91A 2G6BA 4ASUA 4QM7A 4EBFA 3NDPA 1MJGM 1A9ZA 2G8LA 3HPRA 4OHMA 3RBAA 3IUYA 3ACCA 3U3KA 2DHDA 2NVUA 3PWSA 1LNQA 3SJ7A 1V48A 4G9GA 3ELWA 4HQFA 1GFIA 5IJXA 3M70A 1HI9A 5BV7A 1V8DA 1CVIA 3U3MA 3EQZA 3TQQA 1VDMA 3E3AA 2H4JA 2ZBQA 4KMMA 4QATA 1YX5A 1EFVB 3A6EA 4E08A 3TM4A 4XARA 5DRYA 1USGA 2XUDA 1NX9A 2ZRLA 3RFTA 3I01M 3ZDYB 4Y6LA 4F8YA 4CJXA 2BY3A 5CB0A 3DZFA 5IMSA 1C0EA 3KDAA 3FPSA 2O8BA 3VHRA 2YZ7A 2G17A 1Y1VJ 3KR0A 1SB9A 1K78B 4QRDA 1SEPA 1WMEA 1Q0TA 4S2UA 4GLFA 1X7ZA 4QPZA 5LBQA 2F55A 1DL5A 4TXLA 4BLPA 1GQ2A 1L1FA 2FJUA 2Z08A 1TUBA 3KK0A 2H00A 4RA6A 4NOJA 2C07A 1WMDA 2KYRA 1XK6A 3SDZA 4ZICA 3CGWA 1Q0SA 3OV8A 2DMRA 2JGDB 1BA3A 5L3VA 2EFWA 1E9DA 3VR0A 2KFDA 5E4FA 1XRMA 2ZUFA 4MYTA 1YW8A 5CLFA 2ATXA 3ROXA 1E2BA 1ORWA 2J6HA 1D7AA 1VB3A 1Z73A 3QOPA 1E4EA 2CHEA 2ECCA 2CLSA 3M34A 1B0ZA 3NKFA 4O8CA 2YN2A 3NJRA 1BU8A 5B7PA 2B4TO 4LHWA 3A25A 4D9IA 2QVCA 4LHSA 3CR8A 2DYRH 4C04A 3SX4A 3FMSA 2QQAA 4YJ2F 1XCPA 2AN5A 5EZYA 4RLFA 1VB5A 3WZMA 2IJGX 5EMLA 2G9ZA 3P5SA 4FDLA 5CIWA 4B71A 2JVGA 5LRSA 2X76A 3NAMA 1WB5A 1F4VA 1QLHA 3EH1A 1BC5A 4GE0A 4YXWA 1PJCA 2I6TA 4WNAB 5HK9A 1HURA 2ZIGA 3MWFA 3TOVA 4YV0A 2DSTA 2YKGA 3L2WA 3LX8A 1KEWA 3LKBA 4XIJA 1R9MA 2EFHB 1QSGA 2Q5OA 3NTOA 4PLPA 3GJ4A 3QWLA 3V7SA 1ZGAA 3MMSA 4RHCA 2XNKA 3OJLA 3HR8A 4XLNF 4RY2A 1YS6A 1GU1A 3K10A 2AVNA 3O8OB 1MUUA 3OA0A 1QO0D 2LV8A 4LXTA 1FT9A 2XZOA 3ROQA 3HUFA 2XGOA 1IN7A 2R1VA 1UAGA 2G28A 4G4SP 2M5WA 1YZKA 1WEHA 1SKBA 4DT1B 2EBWA 4CMEA 2WB2A 1XZBA 1R0YA 4BECA 1NW4A 2JD2A 5AD1A 5EEHA 2X8JA 5KHDA 5TXGA 2GAAA 4IUYA 2J32A 1RRGA 1SKQA 2BRUA 2BEKA 4GR9A 5FBKA 4XVCA 3GELA 1YFJA 1MNQA 1QVTA 3UKGA 5JMTA 1W4AA 1NI4B 3V1NA 3BB4A 5G0SA 5DTEA 3IO5A 4LBYA 2ZVQX 2BR4A 5H7XA 5JEDA 4WFKA 3L79A 4TSFA 2Q9UA 3HEFA 4KR0A 1HE4A 2H1SA 3WLKX 2VXOA 3MKWB 2PUTA 1TWGJ 2GF9A 1G6OA 2P90A 3JQ9C 5BOSB 5ICCA 5J58A 3RVPA 4RHEA 4C89A 3FKIJ 4G8DA 1CUJA 4MVJF 1YQAA 3NOOA 3D6FA 3OU2A 4F56A 4M87A 5IFLA 4U9IS 3ZTWA 1AS2A 3V3KA 4TRNA 2FMIA 3QVWA 4L72A 3WGNA 4QBIA 3ZDXB 4OX9B 1G20E 1TRHA 2VLBA 1FZTA 2Q3LA 2DKFA 4EGFA 4CDRA 3DDOA 4MRMA 1Z6AA 2GAFA 4R1OA 3ZGXA 3PNPA 1DJLA 2VYFA 1BCRA 1OBFO 3CJTA 3PCRB 2YYAA 5IXSA 3OH8A 2NT4A 5CH8A 3IQIX 4IEFB 2YZKA 3EDQA 1EK6A 4CXMA 1HQYE 2C77A 4D5GA 4DC9A 2DR3A 3OTHA 4PHTA 2CJJA 3G6KA 4WH0A 3T95A 4QDUA 1GYQA 3QX3A 4YRQA 3A26A 5CXSA 3UTDA 4GRDA 5B1YA 5BPFA 3S3OA 1PJAA 2FWAA 2XTJA 4IY1A 2PQMA 4O2AA 4DLKA 1EQ2A 3C3BA 3LPDA 3MLAA 2F64A 4Y67A 3MTDA 3R5JA 1FIAA 1W94A 2W8BB 4KO2S 4OKNA 4UTOA 5F1OA 3ONGA 3PP8A 1ITZA 3A7DA 3AEXA 2ATVA 2YVLA 4YRSA 1YAJA 1XQVA 3DZBA 3UAOA 4YCSA 1XNJA 3T7SA 4EHFA 2GT1A 5I4BA 3D0OA 1CRZA 3R4KA 4YQYA 1LFBA 3G89A 3AG6A 1K3UB 4B4KA 2VQFD 4PEVA 2Z99A 1BJTA 1G5RA 1NNLA 2OHOA 5JZSA 4Y9UA 1YDEA 2GHQA 4FYPA 2BKXA 5HM8A 4D6PA 5EJEA 1I4LD 3BPVA 1VJ0A 3WRYC 2P3SA 1RZVA 4KI7A 1M10A 1Y8ZA 2YJTD 5TGDA 8LDHA 4WK0B 5IASA 1RYEA 2M9HA 2QM0A 1E2HA 2HRDA 3LW7A 5JLWA 4RVUA 3PPXA 1NVWQ 1T43A 2O50A 3P0JA 2WFMA 3C5WP 3CURA 5BW4A 2WP8J 1QHHD 1M74A 4ML3A 4CCAA 1YB7A 1D0YA 2A84A 4WZBA 4AS1A 2CK3D 1NW9B