3KYDB

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
545
structure length
477
Chain Sequence
SRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQDQQVLDVKSYARLFSKSIETLRVHLAEKDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords SUMO-activating enzyme subunit 1
total genus 120
structure length 477
sequence length 545
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
B PF14732 UAE_UbL Ubiquitin/SUMO-activating enzyme ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.520 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ubiquitin activating enzymes (Uba3). Chain: B, domain 2 3kydB02
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 3kydB03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kydB01
1KBZA 1KY4A 2X86A 3BMNA 4BB6A 4EBFA 1E7QA 1JVSA 3NTQA 1WPQA 3DWFA 4HKTA 3V5NA 4IIVA 4IMRA 4CMKA 1H93A 9LDBA 1IULA 3AM4A 2Y05A 2PLAA 3GUYA 4YTEA 4E4YA 4L9RA 2D2IA 1HWYA 4MP6A 3WBFA 3D5QA 5TJHA 1PZHA 3QLJA 2PWZA 1VJ0A 1FDUA 5A4DA 3G17A 5GY7A 3TF5A 4B7CA 5T64A 1WDLA 2IEDA 5K6AA 3I9NA 3T7CA 3FPLA 3GVXA 3QY9A 2EW8A 5DOZA 1IUKA 2J8ZA 4RPJA 4XDYA 3QJ5A 3WSWA 5JAQA 4XR4A 5H83A 1GY8A 5F21A 3BXXA 3E03A 3VH3A 5KNLA 1XDWA 3CMCO 2RCYA 4C7JA 5EJ2A 5BR7A 3VDQA 1T2FA 3LYLA 4LGVA 1RM0A 1KEWA 2JKVA 3NDIA 3OBBA 1ID1A 1XWFA 2RIRA 4NFSA 5JCJA 5U4QA 2IZZA 3U0BA 4BNMA 4KWIA 3DAGA 1LU9A 1LQTA 1PGJA 1A4UA 3H9EO 2UV8A 3KSUA 4E31A 3DZHA 3EW7A 3RWBA 3PFWO 2AXQA 4EI2A 2GNAA 3EYWA 3GVPA 3X2EA 4GSKA 5KJCA 3ZV6A 1F12A 3T4EA 4NFHA 5CFZA 3JQFC 1X7DA 4BHTA 4YRDA 3VTFA 4E2XA 3AUSA 3PHLA 4KOAA 4QFCA 5B4VA 3KLMX 3N74A 5CAEA 1VKOA 1QXSA 4U6SA 7ADHA 3RKRA 2AE2A 2I66A 3WSVA 1U5CA 1YGYA 2DTEA 5ICSA 1MC4A 3RVDA 3OEYA 2GUGA 1DC5A 2PNFA 3NJ8A 4L4XA 3WJ7A 1TXGA 5F3RA 1L1FA 1EE2A 4U5QA 5CDTA 4Z9YA 4UEKA 4QX6A 4AICA 4WCFA 3PQDA 2YDYA 4R9SA 3GG9A 4R69A 2V65A 3U49A 3AFNA 3L6DA 3M2PA 3QVTA 6ADHA 3G1UA 3F6YA 4NBUA 1TT7A 3GGPA 3TL2A 4HFNA 1ZEJA 2A94A 4YAEA 4MIOA 4D45A 2VZ9A 1B3BA 3FNHA 4ZQEA 4BO6A 4EUEA 1PJQA 4BNTA 3KOUA 1ZUD1 5AQ1A 2GO1A 5JW6A 3K96A 3C3XA 2CDCA 1N7GA 2Z1NA 4BO9A 4ZN6A 2OZPA 2HAEA 4DQUA 4NR0A 2V7PA 4E3ZA 4XIJA 1YBVA 5LC1A 3GOHA 1QV6A 1P44A 3ONDA 3M2TA 4BGEA 1HYGA 4ZJUA 2P4HX 1YKFA 4OL9A 1E6UA 3ZWYA 1PU2A 2A35A 3JSAA 2FSVA 1LRJA 1HETA 2P4QA 4Q9NA 4IDAA 2YV2A 1HDYA 4KUEA 3DZBA 4RVFA 4K6CA 3VC7A 4AL4A 1GCOA 4Y6PA 1C0IA 4DPMA 2EKLA 4E2WA 2DBVO 3JQ6A 2H63A 5U1PA 3FN1A 4JBGA 4XGNA 4NDNE 4DPLA 1OBFO 4FJ2A 4R4JA 1Q0HA 2IODA 3AI2A 4G81A 4AJOA 3L9XA 1HYHA 1E3EA 1AGNA 1JAYA 1ZJZA 3Q6IA 3ZCXA 3UKOA 1WDKA 1BGVA 4R3NA 4CV2A 4XYEA 2PV7A 4TRMA 1D1SA 1YH3A 4DWVA 1DIGA 3LF2A 4E5MA 1PS8A 3WQSB 2B5VA 1LLCA 4GVXA 2J6IA 1O6ZA 4NG5A 4Z9XA 4J16A 1KVQA 2O7SA 1ISFA 1JWAB 1U8XX 2EJWA 4OIMA 1NQ5A 2EIHA 4JQCA 1ZFNA 2C0CA 3NEPX 4IPTA 1EDOA 2VCYA 2VUUA 3F46A 1WW8A 2Q99A 3MJEA 1H9BA 2Q45A 4CMEA 3IC5A 4RPGA 3ZU3A 3B1KA 9LDTA 3JQEA 2W2LA 3GAZA 4JNKA 4RF3A 5DULA 2O3RA 3C85A 3DMYA 5A05A 4EUHA 4ALIA 3F1LA 1LC3A 4YRAA 4R5HA 4YT5A 4RDHA 4YAGA 1ISMA 2CDBA 2R00A 1WVGA 3PWSA 2PTGA 3WS7A 1EFKA 1O89A 4XEHA 1YQXA 2CNBA 4IZIA 5DF1A 4IY1A 1E7SA 3SLGA 4A5OA 4FC7A 1H2BA 3O26A 1DLJA 2X0RA 3TNLA 3HB5X 4J7XA 4MVJE 4XQEA 1I0ZA 1SBYA 1YDWA 4OHUA 1U2GA 3I1JA 3O9ZA 4DYDA 5L4LA 1A5ZA 2BGLA 4DA9A 5COBA 5EN4A 3VH2A 4PZDA 2GRAA 4FFMA 5ER9A 1FJHA 4IMPA 5L4NA 1GUZA 3PWKA 5G4LA 3VPSA 4NJMA 2VUTA 4JP2A 4AG3A 2TMGA 5IDWA 2Y1GA 3AUAA 5G0WA 3MJVA 3VH4A 1LUAA 3HDQA 4LCJA 4CM6A 4OXYA 1YB5A 2HK8A 4W4TA 1PS9A 3NT2A 4WCFB 3ON5A 4BB5A 3PXXA 3RUEA 4IQ8A 4YAIA 4XCVA 4GPD1 1UAGA 4BO1A 5IDQA 4MVJI 1U5AA 4M89A 2NU7A 2B5WA 2XXJA 3ANLA 2ZB3A 2D0IA 4LSWA 2FMUA 4BNYA 4PRLA 5IFLA 3PZRA 4M54A 3OIGA 4EJ6A 4BVAA 5TX7A 4CQLA 3L0DA 3PJEA 3TZKA 4ALMA 1ZXBA 4MKZA 1D8AA 3UXYA 1YOVB 4QTZA 4RF4A 4FFPA 3RUCA 2NVUB 2PZLA 4I8XA 2PZMA 4YBZA 4A26A 3DBHB 2YYYA 3FWNA 1ZK2A 1YL5A 3V1TC 5JNLA 1A9YA 2HMUA 2EGGA 4NPCA 4CM1A 5THKA 3WMWA 5L45A 3KBOA 4PVDA 1KEPA 3WXBA 1HF3A 2Q50A 5F1KA 3ICPA 5JLAA 4R68A 4R1UA 2LQ7A 4XIYA 3NGLA 3GGGA 3KZVA 3W4KA 4IINA 2X7HA 5AXDA 4EEZA 4Z0HO 3QHAA 5JAMA 1FDTA 2BD0A 1PS0A 4GX2A 1P45A 4RVGA 4D7AA 1Y6JA 2GZ2A 4PLWA 3HZZA 4AJ2A 3LC2O 3PYLA 1UXJA 1VM6A 3GFGA 1P77A 1PJSA 2W8ZA 3RBXA 5IDXA 2BELA 3BHMA 3C1AA 1PEDA 2SCUA 3GLQA 3I3OA 4ALLA 2Q1SA 3B6ZA 3P7MA 5DCUA 1CETA 3BHJA 5JC8A 1YE3A 1LDMA 5BNIA 2ZB8A 1E6EA 4FFLA 4FSHA 1B15A 1XA0A 1Y1PA 3EDMA 4BO0A 5JXWA 3Q9NA 3PYXA 5EQFA 4IGEA 2Y66A 4CLRB 1R16A 4XD2A 5EIOA 3OF2A 2O23A 2W2KA 2P91A 1I2BA 2PGLA 2CF5A 1B16A 1HL3A 3KHUA 2ZB4A 3TOZA 1HE5A 4CLRA 2NLOA 3DR3A 4XJTA 4DQXA 2ZB7A 3SLKA 4CLDA 1MB4A 1DIHA 4GKVA 1I10A 5JAIA 3I5MA 3RUFA 4DGSA 4I5FA 2FHSA 3ZHXA 4DXHA 5DN9A 1PGOA 4Q39A 5MDHA 4UEOA 2HUNA 4BNIA 2O7QA 3VPGA 3WIDA 3GDOA 1KVSA 2C29D 1BXGA 4HFMA 1C0LA 4MVJF 3RI3A 4NFYA 4PG8A 3ORFA 1MUUA 4D43A 5L4SA 2J3JA 1XR3A 5JFOA 4QECA 5AXAA 4Q3NA 5CPFA 3S55A 2X9NA 5TGDA 3V2UA 5EQDA 1CRWG 3BTOA 2AA3A 1DC6A 3BIOA 4CUJA 1LLQA 3I6QA 1F0YA 2CF6A 3NTRA 4XB1A 3S2IA 1TA4A 1NP3A 2Q2QA 1J0XO 4AJJA 3GG2A 4TWRA 4AJ1A 1L7DA 4BNWA 3RUDA 1LEHA 2RH4A 4MVJP 4E0BA 2UDPA 1LDNA 2PH5A 1C1XB 3F5QA 3V8BA 1EVIA 1PIWA 1P3DA 5A06A 2EG9A 4XKJA 3H5AA 3OFSA 1UDAA 1BXGB 4OKIA 3B1FA 4YAJA 1LQUA 8LDHA 2A92A 3JYQA 3ZI0A 1JU9A 1YB1A 4CV1A 3A4VA 1SOWA 2B35A 3BTVA 5A9TA 5CEEA 3GN1A 4W9NC 2FZEA 3IMFA 1IHXA 3IIEA 3TQHA 1LDGA 4DLLA 3VTZA 3U4DA 3TFOA 4KQXA 1N1GA 2ZYDA 4CUKA 3FR7A 3U62A 1HZJA 1RPNA 2LDBA 5KVVA 1EEHA 5H81A 1MP0A 2AQKA 2PD3A 1CIVA 4PLPA 4JCOA 3PDUA 2WD7B 1BWSA 4XJSA 2NNLD 2QZZA 3ZU5A 3L4BA 1J6UA 1GTMA 3F4BA 1XU9A 2VHXA 1P33A 3DZKA 1I33A 4WLFA 5TQVA 1PTJA 1R66A 2JHGA 4TMFA 5TNXA 3MJTA 3OIDA 4FPXA 3QQPA 3EVNA 2HO5A 2Q4EA 3BYZA 3DXFA 3K73O 4ND3A 4R54A 3ZV3A 2O3SA 5B4TA 3MWDB 3IUSA 5LCXA 2QRKA 3MEQA 2NVBA 3AY6A 4BGIA 3JCZA 1RM4A 3ZNPA 3ANNA 2HRBA 1HE2A 1SPXA 1DFGA 2C5AA 3JQBC 4Y6RA 4ZQHA 2UUOA 1XELA 4CMIA 4B8ZA 3W8DA 4C7KA 1QLHA 4CM4A 3ZV4A 1NYTA 1T2AA 3VDRA 5AYVA 3QWFA 4R1SA 3JYOA 1XLTA 1E3WA 4B7UA 4CJXA 3EUWA 3WX0A 1HTBA 1ZKMA 2Q46A 3VH1A 2J3HA 4O0LA 3RUHA 4HUJA 4WLUA 4J91A 1UH5A 1W8DA 1H5QA 4I08A 2A9FA 1WLYA 4XYGA 2PD6A 3ZWPA 1WXDA 1MFZA 4AJHA 1NQTA 4K1LA 5L40A 5TJ9A 4R1NA 3T4XA 5ENVA 2PKRA 4KDFA 3RKUA 1V9LA 4UAGA 3ZHBA 4M1QA 4BIIA 2OP1A 1WNTA 2WYUA 5AXBA 4M55A 1U7HA 5JC1A 4I5EA 1PJTA 1HDXA 2NQ8A 3HWRA 3PZBA 3JD3A 1F06A 4II3A 1I30A 4MINA 1V0JA 3DMTC 3DZGA 2BI7A 2VOJA 3C7AA 3ONFA 3DEYX 2CD9A 4DC1A 2BGMA 2RAFA 4RPKA 3NGXA 3DAPA 5CDYA 3O38A 3ZDFA 1LTHR 4D46A 4E12A 3RIHA 4AJLA 5FF9A 4BMVA 5HA5A 4W7HA 1PJBA 1UDCA 3INRA 3TJRA 1ZEMA 4E2YA 1ISIA 1X1TA 1YWGO 5CDSA 3DTTA 2GN4A 1Y7TA 4J2OA 3UF0A 1YQGA 3RFXA 4PN3A 1P1FA 3IL2A 1X0XA 3LSYA 3QA9A 4UUOA 4GLLA 1SB8A 1EK6A 2VTEA 4ZVVA 3DL2A 2EEZA 4RZIA 5ER6A 1ONNA 1V35A 3F3SA 3WTBA 1DRWA 4YJHA 1UP4A 1SEPA 1VSUA 2PGJA 2AEFA 1JTVA 1T1SA 1MXHA 5A3VA 3INGA 1C0KA 4CM5A 1LDBA 4ZQGA 3A1NA 5H82A 3FNEA 1KC1A 4W99A 3F5SA 1Q2XA 3KYDB 2B37A 1R12A 4J1SA 4PLVA 1NXQA 1VL6A 2O3UA 4NNJA 3GR6A 3SC6A 4JJFA 4YQZA 3NTOA 3KYBA 4AJKA 1DBVO 1VKNA 5G0SA 3ZU4A 3AU9A 4ZQFA 3U9LA 1I36A 1X7GA 1ORRA 2WSBA 3WFIA 3CUKA 1BW9A 1T2DA 1K6XA 1A27A 4TRRA 1H94A 4BKPA 1PQWA 4UVDA 3QVXA 4O1MA 3WGTA 2NADA 3RC7A 4E13A 2C5EA 2Y1FA 2P9GA 1Y81A 3DAFA 1ENOA 4PLTA 1DXYA 2DUWA 1B8UA 5TT1A 1GAEO 3U4CA 5COAA 3HHPA 4O59O 4ROSA 1PL7A 3UN1A 1NQOA 3QWHA 3IAHA 2H6EA 1Z75A 2Y0DA 5ILGA 1U28A 4UUMA 2HSDA 1RM3A 1OC2A 1LJ8A 2X0NA 3GDGA 2P9EA 4DUPA 4F6LA 3KLPX 1DIBA 2DU8A 1QG6A 2VZ8A 4I9UA 2PGDA 3WNQA 2Y1CA 2OGUA 4CMCA 4DMLA 3HB4X 2D5CA 2VWPA 2IEBA 2V6GA 2C07A 1U2DA 3ADPA 2ZTUA 4BOYA 4IBOA 3T7EA 1A7AA 2X4GA 4P4NA 4RF2A 1GADO 4Z0PA 3TWOA 4DQVA 7MDHA 3GH3A 3KO8A 2G5CA 3ZHZA 3V2HA 2BFMA 4BO4A 5CDGA 1UZNA 3TZQA 1IOLA 2W2KB 1BRMA 3N58A 1GZ4A 2CZCA 1NVGA 1OC4A 3QV1A 4ZRMA 3WGHA 1DIRA 1T2EA 4CMGA 2JJYA 1UDBA 3DB2A 4GX0A 1GQQA 1BSVA 3JQAD 1KEVA 3BMOA 1I3LA 4LN1A 4RVSA 4NBWA 3OJLA 1S6YA 1MFPA 3KSDO 4J4HA 3QWIA 2PA3A 4N7RA 5KJEA 1QYVA 4I1IA 3U5TA 4NZ9A 3I23A 1G6KA 3M1LA 4Q3EA 4DRYA 1DHRA 2E4AA 4P4LA 4HBGA 3S2GA 3KV3O 5GZ1A 4EZBA 1GYQA 4FD3A 3JQAA 2YUTA 3NT5A 3WFJA 1A72A 1QORA 2B69A 3KUXA 3O03A 3OECA 3DHYA 4J7CA 2CUKA 2D3TA 3B70A 1YS4A 3WGGA 3JYPA 4DBVO 1LRKA 5DT9A 3PHHA 3E6AA 2Y0CA 2OL4A 2D1YA 5A5EA 3RC2A 1E7WA 2JFGA 2B4TO 4DLAA 4BO3A 2JD0A 4GMFA 4URFA 4RQTA 4CM4B 2DAPA 4JXKA 2B4QA 3ZNQA 1ADFA 1E1NA 1LI4A 1U3UA 2VT3A 2W4QA 3U09A 4R16A 1W6UA 2O50A 3GPDG 1P1KA 4CQLB 2VT2A 2AMFA 1ZSYA 4BNHA 2Y0EA 5GMOA 1K2WA 4RO0A 4HNGA 1YDEA 3C7CB 3SVTA 4L76A 4IQ0A 4FFNA 2PZKA 1IZ9A 2X1HA 3C8MA 4OH1A 1VE9A 4ALKA 4FR5A 3BA1A 1B8PA 4H7PA 3BMQA 1HKUA 1PQPA 1P1HA 4TQGA 1ML3A 4BNVA 3UHAA 3OQ1A 3IJPA 1Y8QB 3CMMA 3H4VA 1GDHA 5A04A 4CQMD 3WBBA 3VKVA 2ZTMA 1TB4A 3WOHA 2QW8A 4ZRNA 4H3VA 4P8RA 1DB3A 1LA2A 3JQ8A 3VOSA 3TOXA 4YA6A 2YZ7A 3W4JA 3F4LA 4FFRA 4KZPA 1NR7A 1T4DA 2R00C 2QZ9A 1PSDA 1GV0A 1HDCA 3G49A 3AM5A 4HY3A 4JIGA 1UXGA 2DKNA 4UVEA 1R37A 3DONA 2NU6A 1XIVA 4NQZA 1AUPA 1PR9A 1O5IA 3ZN2A 5A9SA 4ONEA 4NH4A 1SEVA 5L95A 4XYMA 1MG0A 1DO8A 4FDAA 1KERA 4J2HA 2ZQYA 1P9LA 2Y68A 1YRLA 1XQ6A 3R3SA 2UYYA 3L4BC 1DC4A 3O4RA 3C1OA 3FBTA 4TSKA 4YT4A 4OXNA 4FJ1A 2OOSA 3GZNB 4KUGA 1HXHA 3GPIA 1Z7EA 2BRUA 3ITKA 1R4NB 4ID9A 1R15A 1Z6ZA 1CJCA 4QSMA 5JO0A 3VPHA 3AUTA 4XQCA 1UXIA 5TRTA 3QW2A 4IQGA 5EPOA 2J5RA 5KJ1A 2IZ0A 5ENDA 3ASVA 3U4HA 5JY6A 2I3AA 4B79A 1I3NA 1GEEA 1NVTA 2AG8A 4IS2A 4AFNA 3RJ5A 2O3JA 4M87A 1QV7A 1EZ4A 1T2CA 4OJNA 4OOEA 4XYBA 4JX8A 2VTDA 2FR0A 3E1KA 2AW5A 4CL3A 1VRWA 2YFHA 3KYCB 3M1AA 1NAIA 1KYQA 1EVJA 2X0JA 5DCWA 3ST7A 1KIFA 3FHLA 1M75A 1GU7A 3WQRA 3CSDA 3V2GA 4UREA 2NVUA 4AJNA 3K92A 5JO9A 4BNXA 2NTJA 4RDIA 3LLVA 3GN2A 2WJPA 3PLRA 3RBZA 4L0QA 3NT4A 1DRUA 1E77A 2OHXA 3KETA 2EERA 3MOGA 4Y9DA 4YXFA 3DBHA 3WGZA 4GX1A 1PZGA 3ZWCA 2ZTVA 4W6ZA 1EE9A 1WDMA 4PIVA 1BHSA 3IJRA 3QVWA 3COSA 1NTOA 3TFQA 2VWQA 5A3JA 1JDJA 3BAZA 4BNZA 3JQCA 4OKNA 4OAQA 1KS9A 1R0KA 3OHSX 5T8KA 3DFUA 4D41A 1V3TA 2VZ0A 4CM3A 4RPHA 2CVQA 3DOJA 4P38A 5KVSA 3NDRA 3QE3A 1GR0A 1TLTA 2G0TA 3DZIA 4Y6SA 4QQRA 4BKRA 1JW9B 2R6JA 4YQYA 3IQDB 5DP2A 3RD5A 2WMDA 1R6DA 3OETA 3EHEA 1PGNA 5IDYA 3ROMA 4FBGA 2TMDA 3HDJA 1G0NA 3I6IA 1WP4A 2Q3EA 4JK3A 3G79A 3DC2A 2FPIA 3HE3A 3PWZA 2NSDA 2O48X 3ZWNA 2X5OA 3HQ4O 1CDOA 2DQ4A 2YV3A 2D5AA 3AOGA 3DHEA 4YJFA 1AE1A 3ROPA 4JJGA 4ND4A 1K6JA 5IJZA 3ADOA 3RSHA 4YRBA 4QXMA 2Z1MA 3OJOA 2QHXA 3H5RA 4LRTB 1EK5A 1R4NA 2D59A 2FZWA 2X22A 3R0IA 4KUHA 2JD2A 4B4UA 2CFCA 2B83A 3E82A 3C7DB 3K30A 2YQ4A 3RU9A 1N1EA 4WUVA 5JDCA 3RU7A 2XXBA 2IZ1A 3NJ4A 1NPTO 2ZYGA 1N8KA 1PR3A 3TL3A 3E5RA 1XEAA 2GYYA 4W5VB 4WECA 5K9ZA 2NM0A 5G4KA 5KWEA 3FSRA 3WLFA 1BW9B 4BNNA 4GKBA 3JQ7A 3QP9A 3AK4A 5JAZA 5IAAA 4J0FA 2YDXA 2IYOA 3LZ6A 4HFJA 1DC3A 3ZGYA 1VPDA 1EUZA 4E5KA 2VYVA 2ZJ1A 2QYTA 1JA9A 1HT0A 3PP8A 3L4SO 4FOOA 3NUGA 3IUPA 2AHRA 4HFRA 3SJ7A 4WASA 1T25A 1V6AA 4TKMA 1E6WA 3H9QA 4XA8A 3H9GA 3OSUA 4N18A 3AI3A 3P19A 3PGXA 4G5HA 1YO6A 1DLIA 5EINA 1E3JA 1ENPA 4CM9A 4Z6KA 1OMOA 3HFGA 1HDGO 3D4OA 4BGVA 2CVZA 3JD4A 3I9KA 2PKQO 4JGBA 5IF3A 3Q2IA 3BHIA 1I8TA 3H6KA 4RORA 4HWKA 5C7LO 4IDBA 4IDDA 4BV9A 1IZ0A 4I9HA 3PHGA 4L74A 5DDIP 2J5QA 4R01A 1E3LA 1LSOA 4GMGA 3HSKA 5EMHA 3VKUA 2DFVA 4EUFA 5HWSA 2YW9A 4D42A 4ZGWA 2HRZA 4D3SA 2EP5A 2V6BA 3FN4A 2F00A 1IL0A 1K6IA 4QT0A 3GF4A 2ZKLA 6LDHA 5ES3A 4BKUA 3H7AA 4LMRA 3VVBA 2Y1EA 2ZATA 3MOIA 4IJWA 3ZW8A 3E9QA 3JQ8B 5A9SB 2JCVA 1FDSA 1GFSA 3AY3A 3WTCA 2I9PA 1Y8RB 3QSGA 5L51A 3K6JA 1PWXA 5LDHA 2YFQA 4IUYA 3RFTA 1F17A 2EGHA 3RFVA 1JVBA 3IP1A 4QO7A 2P5UA 2B0JA 5JMPA 4Y67A 3S2FA 1YL7A 3UVEA 1GPDG 1FDVA 1UR5A 2JAPA 3OA2A 5JE8A 3UUWA 2GR9A 3TZCA 3DOOA 3BTSA 4Q3BA 1KVUA 4A73A 2E6UX 3A9WA 5L7YA 3QRWA 4LSMA 1E7MA 1NAHA 3CZRA 3WGIA 3QVOA 2FOIA 1J49A 1XKQA 4CODB 3EZYA 5AXCA 3FTNA 1VC2A 3X2FA 5ILOA 2JCYA 5CDUA 1DSSG 5KKCA 4OSOA 4E32A 4U7WA 1EVYA 2BHLA 1WZEA 2QG4A 3R3JA 4Z9FA 3ZWOA 5I7EA 4YCAA 5JMWA 1H6DA 2I5PO 3I9OA 1HRDA 3BMOB 5COQA 5EL0A 1C14A 2RH8A 4RZHA 5FWNA 3D4PA 4ILKA 2P5YA 4WPGA 4P4GA 2VRCA 3GEMA 5DZSA 2EKPA 4MKRA 2C20A 2E82A 4II2A 4DIFA 3L6EA 3UW3A 3ABIA 3L9WA 1LSUA 3DZJA 1PZFA 4WLEA 4QO8A 1HDOA 3JQAB 4ND1A 1X13A 2XAAA 1E5LA 2Q1UA 2IDZA 3KEQA 3QWAA 1U7TA 4UVGA 2GCGA 3M6IA 4PZEA 4BQRA 2NVWA 4RJTA 3B1JA 4MPDA 4GL4A 1HZZA 3IP3A 4CMIB 1ONPA 4AJIA 3JQGB 4H15A 3LK7A 1ZBQA 4BV8A 2G1UA 2Q1TA 2NV6A 4DVJA 3C24A 3GMDA 4FGWA 3Q3CA 3B20A 3K2EA 4AJEA 5CG1A 3CTMA 4D0SA 5L7TA 1XCBA 3GVCA 1EQUA 4OGWA 4BO8A 4WGGA 3MJ4A 3LT4A 3G0OA 4PLCA 4TKLA 4DIOA 2Y67A 1K89A 3ROQA 3F47A 3SJUA 2YY7A 2ZJ0A 1EUCA 2X58A 3MTJA 2GDZA 5CPBA 3IOYA 4U6QA 3UOGA 4KP7A 2IXAA 3L77A 4O6VA 2ZCVA 4WE3A 3E18A 1W0CA 4PLZA 4FW8A 5BSEA 4PLFA 4Y98A 4UULA 4RF5A 2FN7A 1HE4A 4WEQA 2VWHA 1R0LA 5JDCC 4WEOA 5TIIA 1E3IA 1P0FA 2G82A 1GUYA 1W4ZA 1ULSA 2DT5A 2GF2A 2PY6A 3LT0A 4QFDA 2XF8A 2Y1DA 3WWYA 1J4AA 1H6CA 2QRLA 5I8WA 3CZMA 4CLHA 3PVZA 1ZNQO 2C54A 1EBUA 3KYDA 1NVMB 3FD8A 1QYDA 1O94A 2NQTA 1U1IA 5BSFA 1XYGA 4X54A 3W8FA 2PZJA 3GGOA 1G0OA 1PZEA 5JYEA 3PTZA 3GZNA 2R2GA 1YBMA 3PRJA 3PFFA 4NBTA 2X9GA 4CMAA 3GVIA 2VOEA 3Q2KA 4NBRA 1HSZA 3HNPA 1AXGA 4IJVA 1P1RA 1ARZA 3WYBA 4AVYA 5C5IA 1V8BA 5IXYA 1NWCA 4YWJA 1O8CA 3UAGA 3NRCA 1ADGA 1KEUA 3ZWVA 3DO5A 4HXYA 4OQYA 1M76A 5L7WA 2HK9A 3PHIA 1AHIA 1U3WA 4NJOA 1I2CA 1NWHA 2DM6A 4BQPA 3HADA 1C3VA 3PK0A 2F1KA 4EJMA 1ISHA 5BNFA 2YJZA 4CLEA 2X6TA 1GQYA 4ZU3A 4DLBA 1YXMA 2HJRA 5TT0A 3AJRA 4BNLA 1YBAA 2JD1A 1M6HA 1D3AA 1JLLA 4UVIA 4C4OA 4KTVE 2B4RO 1FMCA 1MG5A 4CM8B 1Y5MA 1ZCJA 4OXKA 2POQX 4JN6B 4GGOA 3KEOA 4XB2A 5GZ6A 1Y8QA 3Q11A 3WG9A 4WOKA 4CMHA 4K26A 5B4UA 2J3KA 4IXWA 1QKIA 2CY0A 5ITWA 3G3EA 5BNTA 5LDGA 1BXZA 3FNGA 3H5NA 4CL8A 2FY8A 1PL8A 2I67A 2CSUA 3AUUA 3CH6A 3PEFA 4ZQBA 4EITA 1KETA 2OP0A 1I5RA 2P68A 4IJKA 5DBFA 4E21A 1H6BA 3STHA 4XX0A 2J3IA 3LC7O 1NPYA 2WTBA 2YQ5A 1X1EA 1V3VA 1GEGA 4IZHA 2HCTA 4DTIA 1C1DA 1EVZA 3FF4A 1H0KA 4TVBA 1QYCA 4GI2A 2EXXA 5HM8A 1OZAA 3BMQB 8ADHA 4U8GA 5BQFA 3GC6A 5T8KC 3WYCA 1N9GB 3OIFA 1RWBA 4NMHA 4OYRA 2UUPA 4YAKA 3AU8A 3RASA 1D7OA 5HRUA 1PJ4A 1LLDA 5DBIA 4IDCA 4R9RA 4LRSB 4E2ZA 4DREA 1X7HA 2QRJA 3JYNA 2EKQA 4WCFC 2GD1O 1NBOA 4BKOA 1UXKA 2ZTLA 3KXDA 3JQ7B 3PPIA 1NX6A 1X14A 1T4BA 4JBHA 1AN9A 1JKIA 1YVEI 4FQ8A 3MJSA 1SMKA 2Q2WA 3E9NA 1C0PA 4OSPA 2VN8A 1MA0A 2A4KA 2HMTA 4WNCA 4ESOA 1Y9EA 1IE3A 4CMEC 5FI3A 4S1VA 4PVCA 1I3MA 1XGKA 5IN5A 2I65A 3TN7A 1SOVA 4KDEA 3W8EA 4J9VA 1P0CA 1Q7BA 1YQDA 1G1AA 3MCVA 4J1NA 2I99A 1IYZA 3G1TA 2V6MA 5JCJD 3HG7A 1L7EA 4PLYA 4RVUA 1R4MB 3KB6A 1BXKA 5T5QA 3OQ6A 4YDRA 4BKQA 5I9LA 2JL1A 2HQ1A 4MOWA 1YOVA 2XOXA 5I7SA 3DFZA 5TSDA 3OH8A 5I9MA 1IY8A 1PGQA 3E48A 1DAPA 2VQ3A 4R1TA 1CEQA 5T57A 3ULKA 1HDZA 3JD1A 3K2BA 1NASA 1CYDA 4E33A 3PGJA 3H2ZA 2UVDA 3TZHA 4I5DA 1H2HA 4Y8VA 2E48A 4BS9A 3OQBA 3CXRA 1SNYA 4R3WA 4WK6A 4ALNA 5ICMA 4L73A 3PDJA 2IRWA 4IDFA 2PKQP 3A06A 2I76A 1E3WB 1JAXA 3PIIA 5C3MA 1N2SA 4J49A 1K3TA 3AY7A 5KCZA 3ZH2A 1B0AA 4BNGA 5I9NA 4BNFA 1A71A 4DPKA 4DBZA 1XQ1A 4IS3A 4XYLA 2GERA 3TPCA 3VPXA 1EFLA 2OO5A 1DOHA 5DBGA 3OP4A 1FDWA 5HS6A 3TDKA 3ONEA 3GMSA 3LT1A 1M67A 3S2EA 1RKXA 4YJGA 1XU7A 3W6ZA 3VZSA 5IZCC 3KM0A 4J3FA 1Q0LA 1ZK4A 2OUIA 5U9CA 5JCXA 1DFHA 1TT5A 2EW2A 3JYLA 4YYZA 5I7FA 3GNQA 3DDNA 4RPLA 2ILTA 3OEWA 4S3MA 3DQPA 4CV0A 3H9JA 1Y8XB 2JAHA 4WKGA 4CLOB 3GY0A 2JFFA 2VYND 4AJPA 4ZICA 2GLXA 1I01A 1OOEA 3E9MA 3OICA 5AVOA 4YT8A 4D0RA 4BMNA 1VLLA 1YJQA 4JBIA 5KTKA 3ZHYA 2ZIZA 1SZJG 4FN4A 4XR9A 2HJSA 2Q2VA 2DUUA 2V6FA 1BTOA 4MJLA 3ETEA 4GX5A 3GEGA 4NBVA 2VYVD 3CIFA 4E5NA 3NDJA 4ZD6A 3CINA 3UCXA 1CF2O 3UH1A 1VL8A 4YJGB 3KVOA 4YEDA 3OA0A 2EF1A 3L07A 5FYDA 1DPGA 1M66A 2JFHA 4N5LA 5TC4A 1UUFA 1DHTA 4B3HA 1LX6A 1ZIDA 3PJDA 3RC9A 1XG5A 2IYPA 3JTMA 3I4FA 1ZVMA 4GAEA 4F3YA 1UAYA 3D3EA 4CV3A 1BVUA 2BKAA 4DIBA 2WE7A 3NAQA 4FGSA 4CM7A 3ONHA 1X15A 2CDAA 4CMJA 4AJ4A 2HKIA 4KQWA 2WM3A 1A4IA 1F8GA 4DL9A 2PFGA 2DBZA 2Q49A 2VRBA 4HADA 3UCFA 1NHGA 2O4UX 2JHFA 3FI9A 3FTPA 3PYMA 3W6UA 3VHRA 1LDYA 2YV1A 4GQAA 3AI1A 2QIOA 5KIAA 4LISA 2X0IA 5T6BA 4XGKA 1GQ2A 3QVSA 4UUNA 1Z82A 3PJGA 2Y1OA 5G0UA 4D44A 2EV9A 2NU8A 1WWKA 2WWRA 5L53A 2C2YA 3UCEA 3H3FA 5BSGA 2YHUA 4TRNA 4CMBA 3DBLB 2AE1A 2DLDA 2VNSA 3DMTA 1DRVA 2BFOA 3ZZNA 5CEJA 4QEDA 4R51A 5DCYA 1J5PA 2JCXA 4LCEA 1QMGA 3U4IA 3FRJA 3QIVA 3WGOA 4TROA 1KOLA 4XZ3A 4RLSA 1YONA 1HYEA 1UZMA 3VZQA 3OJEA 4B4VA 5K0ZA 1HDRA 5KKAA 1X0VA 1C1DB 4YT2A 4MVJG 1DJNA 1GUFA 2X9VA 3W4IA 1Q7CA 3K9QO 3R6DA 1H6AA 3WICA 1ADCA 4NJMB 1M2WA 3IDSA 4HNHA 3WMXA 1LRLA 4LK3A 3INTA 1ADBA 5JYDA 2GN9A 4IDEA 1CERA 1DAOA 2GZ3A 4MIYA 5T67A 5IZCA 4FS3A 4GVLA 1QP8A 1UXHA 4PFJA 4XWYA 2NWQA 1UJMA 4U0KA 5JS6A 3WYEA 4JP3A 2Y93A 3KYCA 4BNUA 4YB8A 2WD7A 1LNQA 4OO3A 1GD1O 2NTVA 1TVEA 2NTNA 1HSOA 2GSDA 1A7KA 1UP7A 3GZ4A 2BF7A 2EWMA 1RM5A 4CPDA 3GUCA 1WMBA 3RC1A 1O95A 1NHWA 3A14A 2C59A 2Y99A 1GYRA 4UEJA 1ISJA 4FIZA 3WB9A 1E7RA 1TI7A 5A5FA 1UZLA 3EGOA 4RVDA 4J7UA 1K0UA 3SEFA 2GPTA 4MDHA 1T24A 3OJ0A 2O3QA 1Q7GA 2ZCUA 1Z74A 4WOJA 3OJFA 2E49A 4GGPA 1P1JA 4IGFA 4NU5A 1Y9AA 4PCVA 1Q0QA 5A02A 4RGBA 4A7PA 1NNUA 3N7UA 1I3KA 1E1KA 2DBQA 4M49A 1DIAA 2FP4A 3I9LA 4FB5A 1E3SA 3KTDA 5G2OA 3WGQA 1TEHA 2CMDA 3I83A 1VJ1A 4Q3AA 4BNKA 3HN7A 2Q4BA 3VVCA 1JKJA 2H5LA 3LVFO 5A9RA 1SO8A 1NM5A 4B4OA 4CR8A 2AQIA 2BMAA 2BFPA 1MC5A 3MJCA 3PJFA 4J6FA 2RHRA 3ROKA 1JKFA 4L4SA 3UICA 1O9BA 4O63O 2AEJA 4YACA 3QWBA 4XQGA 1MV8A 5DOVA 2DBRA 4WLVA 1MGOA 1BG6A 1U4OA 3DZFA 3E8XA 2G17A 3K31A 4RCVA 4UUPA 1K5HA 4P22A 1E7YA 3D64A 4LVUA 4BNJA 3PQEA 1ZMOA 2I6TA 5ADHA 3PQFA 1ZW1A 3WR5A 5F5LA 1E1LA 4GWKA 3RJ9A 5THQA 3TSCA 1BMDA 5B12A 2AG5A 4CUZA 5KVCA 3ASUA 1GZ6A 3OMLA 2PK3A 3HUDA 4XQ9A 3EAGA 3JQ9C 3NX4A 1JWBB 4DMMA 2BGKA 3V1UA 4IXTA 3AWDA 1LDEA 2RBEA 4BO5A 2FR1A 3ETGA 1RYEA 1YJ8A 4EW6A 2GN8A 3GHYA 1ISGA 3DBVO 3GHHA 1KVTA 2VHYA 4FCCA 3GA0A 2Z5LA 4YJFB 1VL0A 4ZHSA 1B7GO 4N5MA 1T1RA 4CLOA 1KC3A 3RQSA 5A1TA 1QYWA 3EVTA 1FK8A 3UFXA 2H9IA 2WD8A 1Z45A 2O2YA 3LC1O 4YJDA 1HEUA 1GCUA 2C82A 5JDIC 1W73A 5GZ3A 4I9NA 3GNSA 4PGFA 4J4TA 2XPCA 3H8VA 3ITDA 5F1PA 1ZO8A 5FFFA 1SC6A 2LDXA 4F6CA 4JROA 1GPJA 2PH3A 2QQ5A 2O4CA 1SB9A 5JDIA 3A28A 3KRTA 2UAGA 3FPCA 2VRCD 4KTTE 1NPDA 3E5MA 3FR8A 3HDHA 3DBLA 1B8VA 3ZNNA 4GSLA 3AFMA 1ULUA 1I24A 1B2LA 1IHYA 1RYDA 1U4SA 4GWGA 3ENKA 5FI5A 4PG5A 1R4MA 4MP8A 2VWGA 2EHDA 4BUCA 1S7CA 1KVRA 4CR6A 3RROA 1CQIA 2HMVA 4CLXA 3RUAA 3GVHA 3WIEA 1EQ2A 5CEFA 2GZ1A 5JPIA 4FC6A 2OBYA 1R0SA 3D3WB 1PJLA 3F9IA 4GH5A 1DDOA 1IPEA 1I2ZA 1NQAO 3L6OO 5CG2A 1EDZA 5C37A 2X5JO 4JJIA 4J90A 2EP7A 3D7LA 5CP8A 3AOEA 1F8FA 3EMKA 1ZMTA 3EY4A 2HU2A 1VJTA 5CHEA 2HLPA 5K6AC 1M6WA 1N9GA 3K5PA 2AQ8A 4BO7A 3D1LA 2FPPA 4HP8A 3ZNOA 1JQBA 1ZK1A 4TVOA 2ET6A 4U0JA 3EK2A 3DHNA 3JQFA 5KJFA 4WLOA 3ANMA 5EERA 1YB4A 1PQUA 1ZSNA 1PJ3A 4WLNA 2D8AA 3CE6A 4ALJA 1LXCA 1PX0A 3C1TA 1T26A 3JD2A 1N5DA 1IPFA 4RV9A 1P1IA 4XRGA 4N54A 3HDYA 3KSZO 1ENYA 1GYPA 1PL6A 4H16A 3MZ0A 3ZW9A 3RUIA 5J23A 4EDFA 3O8QA 1C1XA 3FNFA 1PJ2A 4OQZA 3VZRA 4J4BA 2DC1A 4CR7A 4CQMB 1DEHA 4RL6A 4MIEA 4PG7A 1HLDA 1DJQA 1ZZEA 4FFOA 3GRPA 3CKYA 3JD0A 4W9NA 5B37A 4OMUA 1FXSA 4BGUA 4W82A 4TZTA 3V1YA 2WE8A 2IXBA 1JN0A 4O5OA 3EZLA 2FWMX 1SCUA 3VPFA 1P74A 5KJ6A 2E37A 4YVFA 3DOCA 2G76A 4DC0A 2PX9A 4KMSA 4PG6A 4A27A 2C2XA 3I52A 3JQBA 2OXIA 3W1VA 5JBIA 4MP3A 3BZUA 3H3JA 2B36A 3HN2A 5C7IO 4Q3DA 3ZWAA 1WMAA 3GRKA 3GFBA 2FSSA 4MVJH 4I5GA 1Y8RA 3BMCA 1QYXA 4D3DA 3GQVA 5JY1A 1U9JA 1Z7BA 3ZWMA 4LMPA 4YJHB 4GLOA 1SAYA 3OM9A 3S8MA 3IKTA 3K8ZA 2W2LD 2QYSA 4JLWA 4MKXA 2Z95A 2ZK7A 3JV7A 5TLSA 3D0OA 2PR2A 3LLSA 4MO2A 1PWZA 2VHVA 3D5TA 4K6FA 2DVMA 4K28A 4QUKA 3DTYA 4D79A 4Z3KA 1DFIA 1TT5B 2EJVA 5HBRA 4PLHA 3ETDA 4A10A 2GASA 4F45A 4XGIA 2QX7A 4J1QA 4NHEA 3LU1A 1Z73A 4R41A 4Z0TA 4DYVA 5ITVA 1VI2A 1QSGA 2GN6A 3P2OA 2C7VA 1EMDA 4B3IA 3Q1LA 5F1OA 2AEMA 3MTGA 4WCDA 4MVJA 2HMSA 1BDBA 4LVCA 3JQ9A 4NK4A 5FEUA 5IXSA 2J5KA 4MVJM 1V3UA 4FJ0A 3TZ6A 3EC7A 2FRDA 4IJUA 4OM8A 2NU9A 1HE3A 2BH9A 1MX3A 3S1LA 1B14A 1FF9A 4L75A 3WGYA 2DFDA 4UVHA 1EUDA 4N5NA 1CWUA 1BVRA 1U8FO 4B3JA 4HX5A 4HV4A 4PLGA 3HJAA 1XSEA 2OORA 1E1MA 1E5QA 4IDGA 3GEDA 3I9MA 1Q1NA 3D3WA 4E5YA 1NFQA 3PI7A 4G2NA 3FWZA 4L8VA 3NKLA 3FBGA 2FPGA 3NYWA 1MXFA 1BDMA 1OI7A 4LW8A 5HS4A 2W98A 3Q0EA 1ENZA 2HK7A 5C7OO 1B3RA 2IE0A 5DNAA 3P2YA 4K9DA 3ZWWA 1E92A 1CQJA 4R5MA 3WLEA 4D3FA 3WNVA 4TRJA 3F1KA 4INAA 4IM7A 2AQHA 3FCOA 4ND5A 5L3ZA 4E6PA 5I7VA 2PD4A 4RLHA 3GK3A 2X8LA 2P9CA 2P2SA 3IKVA 1ZH8A 2I3GA 3I9JA 4NI5A 5I8ZA 4EYEA 3WJAA 3H2SA 3U3XA 2ZYAA 4YPOA 2OMEA 3JQGA 4E5PA 3WQQA 5KVQA 2X5KO 4L4RA 5B1YA 5A03A 1B26A 3SC4A 1XHLA 5G4KB 1MLDA 4PZCA 2YHIA 2NUAA 1VSVA 5IN4A 5G0VA 3PLNA 5HTOA 3ONGA 3NV9A 3GDFA 3AM3A 1EBFA 4Q3CA 3ENNA 2O3TA 2O2SA 1NR1A 4PG4A 3ICCA 4CM9D 3LF1A 2OFPA 1ONOA 2VHWA 1F14A 3LDHA 4MVJD 1I32A 3ZV5A 4NIMA 3HFSA 4W7IA 1N7HA 3GT0A 3RAJA 4ITUA 5EESA 3VZPA 3JQDA 5L9AA 1NFRA 5KOIA 1KY5A 2BI8A 5IZ4A 4A2CA 3LQFA 1HLPA 5IG2A 2DTXA 1ZJYA 1D4FA 4B8WA 1QLJA 3H9UA 1OAAA 2DTDA 5MGBA 5G0TA 1PGPA 1E0DA 2WDZA 4F46A 3BTUA 2YHIB 3Q9UA 5F5NA 3BMNB 4J43A 3ZU2A 4B7XA 5AOVA 1QRRA 3R1IA 4WNIA 4OOFA 4A0SA 4CM8A 1ZK0A 3GNTA 2VUSA 2ZQZA 1LC0A 1P31A 1UP6A 3SBOA 1N92A 4EEXA 4J0EA 4J9UE 4XDZA 1ZSVA 2CVOA 3PIDA 4FOSA 1QR6A 2X23A 5TF4A 3ZWBA 4ND2A 1U3TA 1AHHA 3SX2A 4XRRA 5BSHA 3H65A 4PRKA 1ZXLA 3P5SA 2BLLA 4E30A 1LSJA 2Q1WA 1GV1A 1Y5RA 2NACA 1H9AA 3PHJA 3RCBA 1WAMA 3WDSA 3ZWXA 1LSSA 2VHZA 4B4WA 3DBRB 2DPGA 4KWHA 1A9ZA 2D4AA 4NU6A 4A03A 4YR9A 1RJWA 1GL3A 4WJZA 4RQUA 3CPSA 2HMWA 3RBVA 2WYWA 4BMSA 2VNAA 1LLUA 3DBRA 3AOEC 3CEAA 2WEKA 2BFAA 1OFGA 4CQMA 2HDHA 3D4NA 4M8SA 1AXEA 4G65A 5DP1A 3O8QB 4BL5A 3BMCB 4Z3DA 2OBNA 3MWEB 5TS3A 1D1TA 1PJCA 1GZ3A 5JSFA 4NK5A 2H1SA 3IS3A 3GAFA 4IIUA 4BO2A 2W90A 1U3VA 4TZKA 4EGFA 2VYNA 1O0SA 1ZK3A 3AW9A 3I4CA 3LT2A 4ZA2A 2FR8A 2RHCA 1YL6A 4M86A 2WYVA 3WWZA 2C7GA 1NFFA 2GGSA 1IB6A 3SXPA 5BT9A 4GBJA 3TRIA 5FQ2B 2DPHA 3UGKA 4EJ0A 1LBEA 4RVHA 4J1TA 1WZIA 3VAZA
chains in the Genus database with same CATH superfamily
5K5RA 1TUIA 5JHHB 4EBFA 4YCLA 5AOAA 1IULA 3CRZA 3QLJA 2A9OA 1KIMA 2F1HA 3DLPX 1VBNA 4MMZB 4G4IA 4PX2A 5TY0A 2B78A 1IUKA 2J8ZA 4BFWA 2G9WA 1RYHA 1X80B 4CN9A 1SCBA 3DPLC 8ABPA 1OW3B 3ZMVA 3THYA 4PPQA 3F73A 3HKDB 4WY5A 5PNTA 2A8YA 3GVPA 1ZCFA 4X84A 2XECA 3EPJA 1V8FA 1X7DA 2O0LA 2I1SA 2XDVA 1ZP6A 4DWWA 2W82A 4AECA 3F6CA 3G1MA 2GAFA 1ZNWA 5CDTA 4KJZA 4Z9YA 1C7IA 4NE9A 1LD3A 3MWJA 3QMMA 3GGPA 3TL2A 4D45A 3ZCSA 4EKEA 3KZIC 3PUZA 2JK0A 1MJGM 3H2YA 1A9QA 5DM2A 2QAGB 3T6KA 2AFHB 3BZBA 3RHTA 1M54A 3FMRA 1P2BA 4YCDA 2IUEA 2DT8A 1QAOA 1R8JA 1N5KA 1HKQA 4JJ8A 4G86A 4UB6C 1G21A 4XGNA 3GFTA 2JIMA 3SSOA 3ZCXA 4V38A 5B1IA 4M1OA 4RL4A 4LNAA 2D1SA 3O7MA 4TRMA 4C78A 1EHCA 4V0MA 4LLLA 1M1YA 1UKZA 3N2LA 4PC1A 3EFHA 5KNDA 1TW2A 1EK1A 4YYEA 1HQDA 3NEPX 4LDQA 5HILA 5CFNA 2XE4A 4O2RA 4ZEMA 2Q45A 3GI1A 2RIPA 2QM7A 4RULA 5E8JA 1R6VA 2AOVA 1LC3A 1O3YA 4YRAA 2JT1A 4R5HA 2QTBA 5CYPA 4KXVA 2GJKA 4IHXA 3AW8A 3DWEX 1H2BA 1YIAA 4JP1A 2DHQA 4A3EJ 5KSWB 2R44A 1YE8A 4FMCF 1NV9A 3BJEA 4D0PA 4FS8A 2N9UA 2IYSA 2CLHB 3OMWA 3OCCA 2XXAA 5HDNA 3LNQA 2QR2A 4RABA 4L08A 4UB8C 4A0QA 4DNQA 3QVLA 4F7ZA 2MTBA 3K09C 4A3CJ 2RHHA 4QTZA 4H4EA 4XIIA 1MNQA 3BCBA 3LOPA 4XOPA 4EENA 5BV1A 3HOSA 1SWVA 5F1KA 2AUNA 3ZGVA 1AQYA 3D54D 2PKXA 3WG7H 3DCYA 4MLOA 5ICFA 1KFJB 4YMVA 4JENA 1P77A 1PJSA 1VF9A 3DFIA 3C1AA 4HV5A 5AVJA 1JU4A 2ZJ6A 4M0KA 2BEWB 3EDMA 1DWUA 4PYRA 4Q19A 4O4JB 2JH9A 3O1LA 2O23A 3ZDAA 5AW0A 4RB0A 1PYOA 1HE5A 2REOA 4ZVSA 4TTJA 1I10A 3BSWA 4S0ZA 2M30A 4DGSA 5DM60 5GV7A 3ZHXA 2FD5A 1GPKA 1SBTA 3FPKA 3K2IA 2O7QA 3WIDA 3AUYA 3ZHOA 2WJAA 2VK1A 1XR3A 4MRMB 3NCTA 2HRQA 2EAUA 1T98A 2IIBA 2P7IA 4JB0A 1NP3A 2FCRA 4AJ1A 1QFXA 1Q17A 1TWCJ 4RQBA 2OHIA 1OCTC 2IP4A 4B6EA 3IC7A 1EFVB 3VGPA 4CV1A 1CNFA 3ZBTA 1M0EA 1FY7A 4C4XA 4MUGA 5K5QA 1PSZA 3U4DA 2WPDA 1V4BA 1EEHA 4BLPA 3LSPA 3KV1A 3UGTA 2QZZA 2VAXA 3FIWA 1VPTA 3C8UA 4EI8A 3T3HA 4CBVA 1E58A 4LPSA 2C4WA 3DLCA 1KK0A 4ZYXA 3SP1A 2UYHA 4C3JJ 3IUOA 2L42A 4YHHB 1Z4QA 2UYGA 2JFZA 4Z7OB 4CMIA 4W6QA 4QDOA 3SGLA 2GH1A 3IH5A 3QJGA 4GP9A 4DV5B 5EEAA 1HUQA 2ZAGA 1W8DA 3DPUA 2PYIA 2V3VA 1QHHA 3FIJA 3FVQA 2CKMA 3UTDA 4UAGA 3ZHBA 3ROTA 3F0CA 4X1KB 1S29A 1IY9A 4W9MC 5TQ0A 5FTWA 4FFSA 2HCFA 4MQFA 1RPJA 2ZWIA 1RWMA 1YIJI 4E88A 4ML3A 2LR0A 1UDCA 4OWRB 3BERA 4N12A 5CDSA 3SYKA 2V4MA 3IO3A 1ZOOA 1X0XA 4RGRA 4ZVVA 3Q5FA 4F86A 2HGCA 2ZJQF 2YS6A 3KELA 4YK7A 1T1SA 3QLVC 3GCDA 2HOSA 3I58A 2FE1A 4BVBA 4J1SA 2FW9A 4ZTFA 5EXTA 1DQZA 4B4KA 3N8HA 3RPEA 3CUEF 3QENA 3ML1A 4OX9Y 3PXBA 1Y81A 2IEGA 2X0FA 3V8NA 2W11A 1DXYA 5TT1A 4HF0A 2QMUA 3U4CA 2XEDA 2AFRA 3OC0A 1C0EA 1U28A 2HF2A 1G3SA 1XSVA 1LJ8A 3IAM1 2Y71A 4RU1A 2WBLC 3B3JA 1E2GA 5FTLA 1MBEA 1Z0UA 2DLNA 4O02B 1G4HA 3RSCA 5D5HA 3W5DA 2Z57A 2PO5A 2XJ4A 3TGPA 3M8JA 2YMQA 4BRZA 1NVGA 3OWOA 4LDRA 3JALB 2OQVA 3GPCA 2Z5VA 1L4FA 2IPLA 3OIUA 2O2CA 1M1NA 2HL6A 2VQLA 1JDSA 3U81A 3QSYA 2K85A 3Q6MA 4RGXA 1G18A 1VFPA 1TQ2A 2YUTA 5C8YA 4W5QA 4KI0A 3E2PA 1VE1A 1YZQA 1MHTA 2VJ4A 4FZ5A 1PKEA 2OL4A 2PKWA 4MRNA 3CO0S 2WFLB 2RD2A 4PGGA 2Z9DA 4B2IA 4IYRA 3A03A 1H4TA 1ZSYA 3NKVA 4XB6B 1VQ6I 3SHQA 4L76A 4M83A 5CLQA 1XB4A 3KXKA 2GA2A 1Q0ZA 2O8XA 1FQKA 2XZDA 2XIJA 5C1OA 3QTLA 4C3VA 4J0GA 1LA2A 4IWXA 2GXUA 2W00A 1CIPA 1W8IA 1WMEA 1GV0A 3G49A 5JJBA 1IEVA 3EBPA 4Y0NA 3DYIA 3CP2A 1MG0A 5I4CA 1YULA 1R8XA 3ORQA 4ANFA 1KQ9A 2JIZA 1ZITA 2QN1A 3KNZA 5ERYA 3FMVA 2HTEA 2H92A 3GZNB 1R5HA 4WY2A 3GJTA 3LUFA 4CKCA 3K4HA 3AJEA 1S7AA 3GTPJ 3GV0A 5L3VA 2E2JJ 1ZLJA 1UXIA 5TRTA 1QP7A 4YP1A 4CDGA 2ADFA 4KRXA 2J5RA 1VG0B 1XJCA 4QLAA 4L0ZB 4E5VA 3FFBA 2YFHA 4FFWA 1N1MA 4CT0A 1AU7A 5JO9A 2KJQA 4JLUA 3ZWQA 2LBFB 4Q4LA 1S0UA 1PNOA 2PSEA 1YGPA 4U8HA 3CISA 4DJJA 4EGYA 3Q0IA 1B4DA 2EKZA 3I54A 4OKNA 2HVQA 3OLVA 2VYQA 1T33A 1NVDA 1I94D 1E2JA 4D41A 1V3TA 4RPHA 1DZ3A 3PI6A 1C4KA 4FEAA 4KGXA 1HURA 4ZCQA 1QK3A 4TYYA 3ZOZA 3W2VA 1TLHB 3QKIA 5AW2A 3U6BA 4MIMA 4CU2A 1GZDA 3HE3A 3DHEA 3LUGA 2FK7A 2C9OA 3FHJA 5JANA 1Z56C 4QXMA 3VR4A 1RKBA 4ZHQF 2SECE 3HOZJ 4JXXA 2R0QC 1J0CA 3ZGOA 5KWEA 4X85A 1O0BA 1RXEA 5HKBA 2IYZA 3IQGX 2QDKA 3LA7A 3MTBA 4HFJA 5KAIC 3SMQA 1F6BA 3JTEA 1D5YA 2OCCH 1JA9A 4AWXB 4P9FA 4RACA 3JQPA 2IH2A 4TV8F 1RWNA 1GZUA 2C2KA 1P4AA 3P19A 2NSJA 4Z6KA 4ZI7F 1U9OA 4F1JA 1I8TA 3AF3A 5DK4A 3CR3C 1EHYA 3SC2A 1IZ0A 3G0DA 1KMQA 4ZGBA 1AKMA 2X6YA 5CA1B 2VA8A 4CHGA 5ALLA 4ODIA 4V24A 2ZATA 1VB5A 3ESYA 3AB8A 4Q12A 4L4YA 1VPVA 4IUYA 4JLMA 1J2JA 3RFTA 2ZEJA 1VRCA 2E18A 1YTUA 1YL7A 1GA6A 2WM9B 2QQAA 1JHXA 5CBPB 3DOOA 2GRUA 3FA2A 4DCMA 1SVWA 2XRLA 1XKQA 1G4AE 2YZNA 2GO7A 2VHCA 3OQOA 1VC2A 1V6SA 5EJ4A 3PQ4A 3R3JA 4Z9FA 4GKJD 3WYGA 3V8EA 1ND6A 4ZYHA 2FFHA 4RZHA 1A5AB 3LPAA 2BAGA 4UE6A 3ABIA 3L9WA 1LSUA 3H99A 2DT7B 3GF2A 4JV5D 1UODA 4GQIA 2NVWA 4A3GJ 4QD3A 2E55A 1EK0A 4Q4DA 4KQMA 2Q1TA 3F72A 1YR3A 2PJDA 3FOCA 3TXAA 3QKRA 5E6SA 2VDWB 3IKJA 4BMOB 3LI2A 4ASUA 1W0CA 4PLZA 3SHVA 4QYXA 4D4MA 3E5NA 4LQ4A 3GJYA 1T5IA 2PMKA 4PFPA 1HW2A 5F78A 4W8OA 4CLHA 3LWFA 3VBCA 3R60A 3OTQA 1NVMB 1U7OA 4JP5A 4NDZA 3F4KA 4TLBA 2EKDA 2XUQA 1LB2A 2VATA 1IUPA 2WFAA 4XWOA 4JJ6A 3ORSA 3RTAA 2I91A 4R7TA 5DXFA 2WKQA 1O0CA 1U3WA 4O4JA 2HJHA 1RMTA 3LTNC 1DKMA 1V8ZA 4RHFA 4ENUA 4ECEA 3PK0A 3AERB 1A97A 3J7YJ 1KFBB 1F4VA 1GJRA 1JXOA 1M3SA 4FE7A 4UM8B 1JLLA 2QU8A 3RQIA 1MG5A 5JOQA 3BULA 4OXKA 2POQX 2BLNA 1BOBA 4X6YA 3DDZX 2FRVA 3G3EA 3AUUA 2ASVA 4EI9A 4DCNA 2OP0A 3CLUD 2WJVA 2WFMA 4IWNA 2ZULA 2EZ8A 1WEKA 3OP1A 4H2DA 3AU8A 1D7OA 1R0XA 5DBIA 4IDCA 3JU3A 4R9RA 3KZXA 1QHYA 5AVXA 1TIPA 2L2OA 1T4BA 4HEHA 4ZAYA 4BE4A 1C0PA 4MUAA 1VI5A 2UXCB 5IN5A 4KDEA 4BP8A 1Q7BA 1G1AA 4HJXA 1IYZA 4EJUA 1P2TA 1W48A 5DM7F 5H5JA 4MHSA 1GQRA 2XUOA 5FOWA 3LSTA 2JL1A 5I7SA 1YOVA 4MQEB 1SH7A 2P4SA 1SXPA 5BV0A 4RD4A 3K0AA 4PN7A 2DUNA 3OQBA 4WK6A 3QM1A 2LP4Y 1P0IA 5IK2A 4H1UA 3A06A 4R81A 3HRTA 3STVA 4A0HA 5SY4A 2R7ZJ 1B0AA 1L8XA 1XVLA 4LF9D 1G8PA 3IP4B 4DPKA 1XZEA 1EFLA 1RSZA 1N77A 4LDJA 4BFUA 4EM2A 3LYHA 1RHKA 5D84A 3TQIA 5IZCC 5EIBC 1QLWA 2I1VB 3HB9A 1BS2A 2H94A 2EW2A 4D9BA 4JQZA 1S89A 1RXCA 1IBSA 1WOYA 1GGJA 3A9VA 4D2IA 1KYTA 1PBNA 1E9RA 1ZM4A 4JBIA 4PAMA 2NPOA 4JKYA 2JASA 2XWBF 4EG3A 3L1VA 5T4BA 5D8LB 4YJGB 4Y1RB 4YUVA 1U8CB 4KIJA 5LWHA 4N5LA 1P81A 3I4FA 1MIOB 5F76A 1K4YA 2XKKA 3WZLA 3EYYA 5DCLA 4O2AA 5E3JA 3B13B 1F8GA 5KPDA 1I7DA 1TUGA 1WG8A 5FFNA 2DBZA 3TQCA 2Z43A 4MGIR 3T95A 3KJIA 2V6JA 3SDGA 5DGHA 3AI1A 2AT1A 1G5PA 1GQ2A 3AQIA 1E9VA 5BSGA 3J7TA 3EIEA 2EZ4A 3HB7A 1KO4A 3VYTB 3N0VA 1N78A 2VAMA 4C3OB 5IHXA 1HV8A 4FCVA 3GJ3A 4BLVA 5GAGJ 2HYDA 1ADBA 2VE8A 4IDEA 1NMYA 4M7PA 1LKZA 4FI3C 5IZCA 3ENQA 2H5EA 1TC2A 3L0YA 3IQXA 1T9KA 4XLFA 3A4YA 5JS6A 2IYVA 2REXB 1AKEA 3QQ5A 4XM3A 5CH3A 4Y2RA 5E4FA 2BF7A 821PA 3GUCA 1XPXA 5CH5A 4AIKA 2CBGA 4CG0A 4QYSA 3WK4A 2XPUA 4RVDA 1USGA 2WA1A 1L1EA 3OR2C 1Z74A 1Y4DE 2ZCUA 4PR3A 1H0MA 5AJTA 1P1JA 4G1VA 3ESBA 2W1OA 1I3KA 3C39A 4JYCA 3KTDA 3CUUA 3AFGA 2Q4BA 2AO9A 1F4PA 2IUFA 2LIVA 4GSYA 1G8YA 2DBRA 1BG6A 3E8XA 3IDOA 4CKZA 5DX8A 1QH1A 1ST3A 4QLBA 2XH8A 3IBGA 4DRXB 5IJWA 2LE0A 3RODA 2B63J 1GLGA 1SFKA 3I2JA 1PFUA 2BGKA 5MHTA 1FOEB 1AO0A 2VYCA 3ETGA 3RSSA 5EY5B 5KNCD 3DBVO 3GHHA 1SD4A 4MS4B 1C8KA 1JT0A 5F3WB 5AD1A 4FQ7A 2O8BA 1JFFB 4CL2A 3P2MA 2XPCA 1XGMA 3A28A 3FNRA 3W79A 2I5UA 4J0JA 3UAWA 1FRQA 2DUJA 1SA0B 4NYMR 3QXXA 2G0AA 2WILA 1E9EA 1SCIA 3VVMA 3EVAA 1IPEA 2IJGX 2X5JO 4LG3A 4JL8A 1VMEA 5BW6B 1URPA 4MEBA 3AOEA 3H1GA 1EGQA 4U4AA 2LLKA 1GAXA 3EK2A 3DHNA 3ZXSA 3ZQJA 3G6KA 2BY1A 2ZBDA 3B6MA 3ZHSA 2UZ4A 4B7AA 3H1FA 1FUEA 1QX3A 3JRWA 3R9WA 5F5XA 3IAEA 4OMUA 2CVFA 2Z8YA 4CRWB 3H3JA 3PGA1 4LSGA 3F6RA 1U0LA 4I5GA 2PO7A 4GKJB 1TMKA 4YJHB 2ELHA 3GT7A 1BNCA 1EKXA 2VF8A 4JT2A 4XQ0A 4EJSA 1CY4A 3D0OA 4BN0A 1PWZA 3RSFA 4F6RA 3RTDA 2FPRA 2P6OA 3ET5A 3ERMA 4XGIA 4PYLA 1Q7RA 2KBEA 1EH5A 1S3FA 2TMKA 3MTGA 1KI3A 3JQ9A 4U9HS 3NOOA 3FJOA 2FPPB 2BH9A 1Q1VA 4DM7A 4UVHA 2ZIVB 2BGIA 5HIJA 2ODPA 3QOXA 5JI6A 2JA2A 5DCMB 4GNKA 2Q5HA 1NFQA 4H4DA 4JJ7A 1ENZA 4OMFG 1T5BA 3RH0A 3R61A 4F3NA 1RP1A 1YVPA 2D06A 5EZQA 2AQHA 5CCEA 4YJ2F 1M6VB 5FPKA 6GPBA 5K0GA 2AZ4A 3S99A 3THSA 1E8MA 4G0UA 3H04A 3ZGZA 3I59A 5FD5A 2O3TA 4R8SA 4EVQA 3A01B 1HZZC 3QPCA 2RKHA 1G291 4F9EA 1KYZA 4GI3A 1KJWA 3G5MA 4DIEA 3RTBA 3HA2A 3TP3A 1CY8A 5IPAA 2WDZA 3DKIA 1F9AA 1UM9A 5AOVA 1WXHA 3QQAA 5SZHB 1ZK0A 1GO2A 1Q1ZA 3EF1A 4CSWA 1AC5A 1U3TA 2D1TA 1XDUA 3H1TA 4UPEA 4PSXA 2BL4A 2Q2EB 4D5CA 3BROA 1LSSA 1QRAA 4QIWN 5FFMA 1XN7A 4XDGA 2D4AA 4NU6A 3ASZA 4ABTA 3R40A 2QP3A 1T0JB 5DEQA 2HBZA 3KTAB 4TLEA 3GLRA 4F92B 4OHOA 4HZFA 4M86A 2CG4A 4GBJA 4DCJA 4K0RA 2BTQB 2GUWA 1DAIA 3HSYA 3QYPA 4NENB 2A6HF 3N0WA 5BWLA 3I2HA 3DNMA 1VJ0A 1TO6A 4DUZD 2J7PD 3CUOA 4JVNA 3DMPA 5D5VB 1EYZA 5JAQA 2HVSA 3D6HA 4HQ6A 1Z1DA 1WKBA 2ORYA 1NW4A 4XSZF 3A8TA 5U4QA 1YQEA 2DMQA 3EXFA 3PFWO 3BCHA 1T5LA 4Z5XA 3A1DA 1QRTA 5TRDA 1ZH5A 2Q41A 4ZOQI 2C78A 4TQ9A 4KOAA 1VKOA 5GONF 7ADHA 2ZIFA 3OX1A 4C03A 4RADA 4NG4A 2AFIB 3NARA 1GXPA 4I4TB 2DTEA 2QX6A 3RVDA 1ANKA 2PNFA 4MI6A 3QLVA 5MGNA 3PSHA 4WCFA 3PQDA 2QTLA 3FTQA 2JPCA 3HCFA 2GCOA 2OXEA 2ECKA 2HU7A 2QVLA 1C9JA 3ZQQA 3PQ7A 5LC1A 2GBCA 1QV6A 4ZJUA 2P6NA 3I1IA 1TPYA 4P4TA 2ORIA 5BRNA 1PU2A 1X70A 4YJ3F 4RLFA 3O2SB 2E2IJ 3LGXA 1U8TA 4HDKB 3RJZA 5FKMA 1N0VC 3PE4A 2YC4C 3OS0A 5A2QA 2KWIA 1JR2A 2ETHA 5EG0A 1OT5A 1ZOLA 1JKRC 3A31A 2IODA 1QIEA 1XSXA 1L4UA 2JGIA 1E3EA 3THOA 1ZJZA 1P7VA 3L7CA 3L0CA 2GZAA 5JNTA 5KS2A 5DT2A 2G67A 4G5YA 3PTLA 2EFYA 3OZ7A 1XZBA 2IGBA 1MAUA 1II8B 4A0RA 1FRVA 2OORC 4HDAA 2OB1A 3U4AA 1ZN8A 1RAGA 3OZEA 3MKYB 1E2EA 3JQEA 2XUGA 5AJXA 4ALIA 2NV2B 2ZUEA 1TC1A 3AVWA 4DT1A 4X7MA 3CCFA 4R0NA 5DF1A 2DYKA 1P8AA 1IATA 3VNUA 4Q7QA 2JCSA 2YX4A 4B9AA 4R1QA 1BA2A 1CUEA 3BCRA 5ER9A 1UOEA 1Y80A 4JS0A 2W37A 1YX3A 3QVKA 4FDLA 4DFDA 3ON5A 4IVNA 5IDQA 5KYXA 5K0EA 4EMTA 3NVAA 3V4SA 2HQOA 2C2ZA 3V55A 4BNYA 2BSXA 1LVKA 4ARBA 5MF6A 4MKZA 1O8BA 4PHHA 4I8XA 3ES9A 4GZ6A 2DI3A 2EGGA 3OZVA 3PD7A 1M1EB 4DMUB 1YZUA 2RGVA 4D0GA 3E1GA 2M5WA 1GQOA 1JTEA 1YA8A 2A6TA 4OLFA 1PTJC 2Q1SA 3B6ZA 2A9VA 3P7MA 1CETA 4PZ0A 1CB0A 1XJ5A 1XA0A 2V7VA 1EFRD 5J8CA 3EVBA 1F5SA 1JKXA 1R16A 5EIOA 4RTQA 4IPAA 3IURA 2D5LA 1EFCA 2HH9A 1FW6A 2ZT8A 3K6KA 2LTAA 2JFOA 5CLLA 4XVUA 4EUSA 2MJLA 2WDPA 1E1QD 2LSOA 1CRPA 5HPYB 2G80A 2C29D 3KX2A 2C7RA 4HFMA 4YX9A 5GVSA 2WTEA 1PW5A 1I3AA 3MRXA 4Z49A 2C8KA 2IU3A 4CUJA 3NTRA 5EMLA 2C97A 3GU3A 4ARIA 2G4VA 1JIQA 1R10A 1J0XO 1N1DA 5DYMA 3OHMA 4E0BA 5LMUB 2PH5A 1EVIA 2BHRA 1BXGB 1KNQA 3EZXA 5F9FA 2O8EB 4B82A 5CEEA 3OZGA 1OCCH 4DLLA 1OPXA 1US8B 2LGJA 3V00A 1K2VN 4LY9A 2L4MA 4E7JA 4MQMA 5EEHA 1NN1A 3FZVA 1J6UA 1U5TB 3OX3A 2WTUA 5ILUA 1I33A 2NZXA 2JHGA 3OIDA 4I81A 3QQPA 1I1OA 5D01A 2EZUA 1PZXA 3DDOA 3DTVB 5LCXA 2XUFA 3BE5A 2NVBA 5JATA 1GR1A 4BGIA 2HRBA 3JQBC 1TAUA 4CKWB 2GF9A 8MHTA 3DU6A 2HQSA 2OGSA 1ZKMA 5ECDA 1G8SA 1WLYA 4TKVB 1YACA 3AUXA 3BZCA 5TJ9A 1V4VA 2DFKB 3WAJA 1V37A 5BWNA 4WWCA 3KDAA 4GOKA 1WUTA 2A1IA 2W6QA 3S68A 1UEJA 4EG5A 3ZGXA 1M8PA 1Z25A 4W7HA 3NALA 1Z77A 2AFVA 3NC1C 1PR2A 2GN4A 1NHAA 1AGXA 3H86A 3RF7A 3RFXA 5KQLA 4K9QA 2P3QA 1EK6A 2VTEA 1F6DA 1EUYA 3WTBA 1VB3A 1C0KA 3U3DA 5BN3A 4RE6A 1QBJA 3DR5A 1BQ3A 5G0SA 3MA0A 4HSTA 1ZRCA 3RS9A 1OQAA 2HR3A 5LGNA 2KJCA 1KPGA 1WXEA 4E13A 2NP7A 3LZDA 1GAEO 2DA3A 5AUQA 2VPRA 4ZXFA 4AIJA 2YWDA 3FCSB 5EMMA 2FMLA 5ILGA 1AA6A 2F6CA 1M1UA 3NWPA 2PGDA 3EC1A 2VWPA 4ZZ3A 4UHEA 2XF6A 4EKNB 1WSBA 2X0LA 3QOWA 1N6NA 4PSKA 4XQFA 2VJCA 4IBOA 4RF2A 1ZREA 2JZCA 4U7BA 5E2BA 4IJ6A 4LBWA 1IDN1 4N5IX 1FC0A 3FTEA 4XARA 1YS6A 1VG8A 4EY5A 4A12A 2EA2A 1Z63A 3EUFA 2NU7B 4EPTA 4LN1A 2D7JA 3D3KA 1S6YA 1K63A 4RGUA 4IKPA 1Y4ZA 4LI0A 1VCNA 1TA0A 2EF0A 2C5LA 4KH1A 3T3DA 1KZ1A 3KOYA 5CB8A 4B4CA 1BYIA 1MJGA 3CDIA 3R0QA 4X7BA 4JI2D 5BWMA 1XV5A 4ENVA 1SUWA 4L2IA 1SIOA 4DLAA 4FGKA 4FOPA 3DDHA 2DAPA 2ZUCA 1ZTRA 3KJZA 2R7NA 3AM1A 3BG7A 1O87A 1MW7A 2VJYA 2W4QA 2UU9B 1JUDA 2QGZA 3GPDG 2IU6A 1YS1X 1GRVA 4RO0A 3MILA 5AR1A 1CGPA 2X1HA 3C8MA 4OH1A 1F51E 3NANA 4WV3A 5EEGA 1RESA 2E1MB 3UV7A 1Y8QB 2ZTMA 1TCAA 1QOPB 3ZZ1A 2J3EA 4ZRNA 3EDCA 2VJPA 1GAJA 4R05A 3EOZA 3R77A 4QYIB 5B1HA 4C4RA 3AVQA 1DEXA 2XUKA 4WKOA 5KOHB 3ZN2A 1QM5A 3PNMA 1UBMS 4RPCA 4J2HA 2Y1WA 3A3PA 4KODA 2AN4A 2ZM6B 4YT4A 2L82A 3MYYA 3NH9A 2UZKA 1NI4B 5LL6P 1IJBA 4TUYA 4QUEA 1NOKA 2I3AA 1GEEA 4XLPF 1N32B 3HOVJ 1QU3A 5BNZA 4FYWA 5A4IS 2VBZA 4RY0A 1W5AA 4YRFA 3V2GA 2V7EA 4R71A 3VODA 4JB2A 1EVKA 4RKRA 1P7YA 3RBZA 1DRUA 3K0BA 4KLNA 2XPWA 1JHVA 2CNKA 5CXQA 1YQQA 4RK1A 3FKSD 1MMDA 1L5VA 4K40A 3U7RA 4MUNA 1SCJA 3A0RB 2R6JA 2REBA 3H4IA 4ENKA 1JYFA 3RD5A 1E2UA 4HPWA 5EGSA 2WUGA 1GGVA 3KPWA 5IVPA 3NEAA 3DC2A 2ZR8A 2NTYC 2DQ4A 4M98A 2R5FA 5BV8A 4K81B 3ESRA 2QL9A 5F0HA 2XXBA 3Q40A 2IZ1A 4RZXA 1Y9DA 1Z4OA 5K9ZA 4NOLA 1SIWA 2CZGA 5H02A 4Y0VA 2HTJA 4J0FA 3HM9A 3GLFB 3TO9A 4QRIA 4V3CA 3EXHB 2RCNA 1E2HA 1W76A 1M6EX 3G2OA 3SJ7A 2L2QA 1JIKA 3TM5A 3S3TA 1NLZA 2E2HJ 3A7DA 3D9QX 3CCLI 3PGXA 4YRZA 1YO6A 5HOQA 1HNZB 1DBQA 1OMOA 2FLWA 1VQ5I 1K06A 3WJ2A 1OCOH 1Y82A 3FCCA 4LJ4A 3IQZA 1MEJA 1E3HA 3LSJA 1IBRA 4LNUB 3NHBA 3TIXB 1X1AA 4JC4A 4WJLA 4I5IA 5D7NA 1OI3A 1Y6RA 2VLIA 1IEQA 5HLHA 1CS0A 1KQGA 1DP4A 1JVBA 3N8NA 4MR9A 5FWDA 4B3AA 3RRXA 2B3TA 3ECOA 3OCXA 4M8KA 4FBMA 4BBSJ 3TVTA 3SJMA 3DV2A 3BCAA 1WZEA 4HJRA 2Q6TA 1R0ZA 5I7EA 1W581 4I6ZA 5HNKA 2I5PO 2QX8A 3I9OA 2GNOA 3STUA 2JFVA 4ILKA 1CUIA 3I2YX 5AW6A 1PT8A 3B5IA 5HUJA 4ACBA 3WKDA 1X13A 2XAAA 3NAMA 3M6IA 5ELLA 1USSA 2CWEA 1LX7A 2J6HA 3ODGA 4BV8A 2J0UB 3JRBA 4B76A 3N8GA 1LB1B 1EQUA 2WVGA 3GCWA 1Y8ZA 3HO8A 2JVIA 5E7QA 2GK3A 4TKLA 5IT0A 1VE3A 4MYUA 4J8PA 2GDZA 3GUDA 5CPBA 2Z8ZA 1AQUA 1B72A 2GOMA 1FWZA 2DB3A 1II0A 4O6VA 1KQNA 1UCRA 1YK1A 2C8VA 2IXEA 1C7RA 1YFKA 4KUMA 1QVWA 3FYCA 5K1ZA 1UG0A 3DOHA 3TO7A 3CZMA 1ZNQO 4RFLA 3VR5H 1QYDA 4U02A 3HYCA 4IIBA 4Z6YA 5ALZA 4AUXA 1YRBA 1ECCA 3ZZTA 4BTVA 1L3BA 4JEIA 3LNCA 2AIRA 2K4MA 4EIWA 5CH8A 4TTAA 4RB2C 4PQRA 2H4XA 5B3AA 3STXA 3WTTC 5LMCA 2QP9X 1Z0XA 4NECA 1H8HA 1T36B 3NV7A 4QJIA 2I4LA 4UUAA 3I6MA 3GP3A 3R41A 3NO4A 3EXEA 2F1KA 5BNFA 2HA3A 3Q5GA 5LN1A 1ZVVA 4K9KA 5AM5A 4S2EA 3F23A 4KTVE 1MQSA 2LD5A 2R11A 2BBOA 5FKNA 2ZGVA 3WG9A 2GZWA 1QF6A 3TECE 4FMDF 3P9KA 5M3BA 3BJZA 2R86A 4D8YA 3CH6A 5DM6F 3PEFA 2HDCA 3QFTA 5JCPA 5BSVA 3IRVA 4ESFA 4XX0A 4KGDA 2R7TA 4DRZA 5AW1A 4ZKDA 2B7LA 1ML4A 3O82A 3B5EA 3DCFA 2VSFA 3Q7IA 3LXXA 1PK7A 2V4ZA 2OQGA 3M4XA 5HRUA 2L69A 2GCEA 2FXVA 4GP7A 1RWXA 2ZI3A 5LR6A 3JYNA 2WKWA 3FBNB 2H1WA 3TLCA 2JBAA 1B76A 1VIAA 3HABA 1UQTA 1DAFA 4TKZA 3WK6A 2VN8A 3BEOA 1IWOA 3B6CA 3R0VA 1PVEA 1AKWA 4QTRA 4LZPA 4QUHA 1S8NA 4FLEA 1TYAE 5LXTF 1WI9A 2I99A 2HXSA 2V6MA 2M9HA 4KO3S 1GFZA 3ABSB 2RHOA 1SD7A 1E6MA 4YIIA 3O2JA 3GUZA 3K0FA 1VRVA 2AR9A 2QT0A 4OGKA 3OE1A 2VQHA 5FULA 2NS7A 1VLVA 4FEEA 1E5XA 2Y3IA 1QO7A 1GNSA 3R7WB 5IKOA 4IS3A 3C8DA 1KKMA 3PX2A 1PUEE 2CC2A 3ZQ4A 5DNYB 1XU7A 4NP6A 3WA6A 3FVWA 5HE8A 2Z9CA 4XE5A 1AHNA 2IT1A 1DFHA 1JZTA 3OU2A 3ZHQA 4FYJA 3D8UA 3CP8A 1XRJA 3LMKA 2P40A 2AC4A 1LS1A 4WKGA 3CF4A 1D2GA 2MC3A 2HEIA 4ZYVA 4DY4A 1G3YA 1ULTA 2L3DA 4CG2A 3P94A 1M34E 4TV8B 3PPYA 5EJFA 2OENG 3U6KA 4ZD6A 5UKDA 4MTCA 4HNVA 2M2EA 1W0UA 1ZIDA 2H1OA 2JJ7A 1B72B 3RS2A 4CIVA 1XO1A 3KQMA 1QBGA 4KLRA 3WHPA 4NV3A 4I3HA 2VPTA 2YICA 1A4IA 1ETXA 1MAVA 1CUZA 3FPHA 4FHTA 2A4MA 1KQ8A 3QELA 3K20A 4XUEA 4UUNA 1E6LA 3D5LA 3WE3A 5EWJB 1W0KA 4CT5A 4CMBA 3L0BA 2XGOA 5DCYA 2WIFA 2JZYA 4JLAA 3BKWA 3I71A 4TROA 3FPJA 4JV5B 4DJTA 3TOVA 3LQ1A 3C5EA 1HKSA 3QVGB 3BIFA 4IHJB 4U87A 1M2WA 4K5QA 1JR3A 4RAGA 5AVWA 4H0NA 1DKNA 1U2EA 1RC1A 2VP3A 4EGCB 1JKQC 3E9DA 3NETA 1GHTA 3HDGA 4B0PA 3HI6A 1PVOA 3CZPA 2EWMA 1MF7A 2VDJA 1FZQA 4X62D 4IUDS 4KO8A 5E18F 2LZ0A 1V16A 5H16A 1A96A 1K0UA 1X3ZB 4PEVA 1OD6A 3NBAA 3J80A 2XCLA 4DNCA 4P83A 2HOQA 4PYNA 3TKYA 4M49A 4JI6D 1J5XA 2FP4A 1R3UA 2UKDA 4W5TA 1FLDA 1RJDA 2JLBA 1OAOA 4KQEA 1F3OA 3ZBUA 1GNTA 2NNWB 4AIHA 1B2RA 1O57A 1EP9A 4LECA 3CT6A 3WZ2A 3CTPA 2QGNA 1Z7LA 2IQ5A 3NYQA 3JQ9C 4DMMA 4QOHA 1S3JA 2GN8A 1VBMA 3G9ZA 1ISGA 2R8YA 2ZXJA 2P6RA 4CNBA 2QE7D 2H07A 1S5LC 2OM2A 2BY3A 4Z1MA 1Z45A 3HRSA 4JA0A 4XPZA 3GNSA 3OWXA 5IANA 5FOXA 2P0AA 1RLJA 3KE9A 4ZVKA 1IHYA 1B2LA 3D8SA 3PR1A 3MWYW 1ZIXA 3G8CA 3UMYA 5LBQA 1MRZA 5K3SA 3G9UA 2GZ1A 4ENQA 3CQZJ 4UBIA 5JPIA 1R0SA 1W5FA 3FFWA 1AQLA 2JSCA 4TUYF 4F1KA 1IRZA 1OX6A 3OIWA 4HS4A 2HA6A 3P7NA 1N34B 2CUTA 1TZMA 4G5QA 4BFXA 3L8ZA 4HEA1 1YC2A 1PAUA 5K01A 2JIDA 4RV9A 4XRGA 3DTVD 1PT6A 4WZ6A 4L5BA 4NESA 1Y39A 2BIFA 4CR7A 4UC0A 4DV1D 1DEAA 1FXSA 2HNBA 1QHIA 2A57A 4PICA 3GT4A 3WB2A 3WV4A 3HN2A 4B5KA 4NENA 3ZCPA 4DV3D 4CYMA 1G98A 4BL0B 3DMNA 1CJVC 1RRKA 2XYRA 3HVRA 4LMPA 5CFOA 1L1RA 1FFCA 5FLXK 1UMQA 4EGSA 4JLWA 1JRLA 4H17A 5FHQA 4Y2SA 3EHDA 3MINB 4Y52J 4YRQA 2CHEA 3KTAA 4WF2A 4C7VA 1PLKA 3BXZA 3PXDA 1FUKA 2QD2A 3AIKA 4UAVA 2GBGA 5LRSA 2H8KA 4MVJM 1V3UA 1RRFA 2LW7A 2X41A 4UBNA 2Y4NA 1I1HA 3CT4A 4GRAA 4TMKA 3VNVA 3KHSA 2R5WA 1E5QA 5KNBD 2EC5A 3FBGA 5HS4A 4B6JA 4HDOB 1FFGA 3CPJB 4DR4D 2WLSA 3F1KA 1LI7A 2HRDA 3KXPA 3NHKA 4FHZA 3KP7A 4NCBA 3KPYA 4BMPB 3WJAA 3KZCA 4UNPA 3DTNA 3U3XA 1K4KA 5CNJA 4B1FA 1GUUA 3DE7X 4PZCA 5A5VA 3U7EB 2G4CA 2RN7A 2BJWA 1LFAA 4HPQA 2UXBB 2DHCA 2VHWA 4DKXA 1P18A 2LYCA 2V9VA 2HLDD 3HCCA 4AU7A 5L9AA 1KI1A 1W0KD 3LQYA 4MV0A 4EA6A 3UTCA 4JR0A 5LMNB 5IFKA 2QD1A 3VR2D 3ZU2A 3KIOA 3MCAA 1QDLB 3D8TA 4UBJA 4FOSA 4Z7NB 3WODF 5AJVB 3GLGA 1L4KA 4F1WA 2QY6A 1TF7A 1Y34E 5CVIA 1O7LA 2BTOA 2OO5C 2ID7A 1T9HA 4DV4B 3TB6A 4BMSA 2XMDA 2B0LA 3AOEC 3IUEA 3BF8A 3UWDA 3O8QB 3R7FA 3D59A 3SIWA 3QKSB 4IYJA 4NDLA 2XMGA 3IS3A 2BYVE 2UYQA 4L7VA 3I4CA 4RBOA 2JNWA 5TXGA 1IWPB 3WWZA 5FJ8J 4CDNA 4MW2A 3ZOBA 1RHRA 5BSTA 1SIBE 4BKMA 3WYAA 1U0HC 3U1TA 1H93A 9LDBA 4OFXA 3D5QA 3DEJA 3PQJA 1S2DA 3LX4A 2DW4A 4Q4AB 4RPJA 1NVVQ 2PX6A 4C0LA 2IF0A 1WP9A 2WNSA 1BXRA 4DC9A 1WXWA 2XUHA 4IHJF 2IZZA 3DAGA 2OZLA 3DZHA 3EW7A 3S81A 2XF5A 2ZP1A 1QTIA 2ZT7A 2EX0A 2NU8B 1EX9A 1DNPA 4LTMA 2E21A 2I2BA 3T4EA 2OCLA 3JQFC 2ZRIA 5CAEA 1SC1A 1Y1RA 1K6OA 2WV0A 2HUPA 5ICSA 5AW9A 3KKLA 1G66A 4UEKA 4BWGA 2ZO4A 3BJAA 3HU2A 3ZD9A 1M1ZA 1YF3A 2WF8A 3DLHA 3FI0A 4HXFB 3DVLA 5FRMA 4TTIA 4ZMSA 3D5RC 4EO4A 2B7CA 2GO1A 1W5SA 2Y48A 4BTEA 3QFFA 3V8PA 4ZZ2A 3OZBA 5FOVA 2CHGA 3DZCA 3B6JA 1DG9A 1YKFA 4AWBA 3WHBA 1TD9A 1G2IA 1F60A 2JLCA 4KUEA 5LDDC 5JQGF 4G8CA 2PFSA 4TLMB 1VJRA 1D3YA 2GLUA 4DPLA 1VA5A 2FDCA 1LVUA 3WNZA 1VG1A 1BGVA 4MB6A 3CS3A 1HEIA 3SS8A 4PCUA 4LWPA 4QJ3A 2YXPX 3O3MB 4H1HA 2ECFA 5DBEX 4HO1X 1E2LA 2Q99A 2A1UA 3BRQA 1O2DA 4B3XA 3B1KA 4Q4HA 4JLOA 5EWLB 2FG6C 3N3AC 1ISMA 3RI4A 1XJWA 3G8DA 1GZSA 1O89A 2YY6A 4V1CB 3I92A 3O26A 5A2QK 1TIKA 2LVBA 2W6ID 5KYWB 2P9HA 2OTJI 4DYDA 4RM3A 2NAPA 3KB2A 5A4KA 1WXXA 1ZGAA 2GRAA 1VYTA 3MOSA 2FPMA 4W4TA 3KJFA 1RBMA 2KDOA 3HVJA 4GI7A 2FG5A 2ZB3A 2FMUA 2ZRJA 3NXSA 2O5VA 3LJKA 5A4AA 3L0DA 1ESZA 1XZGA 2Z56A 2B3DA 5J5AA 2OTLI 2YYYA 1IAWA 5D8KB 2ZS9A 4JJKA 3RQ4A 4R68A 1GKIA 2YZKA 4XIYA 5AW4A 4EEZA 5EYPA 1X38A 3B8EA 4ENWA 1SANA 4PLWA 1MPXA 3BG3A 5ED0A 4MWCA 3WB1A 4N7BA 1FLAA 1ZR4A 2H8WA 5K3FA 4FSHA 3DXJF 3QKSA 3GRFA 3RR2A 4HEQA 2JHAA 2PGLA 1DM9A 2CF5A 4S0HB 4IGIA 4DIQA 1S2NA 3DVQX 4DXHA 1NJ8A 3DOFA 5DN9A 2R47A 3K7EA 4TTSA 4L9AA 1ZISA 3IIJA 2QU7A 1G6OA 3GDOA 5DTJA 2JSPA 5LMUD 1C0LA 3RI3A 2HXGA 3HL0A 4AY4A 2ECQA 3KQQA 1LJLA 2AA3A 1FSHA 3IEPA 4WA8A 2MBFA 3FSGA 4GG1A 3TTXA 2ODQA 4LC9A 3QY0A 3F5QA 4IHAA 3KLOA 1UDAA 1FNNA 1EA7A