3KYDB

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
545
structure length
477
Chain Sequence
SRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQDQQVLDVKSYARLFSKSIETLRVHLAEKDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords SUMO-activating enzyme subunit 1
total genus 120
structure length 477
sequence length 545
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
B PF14732 UAE_UbL Ubiquitin/SUMO-activating enzyme ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.520 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ubiquitin activating enzymes (Uba3). Chain: B, domain 2 3kydB02
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 3kydB03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kydB01
3KBOA 4MVJD 1PGOA 2HKIA 4XDZA 3HB5X 2VOJA 4GWKA 2VWPA 1Q0LA 3ZWXA 3PHIA 3I9OA 4ZU3A 1JWBB 4YAJA 2WSBA 2Y1CA 3C1AA 5ES3A 5I7SA 1SOWA 5TS3A 1L7EA 1Q1NA 1BG6A 4P38A 1WXDA 2HMSA 4DVJA 1ADGA 1Z75A 2WJPA 4Z9XA 3VZPA 1X15A 3LC2O 4BGVA 2QQ5A 3QVSA 2CVOA 3RKUA 1Q0HA 1EVIA 3DBHA 3PJEA 4X54A 3H9JA 3ZHBA 3LF1A 3MOIA 1F8GA 1U7HA 1DC5A 4FSHA 1UAYA 2GERA 2B35A 2LDXA 4CM4A 4XYLA 1ZSVA 1P44A 3PJGA 4FFMA 2JCXA 1DXYA 1YB5A 4Z6KA 3E18A 4ALKA 3MWEB 1ZEJA 4PG6A 5THQA 2Y93A 3HWRA 1QSGA 3DZBA 1W6UA 5BR7A 3JQBA 4BNWA 4BHTA 4JK3A 3NV9A 4WASA 5JDIC 1U5CA 4IBOA 3VDRA 4CV0A 3K73O 3TZKA 3PVZA 2IODA 1EVYA 2J8ZA 2JFHA 4DPMA 4EUHA 4F46A 3F9IA 1QV6A 4EW6A 1DFGA 5F5LA 3RUFA 2TMGA 2Q1TA 4Z0PA 4GVXA 2DFDA 3RFXA 2CNBA 1LLDA 1SOVA 3WSWA 4TROA 1NFRA 2X9NA 4ZQHA 4CJXA 4E21A 4UEKA 4FFNA 4F6CA 4WK6A 2F00A 3PIDA 1V3UA 4YJFB 5THKA 1R4MA 2AHRA 2ZYGA 3D0OA 3MTJA 1RYDA 1DC4A 3RFTA 3QHAA 5JAIA 4EUEA 3UXYA 1VSUA 5CDUA 3NDJA 4IQGA 3UUWA 5CEFA 4JROA 4XX0A 1X1TA 1H6BA 3JYNA 4OAQA 1PZHA 3RFVA 1UP7A 3AOGA 4XD2A 1R4NB 3H65A 5CPBA 3OP4A 3RBZA 1MLDA 5JMWA 1YE3A 1HL3A 4PVDA 3ZWBA 1LDNA 1Y5MA 4GBJA 5I7EA 4RVHA 4O5OA 1MFPA 5IAAA 1ADFA 1BSVA 2X5OA 5TT1A 2ZYDA 4BO2A 1L7DA 4ZRMA 2X8LA 1PR9A 1XQ6A 3HFGA 1QV7A 2RH4A 1I8TA 2QW8A 4I8XA 4ZQFA 4FGSA 3BXXA 5A5EA 1TT5B 2FSSA 4IJWA 4E2XA 4Z3KA 1H93A 3DZHA 3ZZNA 3S2FA 1DC3A 1MUUA 3PQDA 1C1DA 4MPDA 1HE5A 4S3MA 3ANLA 3D3WA 3ROQA 1HTBA 3GPDG 1UZLA 2JFGA 3GEDA 4JLWA 5TC4A 4BNUA 3OECA 1BRMA 2H6EA 2J3JA 3TRIA 4YCAA 1KYQA 1VC2A 3BMQB 3E9NA 1VM6A 4P8RA 1PWXA 4ALLA 1GYQA 3ZWWA 2C59A 2DBRA 3BMQA 3F47A 5COAA 2E49A 2YYYA 3PHLA 4XWYA 5K6AA 1U3TA 3C1TA 2D2IA 3HG7A 1JVBA 4JIGA 4CQMA 4WCFA 4WJZA 2WYVA 1H0KA 3D3WB 1MV8A 4XGIA 5JYDA 2ZTLA 4A0SA 1HE2A 4DMMA 4Q3BA 3IP3A 1A72A 4ID9A 4CR6A 3FNFA 1TT5A 4PLTA 5C7OO 2HO5A 1ZJYA 1T2AA 3S2GA 5ER6A 4I5EA 4L8VA 5JY1A 5KJCA 2C7VA 4IDBA 1KC3A 1DRWA 2PH5A 4W9NA 2IZ1A 3FBTA 2HJRA 4NNJA 3RASA 4CV2A 2NV6A 4LCJA 4ND2A 1B7GO 5IJZA 1NWHA 5IZCA 4J7CA 3CKYA 3HQ4O 4LMRA 3WGGA 3BHJA 1EEHA 1UZMA 1P3DA 2IE0A 4MINA 4CM1A 1YL5A 2NQTA 1PJTA 4WPGA 3VPHA 5DOVA 4BMVA 3C7AA 5EQDA 1KOLA 1A27A 4P22A 3T7CA 2R00A 4JXKA 3E9QA 2YFHA 4LW8A 3KO8A 3SEFA 5AQ1A 4YRBA 4HP8A 3ZWCA 5KTKA 2EGGA 5B4VA 2Q99A 4GMFA 3U3XA 1Y1PA 2YV3A 5FI3A 1ZK3A 3X2FA 2CF6A 3OM9A 4EJ0A 4WCFB 2Q2QA 2OOSA 4CQMB 3G0OA 3H7AA 3AWDA 4A7PA 3UW3A 4MIOA 1U3WA 3BMOB 1N7HA 4TRJA 1ZZEA 3ANMA 1HF3A 5AVOA 2CD9A 3RKRA 3K5PA 1UZNA 5JW6A 2C5EA 2AE2A 1DFIA 2JCVA 4U8GA 3RSHA 3WNVA 2HCTA 3BMCB 1SZJG 1BTOA 2EW8A 4AJPA 1D7OA 3K9QO 4FOOA 4BNLA 1IHXA 5A06A 3K6JA 3OIDA 4WNIA 5TT0A 4BB5A 4AJOA 1IPFA 4BIIA 2VUUA 2DFVA 4R68A 1MP0A 1YS4A 1CQIA 1Y81A 3ZNNA 4TVBA 4GLLA 1Z6ZA 4QO8A 1I33A 1MFZA 2HMVA 2B69A 1T4DA 2FR1A 3NTRA 5EQFA 4EYEA 2Y05A 3WG9A 1DRUA 3H9EO 4HNHA 4C7KA 5HS4A 2H63A 2PD3A 1XA0A 1I2CA 4MO2A 1E7YA 2Y1DA 4DQVA 1MGOA 4CM4B 2EERA 1NR7A 5F21A 3RU7A 1EFLA 3GUCA 4IMRA 3GZ4A 1ZBQA 4HADA 1R4NA 4M8SA 1CJCA 2X1HA 1VJTA 2O3UA 3ZU5A 1Z7EA 4FB5A 3X2EA 2NADA 3DAGA 3WR5A 3JQ6A 2B5VA 1JA9A 3NGXA 5KKAA 4ALJA 4R9SA 5DCWA 1GQYA 1YOVA 1B2LA 3BHMA 1YO6A 3RC7A 1R4MB 1LDGA 3EVNA 3M1LA 2Z5LA 2AG8A 3OJFA 1C0KA 1UH5A 3R3JA 4IDGA 4U0KA 3DBLB 3VC7A 1P1JA 1UDBA 5B1YA 4CMEA 3GMSA 1N9GA 3UICA 1KEUA 5COBA 1ULUA 2HQ1A 1AXEA 1X1EA 3AU8A 1OC4A 3AUAA 5AXBA 1WDLA 3FD8A 5U9CA 3TOZA 2EIHA 3U5TA 1UXGA 5CDTA 3G3EA 3LT1A 5ER9A 4B79A 5HA5A 4E5PA 4I9NA 4YTEA 5AXDA 3G49A 3QWBA 4UVEA 2JL1A 1B8PA 3GHHA 3KEQA 4CMGA 4P4NA 2V65A 1WNTA 2EJWA 3WIEA 1O95A 1BDMA 1OFGA 1WDKA 2ILTA 3OBBA 1E3JA 1MG5A 1K2WA 2WDZA 2BMAA 2XOXA 3DOCA 1HDOA 4QTZA 3ZW8A 3DWFA 1O94A 5FF9A 4YQZA 1A7KA 5DOZA 1HDGO 2ZB7A 2FPGA 1GV1A 1ZUD1 2J5RA 5L45A 3FPCA 4A10A 3FTPA 5F5NA 3H4VA 4CMKA 4IDFA 4IS3A 5A3VA 1LSJA 3C3XA 4W7IA 3DBHB 1YVEI 4CMJA 1QR6A 3DBRB 1XU9A 4YJHA 3QV1A 5L7TA 2YZ7A 5A4DA 1DJQA 1IL0A 2DTDA 3HUDA 2VYNA 4IDCA 1P74A 2PLAA 4AJJA 4J0EA 1LC0A 5IF3A 4KQXA 1PR3A 4DLLA 3GNQA 2GN9A 3A1NA 1YGYA 3QVTA 5DP1A 2HMUA 1ISHA 4E33A 2RHCA 1HDRA 1DIAA 3JQAB 3ZNOA 4CUKA 3RBXA 1U7TA 3VOSA 2JFFA 1E6EA 3OQBA 3UH1A 1FK8A 1M75A 5JE8A 2AQKA 2X6TA 3VDQA 2NSDA 3D3EA 2Q1SA 2AQIA 4HY3A 4MIYA 1D1TA 1LRKA 3VHRA 4O63O 4R1NA 2EKQA 1I5RA 4XRGA 3G1TA 4YWJA 1DLJA 3DC2A 3GN2A 5T6BA 2YDXA 1N1EA 3LZ6A 4AG3A 1NVMB 4PZEA 4G65A 3WDSA 4H7PA 1NHWA 4IIUA 2P9CA 1VL6A 2IXAA 4DYVA 4R01A 2J3HA 1TB4A 3VTFA 1HT0A 4JGBA 5JCJA 3ZU4A 3RUHA 4KWIA 1DRVA 1Y7TA 3WXBA 3HJAA 3WGHA 3VAZA 3V8BA 5COQA 1LU9A 1M66A 3UN1A 4BQRA 3VKVA 2B37A 5L4LA 2NLOA 2H1SA 4BNYA 2SCUA 4OKIA 3D1LA 4BUCA 4PLYA 3HADA 3ZV5A 3U62A 3Q11A 3I83A 2AQ8A 1XQ1A 3WMXA 1HDYA 3UCXA 3N7UA 1LBEA 4G5HA 2UUOA 1DIBA 3DAFA 3KSZO 4M89A 4OXNA 1BDBA 3GMDA 3GPIA 5FI5A 4ROSA 3I52A 1AN9A 2WD7B 4A27A 5BNIA 2C20A 2OGUA 4JJGA 4B4VA 4NI5A 4J4BA 4NJMA 1I3NA 3UOGA 4CMBA 3LC7O 4EEXA 1UDCA 1GZ3A 3ZV3A 3K2BA 2HRBA 4GKVA 5BQFA 3C85A 2VHYA 4IINA 1HE3A 1YRLA 3FF4A 3DZGA 5DDIP 1KVRA 1V35A 2XXBA 2CFCA 2OP0A 1PJCA 3L6EA 2Y1FA 4RF4A 1EDOA 2HK8A 3P19A 3E9MA 2GSDA 3RIHA 5BNFA 1PL7A 4BNFA 1H9BA 4RPGA 3JQDA 3Q9NA 4WCDA 4XZ3A 5EESA 2VHXA 2NU7A 5T57A 1NNUA 3AFNA 3KYDA 4YA6A 3M2TA 1TI7A 4LN1A 2WD8A 3FI9A 2NTNA 3C7CB 1R66A 3V2GA 1I2ZA 3OIFA 4QT0A 1ZXBA 4L76A 4BKOA 4FFRA 2NU8A 4JN6B 3WGYA 2GCGA 2P9GA 3G1UA 3QVWA 2NVWA 1WDMA 4OM8A 1LDBA 1E3WA 1X7DA 3PZBA 4IDEA 2Y0DA 4CMIB 3O8QB 4FQ8A 1FXSA 4K6FA 1R16A 4URFA 4FD3A 3JTMA 3EZLA 1QYVA 4J4HA 4ZD6A 4YT8A 3PYLA 3TFQA 2DUWA 1XHLA 4TSKA 2HUNA 3BTVA 1UXHA 3AUUA 2JD0A 3NYWA 3W8EA 1ENOA 3GGGA 4OQYA 1JDJA 2FY8A 1IZ0A 4NFYA 4B4OA 3DAPA 1YBVA 2P5UA 1D4FA 3S2IA 2RAFA 3WNQA 3M2PA 1DB3A 1KERA 2UAGA 4HKTA 1C0LA 1PSDA 2CDAA 4GQAA 3KUXA 4GL4A 1DHTA 1Q7GA 2PNFA 3LQFA 4TWRA 2O3JA 2Y99A 3F6YA 1DO8A 3OEWA 1EQUA 2C7GA 4B4UA 4CODB 3JSAA 3RQSA 4IJKA 4PG7A 5A03A 3RC9A 1PZEA 2IRWA 5F1OA 2O4CA 3WMWA 1PJSA 4Q3DA 2BFMA 4ZGWA 2YHIB 3PZRA 3ICCA 1C14A 3BHIA 4ZJUA 1PEDA 4FJ2A 3MJVA 2A94A 4IDDA 2CZCA 4BNHA 1JW9B 4J2OA 4K28A 1P9LA 5FQ2B 4XQGA 1VL0A 1AHHA 1A5ZA 2WMDA 3GZNB 3S1LA 2Q4EA 1ZK4A 2B36A 1J6UA 4KTVE 1YBAA 1JLLA 4BNMA 2AXQA 3I6IA 3ZV4A 4N18A 3GVXA 4FJ1A 4BO1A 4FJ0A 3K30A 1ISGA 4YAGA 1GZ4A 3TWOA 3ZHZA 3OMLA 4JJIA 5IZ4A 5TLSA 4CUZA 3STHA 1VKOA 2PKQP 1I30A 3UF0A 1KY4A 1XLTA 3DMTA 1YBMA 2I99A 3CMMA 3L07A 4BMNA 3TZCA 2UUPA 3ENNA 4CR7A 4TRNA 3AUTA 4J1TA 3GZNA 4KUEA 4RVSA 1PJQA 2YDYA 3SBOA 4GX5A 2VZ0A 1DOHA 4CQMD 4GGPA 4RLHA 2O2YA 1P1RA 3HDYA 9LDBA 1GDHA 1O6ZA 4BO6A 3H2SA 2X5KO 3DQPA 1A9YA 1NQ5A 3D4PA 5AXCA 4IUYA 3ETDA 4RV9A 3RC2A 3TL2A 3UKOA 2OL4A 3E82A 3LU1A 1S6YA 2VT3A 3ASVA 2V6MA 4J1QA 5T5QA 2CDBA 3RD5A 2AEFA 3GY0A 5IXYA 1E3SA 1B16A 2DUUA 4MVJM 5EMHA 5TNXA 3L77A 4PG8A 2GNAA 3IKTA 1DC6A 4Y6PA 2OBNA 5KVQA 2BHLA 5JAMA 1A7AA 4UUPA 3O03A 2D8AA 2YY7A 5DNAA 2QZZA 5G4KB 3I9NA 1ZO8A 4DBVO 4NU6A 1ZKMA 3K8ZA 4G2NA 5EIOA 3UVEA 3O8QA 5CEJA 2VHVA 2ZTVA 2DKNA 4OL9A 2VRCD 3AOEC 4CLOA 3PLRA 1Q7CA 1E3WB 4GPD1 4IXTA 1LLCA 1E1MA 4D41A 4O59O 2RIRA 3RROA 1JAYA 4FFLA 1ZMOA 3U0BA 1PL6A 5MGBA 3MCVA 3GQVA 3MJCA 7ADHA 4RQTA 1N1GA 2GZ1A 1QORA 3GDFA 3ZCXA 1O89A 3PWKA 4MKRA 1RM0A 4M49A 1YB4A 1Z73A 1PJ2A 4FFPA 3JYLA 4QFCA 1E5QA 3RU9A 3VZSA 5JNLA 5TJHA 4MVJG 1BW9B 1F14A 4KUGA 4OH1A 4BO7A 3L0DA 2WE7A 5A05A 3RC1A 1NXQA 1FMCA 5F3RA 1NYTA 4I9UA 1LTHR 2PX9A 2NU6A 3RCBA 2E82A 2BGKA 3D4NA 1WVGA 3BMNA 2Z1MA 2DU8A 2J5QA 3GEGA 3IS3A 3JQFA 1QLJA 4MKZA 3T4XA 5IFLA 4D3SA 1SPXA 1RWBA 1KC1A 3A28A 3JQBC 3NTQA 5A9SA 4Y98A 1JTVA 5DF1A 2EW2A 1IE3A 1IUKA 1IZ9A 2C29D 3E5RA 2Q4BA 2D59A 5A04A 5B4TA 2DBQA 1NPTO 3DFZA 3O38A 4GX2A 4U6QA 4TMFA 3FNHA 4EJMA 4ZN6A 3CTMA 2JD1A 3B20A 3QRWA 3AOEA 1V3VA 4XGNA 3LDHA 1GAEO 4RQUA 2Y1GA 4XQCA 3ONDA 4HV4A 2P91A 1JN0A 2O3RA 4DQXA 2BI7A 3ANNA 2GUGA 3ZW9A 4E5YA 2EV9A 5KNLA 5JFOA 5MDHA 3IC5A 3KV3O 4ZA2A 1NX6A 2AE1A 4YRDA 4CV1A 5HM8A 4R3NA 2ZIZA 3CPSA 2DPHA 2JAHA 3CIFA 4IPTA 4EJ6A 1GEGA 2JHFA 4BNZA 4MDHA 3ONFA 5TGDA 2YW9A 1EE2A 3LT0A 3NT2A 3MWDB 4LRSB 4CMAA 3HDHA 1V0JA 1XCBA 3DHEA 4XDYA 1HEUA 2ZB3A 3DHNA 1E92A 5JSFA 3WX0A 3GT0A 4ALIA 2JCYA 3H3FA 3JQAD 5I7VA 4FIZA 1P0FA 3W1VA 3QE3A 2AG5A 1B8UA 2DLDA 3U49A 3IIEA 5I8ZA 5JC1A 2PV7A 3EYWA 1I2BA 1UXKA 2EJVA 4ESOA 5JXWA 4E4YA 3RAJA 3KSDO 2EG9A 1N5DA 3OQ6A 4BNVA 3PWSA 4DUPA 3ADPA 5JDIA 2AA3A 4U0JA 4RZIA 1QYWA 1SC6A 3BAZA 3JQ7A 3AM3A 4J3FA 3AI3A 3FWNA 4EITA 1ZSNA 2HMWA 2WEKA 3LC1O 2GZ3A 2YJZA 2RH8A 3WBBA 3FNEA 2W2KA 3WYBA 1PS9A 4W6ZA 4E0BA 1NQOA 4RORA 5CDYA 4Q3NA 1IB6A 4L75A 2VYVD 3DBRA 4YJHB 5EPOA 3WTCA 1LJ8A 4R51A 4CPDA 4EZBA 3NTOA 1ISMA 3H5NA 5L95A 3GGPA 4L4XA 4E13A 3IMFA 1MXFA 2PTGA 1NASA 5G0SA 4II2A 2NWQA 2V6FA 3PQFA 3WFJA 3E03A 4XCVA 3M6IA 4IJUA 3QQPA 4ZHSA 2DTEA 1DAOA 1ZK2A 3CINA 1H9AA 3PLNA 4XYBA 3OETA 5KVSA 1V3TA 1HZJA 3DTTA 1U5AA 3AK4A 4YT5A 5A9SB 3INGA 3EW7A 1PGJA 3ZWNA 5CDSA 4EDFA 5G2OA 4IY1A 1F8FA 4AJIA 1FDTA 3ZH2A 3WGOA 4HFJA 1OMOA 1NTOA 1LA2A 1TEHA 1H94A 5L40A 3TL3A 1I01A 1PU2A 2IDZA 1UR5A 2AMFA 4Y6SA 4R4JA 3NT4A 5KWEA 4MVJE 1GFSA 1PGNA 4RGBA 1EUZA 4Y8VA 4R69A 4DIBA 3K96A 1HDZA 2CVZA 4CM9D 3ULKA 3B1JA 3DO5A 3I9LA 1E1NA 3S8MA 5FYDA 2YHUA 1DPGA 4AJ2A 5C7IO 4PFJA 3W4JA 1TLTA 1CWUA 1T4BA 4J1SA 4GVLA 4YAKA 3MJSA 4YT4A 1XU7A 3SX2A 5KKCA 4UVGA 1NVTA 3S2EA 3O26A 2O3QA 1NPDA 4HX5A 1R6DA 1GZ6A 1WZEA 4II3A 3RUDA 1XG5A 1AUPA 2HU2A 1OOEA 5JCXA 4M54A 5ADHA 2X7HA 3JQ9C 3KXDA 1W0CA 2GPTA 3GRKA 1ZJZA 4L4SA 1K3TA 1OAAA 4M87A 4OMUA 4TZKA 1CIVA 1X7HA 3S55A 3DEYX 5L9AA 3Q0EA 2B4QA 2BI8A 2X86A 1F12A 4NQZA 1T2FA 1YQGA 2PA3A 3QIVA 2GN8A 4FPXA 1B15A 4K1LA 4R5HA 4J7XA 3ZWPA 2HAEA 3PIIA 1NVGA 4HFRA 4PLPA 1M67A 1Z82A 4XIJA 5H82A 3HN2A 4GI2A 5C37A 4LK3A 4B8ZA 4MOWA 1PX0A 1HE4A 2CVQA 3DMTC 4DGSA 5LDHA 2VTEA 4LGVA 5L4NA 4BNTA 1KS9A 3BMCA 2D4AA 4WECA 2YUTA 2BLLA 4GSLA 4BGIA 4I5DA 4CM8B 4OYRA 4E2ZA 5J23A 1GQQA 4CMCA 5LC1A 1SBYA 1WMBA 4MP3A 2UDPA 1QMGA 2O3SA 4TKLA 2DPGA 1R37A 5DCYA 4AJHA 1C1XB 3V5NA 2O2SA 2PZMA 4WKGA 4GX0A 5KIAA 1XELA 4NMHA 2VTDA 4XB1A 5IXSA 1KEVA 3EY4A 4WEQA 2NVUB 2ZJ1A 3E8XA 4I5GA 2JJYA 2A92A 3RJ9A 1EVZA 4W99A 2O7QA 1QG6A 1T26A 4PZDA 5I7FA 1K6JA 1WAMA 2Q1WA 3H9GA 1KETA 1E7WA 4IZHA 1F06A 3PP8A 1ORRA 4UEJA 1BWSA 4XB2A 2CSUA 5BSEA 1LDMA 1LDYA 1I32A 4JX8A 3TN7A 1GTMA 2C0CA 3NJ8A 2CF5A 4I08A 5DBGA 4RL6A 4IZIA 4U6SA 1Y6JA 4ND4A 2GR9A 4ZRNA 4U7WA 4Z0HO 3HN7A 4FC6A 1FDSA 4LCEA 4J4TA 2JAPA 1UXJA 1X0VA 3HHPA 2Z95A 1VJ1A 3JYPA 3U4IA 4UAGA 3ONEA 1YKFA 4R54A 4UUOA 2P4QA 2BF7A 3F3SA 1K89A 1CEQA 4K6CA 4C4OA 2EKLA 3ENKA 4MP6A 5ICMA 2YHIA 2J6IA 5L51A 4BKUA 1BXGB 1DSSG 4I5FA 4BO0A 1U8XX 4DREA 2E4AA 5C7LO 2PGDA 4BVAA 3P2OA 3WYEA 1GYPA 3L6DA 3ZNQA 2D5AA 3DFUA 2NTJA 4A5OA 3GFBA 2V6GA 2B0JA 1X0XA 4CMEC 1LQTA 4W5VB 4Z3DA 4D46A 1PIWA 4J91A 4BO4A 4HFNA 1JKJA 5DCUA 2C82A 2ZK7A 1CRWG 3PGJA 4E3ZA 2GN6A 2I76A 2DAPA 4PLGA 1X14A 2B83A 5T8KC 4UVDA 1QP8A 3W4KA 2DBVO 4DTIA 3BTSA 3F4LA 3JYOA 5IDWA 5FFFA 1H6AA 5JMPA 1I3LA 3TFOA 3GK3A 1T2CA 1HRDA 5K9ZA 5BSGA 2NTVA 4IGEA 1VJ0A 3IUSA 5JLAA 3MJEA 2OXIA 1AGNA 4R1TA 1PZGA 1TXGA 3IAHA 2DBZA 2FR8A 4D45A 2NQ8A 1RJWA 3LLVA 1NWCA 2VWQA 3ETEA 5FWNA 3NX4A 1PL8A 1VRWA 1BXKA 2GYYA 1IY8A 4YVFA 1OZAA 2C54A 1FF9A 3H5AA 4J2HA 2IXBA 3HE3A 3I9JA 2EHDA 2Q1UA 4DC0A 4NBVA 4CLDA 3OICA 1I3KA 4W4TA 5A5FA 4E32A 3GH3A 4GX1A 3I5MA 2VOEA 3Q3CA 3PTZA 4KOAA 4DLBA 4CM5A 1CF2O 1SMKA 4H16A 4OOEA 4BO3A 4PLHA 2VYND 5GMOA 2PGJA 4KDEA 1TVEA 3CSDA 1U2GA 3DOOA 4KUHA 4AL4A 3N58A 5H83A 4YJFA 2E6UX 4BGUA 1EUCA 3JQ8B 4XA8A 1RKXA 1GL3A 3FR7A 4OGWA 3DZKA 2BD0A 4NPCA 3E1KA 5ILGA 4CR8A 2ZJ0A 1I0ZA 2R6JA 1R0LA 1YJQA 3FR8A 4QO7A 2H9IA 3TJRA 3ZV6A 4YT2A 2DTXA 3ZWYA 2D1YA 3I4CA 1GQ2A 1XWFA 3OJEA 3ICPA 2VWHA 4XYEA 1ISJA 2W8ZA 1VE9A 4NH4A 5EERA 3U4HA 1Z74A 5DZSA 1TA4A 5AXAA 3GG9A 4W7HA 2EF1A 5BT9A 5KOIA 1HYHA 1CQJA 3GVCA 1ENPA 1GYRA 1GPDG 3JD1A 4O1MA 1E7SA 2VNAA 1LX6A 2X0IA 2WE8A 4J49A 2V6BA 3ZDFA 4OKNA 5JO9A 1PGQA 4B3HA 4CMHA 5A02A 1KVUA 3CMCO 1IYZA 2VHZA 4N54A 2BH9A 4FBGA 5JDCA 1MB4A 4E5MA 4KDFA 4ND1A 2EWMA 5KJ6A 5LDGA 3RUAA 4ILKA 1HLDA 4HWKA 4BO8A 4B3JA 4QQRA 1D3AA 3AY3A 3PEFA 4GH5A 4LRTB 3NEPX 1HYEA 1H2BA 2ET6A 2X0NA 2XAAA 4D3DA 4UVIA 1HWYA 3JCZA 2QRLA 4TVOA 2VHWA 4XJTA 4FOSA 1P1FA 1XIVA 2Q2WA 7MDHA 2VQ3A 5L3ZA 4BQPA 1IULA 4DYDA 2AQHA 3AW9A 4RJTA 2ZQYA 2GO1A 4DPLA 4LSMA 3FTNA 1E3EA 1PJ3A 3JQAA 2J3KA 4KMSA 4WNCA 1IOLA 3LVFO 3WLFA 2B4TO 4AJLA 1L1FA 2GDZA 2GRAA 4DBZA 4WEOA 3K2EA 1EUDA 1NAIA 4D0SA 1KY5A 2NACA 2A9FA 1A4IA 4Q3AA 3TPCA 4RPKA 4N5LA 3GF4A 4E6PA 1JVSA 2GF2A 1VPDA 3WJAA 3UAGA 4RPLA 3UCFA 1ZXLA 3MZ0A 4ONEA 1ID1A 3DZIA 3W8FA 3T4EA 3GOHA 3SJ7A 1GR0A 1LLQA 1J0XO 2W2LD 1YL7A 3EHEA 4PLWA 4FS3A 1EFKA 3A9WA 4XRRA 1UXIA 4YRAA 2HSDA 2ZCVA 4IS2A 1ZCJA 4LVUA 2W98A 4Z9YA 2LQ7A 1XR3A 1S7CA 2YV1A 2FMUA 5DN9A 1T1RA 4RF3A 2BGMA 5TSDA 3WBFA 5G0UA 2VWGA 2Y0EA 5IN5A 4FDAA 2QX7A 1YL6A 4D79A 4FCCA 2FOIA 1O9BA 1BVUA 1DIRA 1GCOA 1E3IA 1OBFO 3AI2A 3VVBA 5HRUA 1BMDA 1RYEA 1EDZA 3R6DA 3WWYA 1N7GA 1GUYA 4NBRA 3PYMA 2PH3A 5IDQA 2Y1EA 3ZU2A 5TX7A 4BGEA 4Q3CA 3BZUA 3FRJA 2I67A 3VH4A 3OFSA 3U4DA 2DVMA 4EI2A 2PFGA 1NQTA 3SLGA 1NBOA 1Y5RA 1Y9AA 2VNSA 4RVUA 4UUNA 1EQ2A 1WPQA 2VUSA 4YACA 4PG4A 1HSOA 3FN1A 1ML3A 3CXRA 5TRTA 3NUGA 3CEAA 4O6VA 4W82A 4KTTE 1PTJA 2WYUA 4WGGA 3DMYA 2P5YA 3TF5A 2X5JO 4KQWA 1N9GB 3GNSA 1DBVO 2XPCA 3AFMA 3IL2A 3GAFA 4JBIA 4LMPA 3D5QA 3JQCA 1EK5A 2IEBA 5T64A 4AJ4A 3DBLA 5EN4A 4XYMA 2IZZA 1KEWA 3EVTA 3H5RA 4B7XA 4GGOA 4XR4A 1DIHA 4R9RA 3OSUA 3I4FA 2OORA 3JQGB 1YOVB 3HDJA 2ZTMA 3HZZA 3IJRA 3ADOA 4S1VA 4Z0TA 1IPEA 2JD2A 4JCOA 3WQSB 3PFFA 1R0SA 4OOFA 4Y9DA 4UUMA 3SLKA 3QJ5A 5ENVA 3CUKA 1DFHA 3U09A 1N2SA 4BV8A 3JV7A 2QRJA 4NBUA 1GCUA 3LYLA 3DB2A 2UVDA 1J5PA 1WWKA 1Z7BA 4B3IA 4JNKA 3KSUA 4ZQGA 1NPYA 3ZI0A 2QRKA 3OIGA 4PGFA 4Z9FA 4DLAA 1LRLA 2ZATA 2X58A 4RCVA 4B7CA 1UDAA 3F5QA 1DEHA 2BELA 1SAYA 4B8WA 4I9HA 4PLFA 3C1OA 4GAEA 5CP8A 5EJ2A 5ITVA 5TJ9A 3NT5A 1LUAA 3DR3A 5C5IA 1HZZA 1W8DA 1PQUA 1B0AA 3RBVA 4FGWA 1P1IA 5KVVA 3Q9UA 3WTBA 5GZ1A 4RDIA 3L4BC 4YJDA 3OHSX 3GUYA 2Q49A 4TQGA 1N92A 2EEZA 3GFGA 4ALMA 2OZPA 4BO9A 4AJKA 2DM6A 5G0WA 1UUFA 1DIGA 1MXHA 2XXJA 3BMOA 3NJ4A 4WOKA 1ADBA 1U28A 1UAGA 3JQ8A 1U4SA 3R1IA 1EBUA 1ZW1A 3PPIA 2Y67A 2AEJA 2OHXA 4AJEA 1LNQA 5JY6A 2ZKLA 3LF2A 1NFQA 1X13A 2EKPA 3DONA 4TRRA 5B12A 4H3VA 1N8KA 3EZYA 4FC7A 3JQFC 3EK2A 2FR0A 1F17A 4KWHA 1OC2A 3AUSA 1E5LA 4ZVVA 2G17A 3L6OO 2D0IA 1Y8RA 3A14A 4LSWA 3JD4A 4GKBA 2G0TA 1LRJA 3RUEA 3VZRA 3GDGA 1QLHA 4AICA 1ENYA 2PZLA 3VH2A 4L73A 1ZEMA 3GA0A 2I6TA 1R15A 1GV0A 2GD1O 1YH3A 5L4SA 3PQEA 2A4KA 5DULA 5H81A 3M1AA 4YR9A 4YYZA 3VZQA 3RJ5A 3F4BA 4L4RA 2X9GA 4MVJF 4BKPA 2NVUA 1J4AA 1V9LA 5B4UA 1PJBA 3WGTA 1LI4A 2G82A 4RVDA 1PZFA 3QSGA 1D1SA 1XSEA 3WOHA 3GEMA 6LDHA 5AYVA 3CZMA 2PK3A 1ULSA 3DHYA 5C3MA 2DC1A 5A9TA 4W9NC 2Q2VA 4PZCA 1BXGA 1U3UA 1T1SA 1P1KA 5CAEA 2B4RO 1H6CA 2W2LA 2HMTA 1C1DB 3NGLA 4NK4A 4PLZA 3V2HA 3JD2A 3WB9A 4DL9A 3GNTA 4D7AA 2LDBA 3OA2A 4CLHA 1A71A 4BKRA 4ZICA 2PD6A 4Y67A 4AJ1A 1FDUA 1E3LA 1MC4A 1LQUA 4KZPA 4R41A 3W6ZA 3UGKA 4NHEA 4CM9A 4A73A 1ONOA 3F1LA 4N7RA 4R5MA 4CQLB 2B5WA 3KYCA 4JBHA 1KBZA 5JO0A 2EXXA 5L7YA 2O4UX 3V1YA 3H3JA 5CPFA 3KOUA 3GVIA 3BA1A 3DTYA 4JP2A 3PJDA 2D5CA 5JCJD 4OXKA 6ADHA 3W6UA 3UFXA 3H2ZA 3WJ7A 4A26A 4GLOA 3I1JA 3EUWA 4XQEA 2PKQO 2D3TA 2G5CA 3PK0A 1P31A 5DT9A 1EMDA 1EVJA 3ZNPA 3ZGYA 1RM4A 1Y9EA 3AY7A 5EL0A 5CHEA 4ND5A 4QXMA 5KJ1A 1KIFA 4H15A 3VPXA 3MTGA 4UULA 1C1XA 1A9ZA 2JKVA 3O9ZA 4RLSA 2CMDA 4RO0A 4M86A 3VPSA 5KCZA 4DA9A 4B7UA 3ZWVA 1IHYA 1UP4A 3I3OA 3E48A 4HBGA 4BNIA 2P4HX 4RDHA 4CM8A 3NDRA 5K0ZA 3G17A 2FHSA 1PS8A 1TT7A 1HLPA 4GMGA 4WOJA 1M76A 3FN4A 4QX6A 3P5SA 2NM0A 5DBIA 5JAQA 2OP1A 4Y6RA 2PR2A 5GZ6A 4BV9A 1Q7BA 4IIVA 1JKIA 2BFOA 1HYGA 1ARZA 2GLXA 2FRDA 2X0JA 2OBYA 3ZN2A 3KLMX 1NP3A 3SVTA 5BNTA 1X7GA 4YXFA 3OJOA 2A35A 3FSRA 5KJEA 3W4IA 3FNGA 1VSVA 4QSMA 3H6KA 1MX3A 4WLNA 5BSHA 1KVTA 1YDEA 3ST7A 1DLIA 4EEZA 3UHAA 2PZJA 3JYQA 4OSOA 4IGFA 5IDYA 3GC6A 1V8BA 3QW2A 1WLYA 4D0RA 1R12A 2ZTUA 3ON5A 5HWSA 5CG2A 4UEOA 2WYWA 3F46A 3PYXA 1YQXA 2F1KA 2W2KB 4OXYA 3DDNA 3WYCA 3GG2A 2HLPA 3DBVO 2PWZA 1MA0A 2GZ2A 3D5TA 2RBEA 3QWIA 1LSUA 1ONNA 4TZTA 3JQ7B 5ENDA 4Q3EA 2WTBA 5U1PA 1AXGA 3I23A 2VZ9A 3U9LA 1YJ8A 4CUJA 1K5HA 2X0RA 3U4CA 1ZK0A 4GWGA 3V1UA 1YONA 4AVYA 5TIIA 2FN7A 3PDJA 4MVJH 4WLOA 2PZKA 4JBGA 3OQ1A 1LC3A 3Q2IA 1E1KA 4NFHA 1Y8QA 3WQRA 1JQBA 1GPJA 3BYZA 3VTZA 4BB6A 3B1KA 4OSPA 4JP3A 4G81A 3PDUA 2P9EA 2IZ0A 4L9RA 4J90A 3QLJA 1GY8A 3PXXA 1T2EA 3GLQA 4P4LA 5F1PA 2OFPA 3I6QA 3INTA 4PLCA 1SO8A 4KP7A 2VZ8A 1ZNQO 2GASA 3DZJA 4BNGA 5T8KA 2AW5A 3DL2A 4FR5A 1GD1O 2I3GA 1E77A 2EP7A 1F0YA 4L0QA 2JHGA 3PWZA 4U5QA 3HDQA 2VUTA 4IQ8A 5U4QA 3VKUA 3GR6A 1CYDA 3N74A 4YJGB 4YB8A 1O5IA 1XYGA 4NU5A 4XKJA 1ISIA 3OA0A 1ZSYA 2VN8A 1QYDA 3OEYA 3PI7A 4WUVA 3HB4X 1EZ4A 2FP4A 4ZQEA 2QZ9A 4ITUA 4D3FA 4EUFA 3SJUA 5I9LA 4BNJA 5JPIA 3IUPA 1YWGO 4PVCA 1K0UA 1YXMA 1XEAA 1YB1A 2Y0CA 1SNYA 3P2YA 8ADHA 1ENZA 1KVQA 1DDOA 1VLLA 3IOYA 1HSZA 5G0TA 1H5QA 2QYTA 4MVJI 5F1KA 3SXPA 4DIOA 4F6LA 4HXYA 1DHRA 2Q45A 3BMNB 4MIEA 3FCOA 4MKXA 1GU7A 4J9UE 5LCXA 4CM7A 1JU9A 1H6DA 1NR1A 3L9XA 5DBFA 4RZHA 2I65A 3DOJA 4ZQBA 4CLRA 1C0IA 4M55A 3KETA 2YQ4A 3E6AA 3COSA 1FDVA 3ROMA 4D43A 2NU9A 4IQ0A 3ONHA 4QFDA 4B4WA 2BRUA 2O48X 1Z45A 1B14A 1QKIA 5L53A 1RM5A 4TKMA 2ZQZA 4UREA 2Q46A 4OQZA 2NVBA 1E6WA 3Q2KA 1HXHA 5B37A 3ZWAA 2QYSA 4YDRA 2FZWA 4NBWA 1B3RA 1E7MA 1P33A 4CLXA 3GN1A 4NZ9A 4HNGA 4DC1A 3OF2A 4J6FA 4E31A 3HNPA 1ZIDA 1NFFA 2VRBA 4FW8A 5IN4A 4RF2A 4NG5A 4NDNE 5A9RA 1NAHA 2C2XA 3VVCA 3KVOA 5JS6A 1E7RA 4DQUA 4R1UA 1M6HA 1XGKA 4E12A 1H2HA 2IEDA 1W73A 2BGLA 3TZHA 1W4ZA 3HSKA 3NKLA 1QRRA 2QHXA 4E30A 3WICA 3A06A 5T67A 3QA9A 4K26A 2X22A 1PJ4A 3WLEA 4A03A 1SEVA 3SC4A 2I5PO 3V2UA 4XEHA 4HFMA 1HDXA 2ZYAA 3QY9A 1SCUA 2X4GA 5HS6A 1U4OA 4RVFA 4OO3A 2X9VA 3WGZA 1O0SA 1SB9A 3LT2A 1BW9A 1VI2A 1PJLA 1E7QA 5JDCC 1ADCA 5JYEA 3GHYA 4BOYA 4EGFA 1U3VA 3GRPA 3IKVA 3C24A 5DP2A 2ZB4A 2VT2A 3KHUA 3TQHA 2AEMA 3TOXA 3ZHXA 3ZWOA 2E37A 4PN3A 5AOVA 4WCFC 2GN4A 3EDMA 3IJPA 3JD3A 3KZVA 2Y66A 2P68A 3NAQA 4HUJA 4PRKA 4QUKA 3VPGA 3NDIA 1A4UA 1Q0QA 3R3SA 3FHLA 3B1FA 3TZQA 4DXHA 2FWMX 3R0IA 5CFZA 3I9MA 1P0CA 3ORFA 2YQ5A 3BIOA 4CLOB 1HDCA 2O3TA 2Q50A 5TQVA 4CM3A 3MJ4A 3O4RA 4R3WA 5IZCC 4J1NA 4WLFA 1XDWA 3KYCB 5I9NA 4CQLA 4INAA 4I1IA 1FDWA 3P7MA 4Q9NA 2HRZA 3Q1LA 2O23A 1GUZA 2HK9A 4Q39A 5G4KA 3KLPX 3BTOA 3ITKA 4IJVA 4GSKA 3ROKA 1NQAO 1O8CA 3KRTA 1HKUA 1PQWA 3D7LA 3T7EA 4J43A 3QWAA 4PCVA 4E5KA 3JQEA 1OI7A 3F5SA 2G76A 5JC8A 3EGOA 3D64A 4F3YA 4O0LA 2DQ4A 1BXZA 1I24A 1AE1A 2EP5A 4YAEA 4XR9A 1ZVMA 3PFWO 5GZ3A 2WWRA 4E2YA 5JAZA 3L9WA 1YQDA 4L74A 2BKAA 2UYYA 3ONGA 1ZH8A 3MJTA 2QIOA 3F1KA 1PQPA 1HETA 2VRCA 1T2DA 3GVPA 3LT4A 4PRLA 1VL8A 3ASUA 3KEOA 3EAGA 5IG2A 3H9UA 3WIDA 5I8WA 1ZMTA 4A2CA 3LK7A 1G0NA 3PHHA 4YEDA 1AHIA 3LSYA 3EC7A 1M2WA 4TRMA 4YQYA 3ROPA 5CEEA 2EGHA 4EBFA 5EINA 4QECA 4IMPA 4C7JA 2OO5A 3IQDB 4CMIA 4PG5A 3B6ZA 3INRA 3TNLA 2YFQA 1PGPA 4BS9A 3ITDA 3JD0A 3GAZA 1DAPA 5G0VA 3RVDA 1BVRA 1BHSA 1JKFA 1Y8RB 3H9QA 9LDTA 1WW8A 4XIYA 4RPHA 2C5AA 1WMAA 2WM3A 5G4LA 4NJOA 4OIMA 3G79A 4CL3A 1LLUA 1JWAB 4NBTA 4QEDA 3WGIA 4N5NA 4WLUA 5IDXA 1E1LA 3MEQA 4WLVA 3V1TC 1G6KA 4OJNA 1E0DA 5CDGA 3E5MA 4N5MA 2POQX 4NK5A 1GADO 3C8MA 4M1QA 4JJFA 8LDHA 2XF8A 4NIMA 1VKNA 2TMDA 1B3BA 1PWZA 2ZCUA 3WS7A 1E6UA 4AFNA 2C2YA 4ALNA 2O50A 4MVJP 3GVHA 3L4BA 4OHUA 3WGQA 3IDSA 4NJMB 3VPFA 3ABIA 2FPIA 4IM7A 1EE9A 3GGOA 5ILOA 4BNNA 3FBGA 2J3IA 3FWZA 1Y8XB 2I3AA 1LDEA 2WD7A 1I3MA 3AY6A 4XJSA 3QVXA 4FN4A 4AJNA 1CDOA 1GUFA 1Q2XA 4F45A 1MC5A 1JAXA 2OUIA 1B26A 3WSVA 1EK6A 3DZFA 1J49A 3PJFA 4J7UA 3KYBA 3OH8A 3UCEA 1UJMA 5I9MA 5FEUA 1P1HA 1MG0A 3BTUA 1K6IA 3WWZA 2E48A 3RUCA 4BKQA 1CERA 1YDWA 2CY0A 3PHGA 4BNXA 5KJFA 4DMLA 5K6AC 1U2DA 1SEPA 2PGLA 3ZWMA 4CV3A 5HTOA 3CH6A 5GY7A 4PLVA 3RUIA 3TSCA 1GEEA 1ZFNA 3VH3A 4LVCA 2HDHA 4P4GA 3A4VA 1P77A 3OJ0A 1G0OA 4J16A 4J9VA 3ETGA 3KYDB 3AM4A 4JQCA 2HK7A 1ZK1A 4XQ9A 4RPJA 3AM5A 4DIFA 4YBZA 3QWHA 2FSVA 2Q3EA 1G1AA 2P2SA 1QYXA 3I9KA 3W8DA 3LLSA 2G1UA 1RM3A 4FFOA 3JQGA 1NM5A 1T25A 2R2GA 4LISA 2CDCA 2FPPA 1EBFA 3L4SO 1BGVA 4CLEA 4DPKA 3CZRA 4R16A 3AU9A 2OMEA 3GDOA 1XKQA 5CG1A 2VCYA 1QYCA 4CLRB 4PIVA 3PHJA 3NRCA 1CETA 1I36A 2W90A 3OJLA 4YPOA 1WZIA 2RHRA 2I66A 1SB8A 1D8AA 2RCYA 1T24A 2J5KA 1WP4A 3D4OA 4MP8A 3RWBA 3PRJA 3EMKA 3CE6A 3H8VA 2PKRA 2IYPA 4DRYA 3VH1A 5ITWA 4NR0A 5TF4A 5KVCA 3C7DB 3PGXA 1QXSA 4DWVA 1I10A 2QG4A 3ZHYA 4BL5A 2DT5A 4XGKA 3TZ6A 2BFAA 3DXFA 1ISFA 1U1IA 2R00C 3IP1A 4RVGA 4E2WA 4RF5A 3HFSA 3QP9A 2I9PA 1C3VA 1M6WA 3AJRA 3K92A 2V7PA 3WFIA 1LSSA 2PY6A 3JQ9A 4YJGA 3AI1A 2GGSA 2X23A 4IXWA 5HBRA 4D44A 3ZU3A 1NHGA 1R0KA 1FJHA 3K31A 4R1SA 1RPNA 2Y68A 1LSOA 2C07A 2PD4A 5JBIA 2O7SA 2VYVA 4K9DA 3KB6A 4D42A 2UV8A 3QVOA 4BO5A 4WE3A 1V6AA 2W4QA 1DJNA 3WQQA 4BNKA 5ICSA 5BSFA 4NFSA 2FZEA 2CUKA 3KM0A 1LXCA 2YV2A 4XYGA 2H5LA 3MOGA 1U9JA 4J0FA 3Q6IA 3B70A 1C0PA 1KVSA 4BMSA 3QWFA 2HJSA 4UVHA 2ZB8A 3RI3A 3KTDA 2Z1NA 1UP6A 4MVJA 4CL8A 5A3JA 1Y8QB 1K6XA 5A1TA 4CM6A 4YAIA 3TDKA 1LEHA 4ND3A 1ONPA 4IDAA 3SC6A 2NUAA 5L7WA 4E5NA 1PS0A 4MJLA 4WLEA 1P45A 1U8FO 1B8VA 2BFPA 2Y1OA 3FPLA 2NNLD 2IYOA 1KEPA
chains in the Genus database with same CATH superfamily
1YJNI 1LDDA 3MZYA 1JEDA 1GRVA 4TUYB 5FBVB 1W5CC 5IU6A 2Y1CA 5K0BA 1FEZA 3LPMA 3CO7C 3Q9LA 1W1IA 3MTAA 5BR8D 2AMYA 2EL9A 3D54D 4M1KA 3GBSA 3QSYA 3FRHA 3C6BA 1G3SA 3MOIA 1J8YF 2PI0A 4XVRA 1EH8A 4HEJA 3LUKA 2J48A 3MWEB 3HWRA 4BY7J 1O4VA 3TTSA 5HFNA 2IYEA 4DXDA 2KKOA 4LZAA 3BWVA 2WJAA 5DEIA 2M1XA 5CB0A 2STTA 1PR5A 3ZHQA 5F5LA 3TL4X 4ARIA 1KQ9A 4TROA 4WN9B 5A71A 3UTCA 1DWUA 2PBRA 4L0YB 4GR9A 4WK6A 4RMHA 4XGQA 4B17A 2G7MC 1TD9A 4WXPA 2H9YA 4KH1A 5JAIA 1ORKA 2IEKA 2QS9A 4IQGA 2JPCA 3GT7A 3T7IA 4UXHA 1R5GA 4OAQA 1KAOA 1H0MA 2YBEA 3RBZA 4UPVA 5I7EA 5C1DA 3QTBA 4O5OA 1NVEA 1ADFA 5TT1A 3KUCA 3R5KA 2MSDB 3K1NA 2PUGA 1A9PA 2O2IA 2QW8A 4Z3KA 2V1UA 3EZFA 3MKYB 1HXDA 4LJSA 1N0UA 5G41A 3S15J 1U0NA 2I3BA 4JLWA 5EYRA 4G36A 5HDBB 1ZRFA 1KYQA 4P8RA 3J7AF 6NULA 4LFBD 4DA4A 1FJLA 2WIBA 3O2SB 2E7WA 4EG6A 4MWBA 2M30A 2IY8A 5EP1A 1RQGA 4L5IA 4HSEA 5JYDA 4A0SA 4FKZA 4U5XA 4DBLC 5CD9A 3JU3A 5BW4A 1V5WA 1T2AA 4L8VA 5KJCA 3RPUD 4W9NA 5EJMA 2JJ8A 2HJRA 3RASA 2QT9A 2W6JD 1EEHA 2B8TA 4KVZA 4BMVA 3C7AA 1KBOA 2R5YA 3V8QA 2GXUA 2CB9A 2CU7A 5C4MA 4E1BA 4RMNA 2OOSA 1HQYE 3CP2A 3H7AA 1KDTA 2A5YB 2F5DA 2DWQA 2IPXA 5B1IA 2G9NA 5KWVA 2C9MA 1T0FA 2HCTA 3BMCB 1RUNA 1B93A 3ESAA 1EUYA 4WNIA 1AG9A 3NDBB 5DDGA 1BX1A 3WTVC 4A8TA 5KWJA 2YL2A 2WC1A 5FROA 1KYXA 1WI3A 1N5LA 2HJVA 1Z6ZA 1PKEA 2FEXA 1AS3A 4MUAA 3BSYA 4HNHA 1KYWA 1WKMA 1XN7A 1HOTA 1BN6A 5FWYB 3PRYA 2WKPA 4EGQA 5J1SB 2X1HA 3C4VA 1R27A 1TBXA 5KKAA 2C6YA 3BHMA 3TXYA 4A3EJ 3M1LA 1C0KA 3ML1A 1GSAA 3DMGA 4CMEA 4A6DA 2XQFA 2NIPA 3K72B 4Q1BA 4IUCS 3E0JB 3IRUA 1X1EA 4X60A 2JJ2D 1U2GC 4HNAB 3AG3H 4XPZA 1M10A 4Q6WA 3KEQA 4JYCA 3TGPA 3GJTA 4F92B 4HBZA 4PX2A 4JI3D 1RZRD 4ZIRA 2C92A 4PO3X 3I42A 2ZB7A 3V1LA 4A6EA 1QB8A 5F5NA 4A9AA 3O3OB 4ZYXA 2VCEA 4N0EA 4PM4A 4BFXA 4PXSA 4JYBA 1DJQA 1IL0A 1U9IC 1DGQA 4LFUA 2O03A 4LF7B 1QKJA 4KQXA 3BCAA 1MEJA 3B6AA 1N57A 3KE8A 3BSFA 4MNTA 3VOSA 5CNMA 1E6EA 1LVHA 3DKKA 3VDQA 5TS2A 2Q1SA 3T5BA 2C03A 4OIOF 3L0YA 4B80A 5J4KA 2GZWA 2BFNA 2YZMA 1XTAA 4QGFA 4DLSA 1J0BA 1XRRA 3HKEB 4ZKEA 3LNQA 1IG0A 4CTMA 1Z28A 2Z8YA 2VPPA 1U2EA 2FUNB 5K2MA 1TZLA 5K8VA 2NO7A 4Q7QA 4OKIA 4MWZA 1EB8A 4RD3A 3BDAA 2VNJA 2FEMA 3WLIA 3TOBA 3EGEA 4X1OA 1BDBA 3OFNA 4YRKA 1A7JA 1O3QA 2EBUA 4CTOA 2E4VA 4B4VA 3EOAI 3OQVA 3MN1A 2BFCB 1BROA 2V8OA 4B3SB 3LFHA 4B5KA 4MNUA 5I01A 1RPJA 2XEXA 4ISCA 4NULA 4QTUB 1AUXA 4DJEC 2VHXA 3KOXA 3ZJ5A 1FQKA 1E0EA 2YVQA 2QVOA 5DLQC 2DA1A 1P9QC 3VU9B 2NVWA 1DKRA 3BIFA 1FXSA 1GNPA 5FLEX 3JTMA 3NHLA 4P7JA 4MPTA 1F6WA 1E66A 1KERA 1UBKS 3LUBA 5BSKA 1PSDA 2OY0A 4CODB 4PXAA 2IITA 3TW6A 2IRWA 3CCUI 2BMDA 2RGWA 4F85A 4ZJUA 1IMJA 1KI3A 3AVQA 3IHUA 3F8MA 2LUOA 4P35A 5MF6A 1YOBA 5C5EA 2ZIEA 4KYWA 3HWSA 4BFTA 4FMCF 2EKDA 5DO9A 3MRVA 4JYAB 4GP6A 1R88A 4Z4EA 3STHA 2EFNA 4GXOA 4Y9RA 1HQDA 1QHHD 4J1TA 5FUMA 5LKAA 1WXXA 4IQJA 2N46A 3SEZA 4H7DA 4HTAA 1RAIA 1YU9A 2Z58A 2M9HA 3VR5A 3A1EA 1TYBE 4LTDA 4P34A 1FYEA 5JAMA 3CJQB 9ANTA 2W11A 2VQ6A 3K8ZA 4CIDA 1CZRA 3W9YA 3AOEC 3B8HA 2IKQA 3N8IA 1BHJA 1U3GA 4DCMA 4KR3A 1Z39A 3PE6A 4E03A 4X20B 1TJ5A 2NT4A 4RQTA 5FO5A 2WIJA 2BKXA 3ZCXA 4TLMB 3PWKA 1Z73A 2E6KA 3RJZA 1ZM4A 3MLBA 2OBLA 3R3VA 3TJZA 1L4GA 1F14A 2YWDA 1M8FA 1AVTA 2QTNA 1Z91A 5F04A 2M45A 1FMCA 1RZVA 4I9UA 5EGOB 3R3ZA 2ZCJA 4BE1A 2DQLA 4IFTA 2LVSA 4LGWA 1IZ9A 1RD4A 5IKXA 2JBWA 4MITA 2YOFA 3IQWA 3JALA 3GEPA 4R8RA 1V3VA 2A9JA 4O8ZA 1CQPA 4XQCA 2FQXA 2P91A 2D8MA 4YV7A 2O3RA 1HFEL 4XOTA 3UAVA 1F3LA 1CRZA 3TBFA 5GIOE 1O3SA 2VJMB 5IRCD 5L3FA 4UHBA 3LW7A 3LT0A 3ZC3A 3PD7A 3FYHA 3DHNA 1E92A 3WX0A 4LF9D 5DM0A 2A1UB 4QTTB 4P82A 2YWEA 5FL7A 5JC1A 3QMVA 4EKNB 3EYYA 4L6AA 3KSDO 4A3JJ 3OQ6A 5DNDA 3E23A 4U0JA 1K3FA 2HMWA 3VC3A 2WEKA 2FPLA 2YSRA 1E89A 1IB6A 2CMPA 4L75A 4YJHB 4MTDA 5EMNA 2P41A 4XWTA 3WRXC 4U87A 4UE6A 4NMWA 1UHSA 4P32A 5EXXA 3GBPA 3VNAA 3RF6A 5KQMA 5P8WA 2DTEA 3CINA 3OR2C 3OFKA 5HM6A 2LCFA 4LMBA 4AQDA 5G2OA 3ZH2A 1EP3B 1NQUA 2XUAA 2PYZA 1H94A 2OV7A 3MCZA 4JOCA 1WUHS 4DV6B 1V7ZA 1X7XB 5FYDA 1UM9B 3PG5A 1AC5A 3KQPA 3L3BA 1IU9A 1TLTA 3OT4A 4BACA 4TQ9A 4P9FA 3A7DA 1VLMA 3WODF 3FPGA 3STUA 1TNDA 4F2DA 1R6DA 2BM8A 3SHQA 2M3AA 3LUFA 1AUPA 3AF6A 1N2BA 1WVIA 3ET4A 2BR3A 3ZV7A 3DEYX 4F2GA 1R3DA 2OAQ1 1Z6QA 3CUVA 4G1MB 4XIJA 3GXBA 4LGCA 3SXYA 4DARA 4H59A 3QU9A 2PEZA 2R7DA 2LSOA 1O1YA 3JR9A 2Q8QA 2QLJA 1CPYA 1WMBA 3BFKA 2WDPA 1O97D 4KR6A 4TKLA 1C1XB 3BCHA 5KIAA 1NI4B 2NVUB 3B52X 1OFCX 1G59A 1SHTX 2OLEA 3C3AA 2R4QA 4M7RA 4N39A 4ANFA 4EM1A 3U37A 3HM5A 4NJEA 3DPUA 2QBYA 2CV0A 3O93A 1Y6JA 4Z0HO 2O6GE 1P2DA 4EIWA 4OP3A 1M1ZA 5DTJA 3VYUB 4OMYA 4HNUA 4TVSA 4R54A 4N01A 2YICA 2FW0A 4GI7A 3ABMH 3ZN1A 2OPBA 4LOLA 3WYEA 5D6EA 3BB1A 3GFBA 3O2QB 2C82A 5AOCA 2H08A 4L18B 2F8MA 3RDPA 1OD6A 5D8DA 1OT5A 2P8SA 5AW8A 1HRDA 4GZ6A 3VFZA 4CGZA 5G40A 2KPMA 2XD9A 5IK2A 3LLVA 2DA7A 3B7PA 2Q5LA 4RADA 4QIWN 3T1VA 3QXJA 4PYNA 4RKFA 4Y7NJ 1XD8A 2DPYA 3QNMA 4AD8A 3K3PA 3N58A 4YJFA 1EUCA 2A1TR 3JQ8B 4XA8A 1I14A 4CG2A 2QX8A 3MB8A 2J3EA 2XT9A 4IO1A 4NPCA 3E1KA 1GT6A 1I0ZA 2ZJ0A 1JYFA 3G9ZA 3OJEA 1O94C 1FIAA 1AF7A 3MWFA 1GNVA 1Z5ZA 3K6KA 4JODA 2I87A 5AM2A 4UEWA 5BT9A 2C4TA 4UUSB 3MWEA 3LCJA 3ER8A 1YW7A 3DVAA 4N54A 4JI8B 1VSQA 5IT0A 3U4QB 5F9MA 5KYWA 4B3JA 1LFUP 1P7IA 2HYJA 2JBHA 3ZP5A 2UVPB 2A9KA 5D3QA 2WF9A 4LAFA 1VBKA 3T1HB 2BIFA 3WTYC 4ARCA 4HZUB 3ZGVA 2O8BB 3EIFA 1ZHHA 4AJLA 3DC7A 3T3NA 2R4UA 2GFQA 4H7KA 1VLVA 3WJAA 1H4TA 4O4LB 2R1UA 3FROA 4TXJA 3BR0A 4YRAA 3CRZA 3MSCA 3TG2A 5IK2D 1T1RA 5AUOB 1X7WB 3HXTA 4MV8A 3GYHX 1REPC 1T0PA 3HCAA 1SD1A 4NYMQ 1KXJA 4WZ6A 2FX2A 1WCMJ 4LSGA 3ANSA 4AIJA 1VQ7I 2I1SA 1WCYA 3ZTWA 4R31A 1NW7A 1Q14A 2C77A 4QDTA 3HDJA 3IJRA 2R85A 5K4GA 1R0SA 1S02A 5E7IA 3RKSA 1T4MA 2C5SA 3CUKA 5KNDH 5KSZA 3OQNA 1S4QA 5BV2P 1TKBA 2C8JA 4B3IA 1OXXK 1E6MA 4G9BA 1F9NA 2QTFA 2Q6KA 5D8KB 3H0CA 5CRIA 1BWRA 1E79D 3NNNA 1GTRA 3CLVA 4AG5A 3SQOA 4WK2B 3K09C 2OZPA 1OCPA 1OF1A 1ADBA 4BJ5C 1KO4A 1XXHB 5MFZA 3QP5A 4OU0A 3C3MA 2I4TA 4DCUA 2YJGA 1EWKA 4O2BF 2FN9A 3IPCA 1OC2A 1JLKA 3QE4A 4KNVA 3O90A 3BR1A 1M72A 1QLHA 2FSWA 3ENWA 1NG7A 2PZLA 1R1UA 1FW8A 3O4FA 4YLEA 2A5DA 4DA6A 1SD2A 4D9JA 4MVJF 2G25A 2CUJA 1LI4A 1XKLA 2PJDA 2YCLA 4O8CA 4KQKA 3SEQA 4BMXA 4WWHA 4PZCA 4JX5A 5GOTA 3NIGB 3BL6A 4YFKF 2R7UA 4XKVA 3ZQ6A 3WZLA 4JT9A 3L0ZA 3LHIA 1MQSA 3SZ3A 4DANA 1LEAA 4BP9A 2WVJA 2KTLA 2FCRA 3FCCA 1KFBB 2PZEA 3EUWA 2EW1A 1M2GA 2QMHA 4LYGA 4OQPA 4QXMA 3PI6A 3P71T 4CIVA 4NCJA 2IVMA 1KQ8A 1RPZA 1UBOS 3A31A 3O84A 4OQ4A 2HD4A 2X6QA 2WSMA 4R8LA 1Q7BA 5JD4A 4K40A 5AJZA 2GK7A 3QPUA 4QU0A 1NVBA 5E9QA 4QUIA 2GH1A 2R5WA 1YX3A 2L7MP 4EEZA 4FVTA 3VR6D 3JYQA 4Q3LA 5EEGA 3GC6A 4F7WA 3AVUA 1NVVR 3HYLA 1TRHA 1U0RA 2F1KA 4OXYA 4JUIA 2ZYRA 1TW3A 3NFRA 1S5LC 1MJGM 1E1QD 3S27A 3P2JA 4POOA 2VJOA 2HT6A 4IIFA 3PQ3A 4K8RB 1E1KA 3E4DA 4Q16A 3GFVA 2JGNA 4NCIA 3TIIA 3HYSA 5LVAA 3OCZA 5EHQA 1D5YA 2VJMA 4JLPA 2CQXA 2ZSIA 3UC9A 5JH7A 2NZVG 3VKUA 4NY1A 4YB8A 4RWZA 3GFTA 3OA0A 2ZM5A 1QBKC 4D3FA 1ETWA 2FF4A 3F22A 5JVDA 5FNZA 4ZV9A 1XEAA 1ENZA 3IOYA 4X6LA 4D9EA 4DIOA 2PBIA 1TMYA 2QN1A 4MIEA 3OPMA 4KIUA 1NR1A 2B8JA 3ZR4B 2Q2EA 3DOJA 3QYEA 2MC4A 3E6AA 4U2DA 3Q5FA 5ICGA 2VJNA 1Z45A 3D8SA 4BX8A 1VE7A 5JJCA 4U7DA 2FZWA 1SQ0A 4G12A 3WLHA 1B3RA 1F2DA 1SU8A 2YJ3A 3W06A 2H3HA 4UASA 3IAUA 3OV8A 3JZIA 4DV7D 3OF2A 5IULC 1Z4KA 3ASOH 3ISTA 4ESBA 1K78A 3E5UA 1NAHA 4WZAE 3HBNA 3KVOA 2C3UA 3THWB 2AJTA 2BM9A 5BXQC 4N6OA 5GJCA 2W6IA 1NT4A 1ZRMA 4K0KB 4YCDA 1ZA1A 3V34A 4F3TA 2V7EA 2CJXA 3TIXB 1KJJA 5DSZA 3OWOA 3RABA 1ADCA 3GHYA 3LY9A 2BGWA 4ZXPA 4M3GA 2XZDA 1UBEA 1H1LB 2ALJA 4WFKA 4RFVA 5BXYA 3PFCA 3P9CA 3B38A 2R4GA 5H20A 2GHTA 3KYCB 3C39A 4I1IA 2WJYA 1GUZA 4FONA 4Q39A 1YUNA 1FP6A 4GSKA 5CIQA 4ZYTA 3OKCA 1Q7TA 4LRXA 1YS6A 1AUVA 3ZCSA 3DF9A 4C0BA 4DUZD 3F1KA 1T2DA 3GVPA 4G8XA 5IG2A 3DE5X 3FUTA 3K4MA 2F3RA 1SRRA 2OHIA 2C8VA 2GFHA 4XWGA 2VDJA 4V1CA 2FF5A 2FOLA 5DMXA 4KLAA 2E4ZA 3K1PA 5CYGA 2JK3A 1JKFA 1W7PA 1EGHA 2C9CA 1Z2OX 2I2AA 1PYGA 2IZOA 3HGQA 1QH8B 3MEQA 4I2VA 5E1XA 1E0DA 2DFTA 1C4XA 2RFLA 3SGLA 3KBGA 1SBZA 5LQDA 4ZCMA 1GL7A 3WS7A 1YJBA 2WW8A 1NULA 3D9QX 4PAQA 2QWXA 3SXUA 2IV2X 2XUQA 3OE7A 2A6TA 2F5CA 4NEHB 2KP6A 5B58C 1I9GA 3VSDA 3Q0UA 4B3RD 2ZETA 4KRGA 4F45A 2IXTA 3UCEA 1UJMA 2VAPA 1ORDA 1VDZA 1MHTA 1D2RA 3CKLA 1F51E 3ADDA 4LVCA 4PSKA 3ME5A 4PK4A 1HUQA 4RPJA 1SCIA 3B6MA 1ODCA 5EVCA 1EVLA 1L7AA 1ACLA 3ASYA 5GTHC 1EBFA 1JBKA 3MTBA 2GWHA 4NCXA 2J9RA 2QTTA 2V58A 5B36A 2B20A 2FW9A 2I66A 3EF3A 2QIPA 3C18A 3SYKA 3GLUA 1UPBA 4X6AJ 1F43A 4KPUB 1KY2A 3OIUA 2EQ5A 1DKNA 3U80A 1IQ0A 3BE4A 4DWVA 4M9XA 1Q57A 4XGKA 4RF5A 4DR1B 1H1TA 3AHGA 1M6WA 4OB8A 1BXRA 1QFZA 1QGAA 2AUNA 1ZVVA 2VYVA 2XAUA 3B2QA 2ZI9A 4HLXA 2XE8A 3TKLA 3BQ9A 4NFSA 4QOJA 5IY5H 5GP9A 4DLTA 2ZULA 3MOGA 3KP4A 4UVHA 3V97A 4F2PA 3OM0A 1J09A 2JK1A 1R2QA 4OI4A 3KT3A 1P45A 2EFJA 3AF3A 3DV0A 2PRYA 1OLUA 2V7UA 3KBOA 4FZJA 3KXKA 1QWOA 3R6WA 3ZWXA 2MYSA 3HVJA 2R7ZJ 5TS3A 4P38A 5H3LA 2XNHA 1Z75A 1RHKA 1YGPA 3LG2A 3M9WA 2QD2A 1XTVA 1F8GA 4B9EA 3A01A 1D4OA 2H5IA 3U17A 1VP3A 3K2QA 3N2GA 1ZVKA 1XEXA 5BR7A 4JK3A 1DEOA 3GEZA 3C87A 3C1UA 4U2BA 4H6WA 1R8QA 3QEMA 2H3EA 5JNTA 3ER9A 1WX1A 2JC3A 3QYJA 2JPBA 5AICA 4CJXA 1EUCB 1Z36A 5KOJA 3BZWA 3K4BA 3NDJA 3EG9A 5EFZA 4X9XA 2JI4A 3RKWA 2C2MA 5C4GB 1T0FC 3BE6A 1R4ZA 1GKKA 2JI8A 1RTKA 4GI1A 1G8JA 2OD7A 1UMKA 1Z3YA 2RH4A 5A5GA 4ERNA 4ZOQI 4I3GA 4MRMB 4J03A 4EL0A 3GPDG 2JFGA 4MROA 1LW7A 2WZDA 5ALGA 1O5OA 5KSYA 2NS7A 1J5EB 1GAXA 1RYFA 4BBZA 4ZXFA 3PHLA 1D2GA 3WGLA 2H1KA 1YJ5A 2A5LA 4RD4A 4XGIA 5EWJA 2MINB 1VQLI 4CZ2A 3FUXA 5ER6A 4XJXA 2NPIA 2GM9A 4CV2A 1UFVA 5E8IA 5C8VA 4KO8A 4NQWA 1YB2A 1LD3A 1P3DA 3VPHA 3UJ3X 3ECCA 1X8KA 3O8RA 3GRUA 4B2YA 3OT1B 2GEBA 2CF6A 1A5BB 3MUEA 1MKMA 2O0LA 4AN0A 1U3WA 3P7NA 2J7KA 4LFCD 2WV0A 1CEEA 1MAWA 1FTQA 3K5PA 5BS6A 3WNVA 4ZJZA 3K0SA 3K9QO 4FOOA 4EQ6B 4PHGA 4DSNA 1J7KA 2IY7A 5CYVA 4Q21A 5JZMA 4EGYA 2VP3A 1M8GA 3MA0A 2XAQA 1UMCB 2WAYA 1PV1A 3RU7A 5LM3A 1PTKA 3BF8A 4FCWA 1CR1A 1R4NA 3FM5A 5C8XA 3KKKA 3SI7A 1O57A 4TWZA 3ZU5A 2GLTA 5LYJA 3CO5A 5DCWA 3RC7A 3TQFA 2X1LA 3LCRA 1WGXA 1C9NA 1GFIA 2AG8A 4IDGA 3I28A 3CF2A 5A5VA 4NBSA 1UG0A 4P98A 2HQSA 3WYAA 1OCOH 4DLZA 4X85A 3V1NA 4I55F 2Q8PA 1WS6A 4XPIB 5GAGJ 3G2KA 1MVLA 2V65A 2Z4SA 1P0IA 1JF8A 3HDGA 1LFBA 2JPDA 1ZCBA 4O4LF 3FCXA 3C5WP 1A7KA 5T3UA 1ZUD1 3E0XA 5E4JA 4FWIB 2XZLA 2HZDA 5H59A 2R92J 2WYHA 1QRUA 3M8KA 1FLVA 3MS2A 2M7BA 4EL5A 3TLBA 4GICA 3IEMA 1X4OA 1AZLA 3VAYA 1FNNA 4UTXA 4YWHA 1X77A 1ODIA 4BBJA 2FPKA 2O5RA 2I7XA 2JFFA 1YVDA 4FOLA 1U1FA 2CBXA 3DEIA 1UBNA 5F76A 5K0FA 4P9NA 4A0RA 2KE5A 5HS7A 2EKQA 2CMHA 1QS0B 4YWJA 3T0GA 3VBEA 2UV1A 1SIUA 3LJKA 2IXAA 2J3HA 2DYSH 1FXUA 1GRRA 3V4FA 2O8FB 3ZWKA 2M1BA 3WXBA 1RQPA 3IVXA 2G63A 2FW6A 1M66A 4EK9A 3D5EA 4WNYA 3N1UA 6PFKA 2QB5A 3U62A 3Q11A 1T36B 2EJTA 3WMXA 3R7LA 2UUOA 1DIBA 1E0SA 2O6LA 3HYNA 3E9ZA 3ABZA 2WPNA 2C20A 4J4BA 3T34A 4NJMA 4J75A 1I3NA 2ZI7A 4N5DA 2WFMA 4GKVA 3Q98A 1IHOA 4E5VA 5HIAA 1V3FA 3P27A 3ZIDA 3ER6A 3LOUA 3GF2A 1VPEA 2QRZA 2E18A 4BNFA 1IAVA 3BGSA 5EMMA 1PEAA 1BR4A 2FX0A 4HH0A 4MUYA 1R66A 3LPAA 2VUHB 4JUDX 2B25A 5IJ9A 2OQRA 1X7DA 1YZLA 3PZBA 1USTA 3VUEA 1RKUA 4FQ8A 3Q0VA 4K6FA 4RHXA 2HUNA 3NYWA 5ESWA 2RGYA 1TJ3A 1YBVA 4XNFA 4X00A 2UAGA 2FE3A 5GONA 2QWWA 1C4WA 1DHTA 3TQSA 2ISSD 3AR7A 1DO8A 1EQUA 2IEZA 1CNEA 4H6PA 3QOWA 1PJSA 1P9RA 3MJVA 1JHHA 4K6HA 4BNHA 2A5WA 3RSSA 5FQ2B 1AHHA 2FOKA 3GRRA 1SG0A 4V39A 3S7TA 2Y8EA 4LLGF 5LD2B 3FXQA 2PQ2A 4FX4A 4C6TA 1Y4AE 4NH0A 1B72B 5E0KB 2AFHE 3T41A 1T6YA 2HT1A 2B34A 4CQMD 4X90A 3HDYA 4MV7A 4S0HB 5FA8A 2HBYA 2O1EA 4EATA 5HILA 1ORTA 1UQUA 1J8FA 2OL4A 5T5QA 3HV2A 3GY0A 4GRAA 2HA7A 4L8FA 3ZGLA 3IIIA 1OASA 3O82A 4Y6PA 3HJFA 2BHLA 5EJIA 1NRIA 5KK1A 4OQFA 5EIOA 1E3WB 2DQZA 1NZDA 3FXKA 1YRYE 3HOUJ 2HBRA 1XYYA 3U0BA 4Q3OA 4MK4A 2PSFA 3OC0A 4R1PA 4ENPA 1I51A 4PCAA 4MRPA 1HNWD 2HQNA 1VZ2A 3PNMA 2ECOA 2IJLA 1XMJA 1RBQA 4EA8A 3OYLA 5A05A 5F3RA 3HCDA 2A2ZA 3VXKA 2TMKA 2IUEA 5SZHB 3M6UA 2CQ7A 3NYIA 1MOZA 1YTUA 5ULLA 1VSTA 2IYVA 1JNXX 1JEJA 3WTXC 1MO6A 3PEWA 3OKAA 4JVSB 3SS8A 3KPUA 4AKIA 1UK7A 1G6HA 4EJMA 3B20A 3I0NA 1HE1C 3ZGZA 3OWTA 4RQUA 4IWYA 1O6GA 3VKHA 3JRAA 1NBEA 5A3RA 4CV1A 2FKNA 3D8RA 3SR0A 1S1MA 3OQIA 5ELMA 2V96A 3ONFA 1FP4B 2NU9B 2O2CA 5DYIA 4N0QA 3H9BA 4EY5A 4ALIA 1ZUHA 1J24A 2G1JA 3RVPA 1CNFA 3NKFA 4RQAA 2P1RA 1XF1A 2IYUA 4QM7A 4IIGA 2EG9A 5LQNA 4BNVA 2PUDA 3T5GA 3BSSA 1ZH5A 4J0GA 2P1ZA 3RS8A 2Z04A 3TSWA 5G1PA 4ZANA 2QE6A 4LQDA 1E8DA 3GD5A 4KB5A 3HL2A 4IHXA 1E99A 4V0RA 2CE2X 2FPGB 2Y4OA 2PUWA 1BKSB 2I0FA 5KVSA 3EW7A 3NG1A 3BDIA 1Z3CA 1FDTA 3C3YA 4GVPA 2P90A 4NFLA 1TEHA 3TL3A 4DV0B 2Z2XA 1CY8A 4MVJE 5JBQA 1W29A 1H2YA 4RGBA 2AFVA 4E3WA 3RAEC 1C0WA 3IUNA 4XVQA 5C7IO 4NOMA 2CHQA 3MJSA 2HWWA 4MI1A 3IOCA 1EVQA 4QDUA 5LYJB 1KXZA 4JL8A 1PJAA 2P81A 1XG5A 2FUG2 1HSTA 2P5VA 2ATCA 5EP2A 4Y2QA 1NW4A 2HF7A 1BS2A 4BQSA 2B4QA 2Z1DA 2WV7A 4FPXA 2GN8A 1LZKA 4CKCB 2L42A 4ZVSA 1DVRA 4RZUA 3HN2A 3DW3X 2MGQA 1X9GA 3PUBA 4MPJA 1LTKA 1S7GA 3RVOA 1ZG1A 4BNTA 1BOAA 2P4UA 3ZE7A 2H65A 1VA5A 1X74A 2OXRA 4URVR 2M87A 4DV5B 3JCUC 5C1OA 2DB3A 3BTCA 1USUA 1YFLA 1BMFD 4H1UA 3SC2A 3CF0A 2WA1A 4WEQA 2ZJ1A 4I0WB 4R1HA 1ATZA 4DN6A 3T12A 4LY9A 2B6HA 1RI5A 1XRLA 2L0XA 4TTIA 4YMSA 4IZHA 4MWTA 2MYPA 3BB3A 1I32A 3EQLF 3FHJA 2CEAA 2C0CA 2AJBA 4RB0A 2Z16A 4N47A 1D1AA 3PS9A 5H02A 1FDSA 3W5DA 3G88A 4JR1A 1EK1A 5E3IA 2I34A 2PWPA 4MB0A 3GLTA 4OB7A 4EX6A 3OIQA 2HWVA 2J6IA 1DSSG 3K7EA 2O2XA 1SHUX 1MCZA 3MMPA 2D5AA 5E17F 3MIIA 5H5JA 2LOOA 2H57A 2EOAA 4QYSA 3VOTA 2FPMA 2ZPAA 2P7HA 5AK6A 3W77A 1L5VA 1L7XA 1F36A 4KQMA 3NHZA 5FFFA 1H6AA 4A15A 5FORA 4BJ6C 1NSTA 5JLAA 1AGNA 4N6GA 2Q0HA 2NU8B 3KS9A 5TMDA 2TCTA 4QBIA 2FWPA 5JS7A 2BHNA 3I9JA 1ABBA 5CYFA 3K1MA 4GX1A 1O7FA 4BGDA 2FX3A 1SMKA 3BQMB 1RHUA 2VYND 2YXPX 2CG4A 1OX5A 4BXUA 5J63A 3E5XA 2H4XA 1S3FA 4JI6D 1JE0A 4MVYA 1Q3HA 3ZY2A 1DKOA 2G80A 3ZV6A 3V00A 1GQ2A 1Y9ZA 2A69F 1K6MA 2Z6AA 3WP0A 1Y7PA 1MIJA 5ECGC 3JD1A 1N2IA 2VNAA 1LX6A 1CU1A 4J49A 3FE2A 2BY0A 4KAJA 2HU7A 4PC3A 5AUQA 1IHPA 4PJ0C 4E7ZA 4ND1A 2GWRA 1GO2A 2J9GA 4PZZA 2V26A 2RGNA 1FSEA 1TX4B 1QYRA 4UVIA 1L5QA 4TVOA 4QG7A 4OK5A 4Q4JB 4BEJA 1VGRA 3D7KA 3FPBA 1Y7LA 2BHTA 2QSJA 4WNCA 3UMGA 1C3OA 3LAWA 3IUEA 1JR4A 3HDVA 2CB0A 1KRXA 1VPDA 4E7SA 1MH9A 4AMYA 2QRMA 5JTUA 4XH9B 3SJ7A 1LLQA 1Z8DA 2V7GA 2HKOA 4KBFA 1EFKA 3W6OA 2ZCVA 4LNUA 3A1YA 5IN5A 2QX7A 2MMGA 4FCCA 3JTGA 1RYEA 1UIMA 4QJ3A 5JQGF 4QE3A 3AEQB 1WPRA 2HBQA 4C0JA 2XGJA 4HOBA 4D26A 2X5XA 4UJ3A 4W5WA 4B1RA 4ARUA 1NXTA 3HCBA 3GNSA 3KWFA 2XPCA 5EPUA 4ZEOA 4ZMBA 3JQCA 1L1QA 3H2YA 3AHJA 3T8YA 4XR4A 2E1CA 2ZMEB 4RGSA 2ZTMA 4MCJA 5IBRA 1Z05A 2G06A 1IPEA 3T54A 3SLKA 2B8EA 4CUGA 1DFHA 1S4MA 3HK2A 2FEWB 2PSSA 3LCMA 4WCGA 4IRMA 1EFRA 1CJBA 2AOXA 1MDMA 2QRKA 3R0VA 1UCRA 4B7CA 2H8WA 2PSJA 2ZUDA 2BLNA 4BCCA 5AKEA 4RH1A 2BZTA 1Z2DA 1Y7HA 3OT5A 4OXIA 5H70A 3TOVA 3W5CA 1C30A 5K99A 4LFAD 2DM6A 4BVJA 1YDHA 2CJWB 4YIIA 2AB0A 4UDNA 2X3FA 4ZT4A 4GMDA 2CH0A 2XZOA 2FR0A 4TT8A 1KJQA 1RQ7A 4ZVVA 4FQ7A 2AEEA 1AQ6A 4IKFA 4QNMA 1HOMA 4A2QA 3WL5A 1WZNA 5CT4A 1S8NA 2XV1A 3ROUA 4G8DA 1OR7A 1OZFA 4WFQA 3FISA 3CH7A 1QPMA 4H9GA 2AWNA 4Q12A 1E1RA 1KSGA 4CT4B 4OXXA 3TI7A 1E2IA 1UBFA 2IX3A 2COEA 1VI0A 1GQFA 1P1KA 2M2EA 2W2LA 1SKAA 4IHJF 1VKHA 3A05A 2JIZA 5FHQA 1DUVG 4BKRA 4EG7A 1FRFS 4UQLA 5ALNA 1VG1A 1UQTA 3W6ZA 3OZWA 1VRVA 1ICIA 1JQLB 2CQKA 1M5RA 2VNIA 1TVCA 1S01A 5AHRA 2B63J 3VPRA 2ZR9A 1FRNA 3OTQA 2NO0A 4FDUA 1GGMA 2IP4A 3FUCA 1P2BA 3WJ7A 4R40A 3I61A 2QQGA 4UM9B 4WKPA 1FVXA 2CCGA 4QXOA 3TXXA 2QI9F 5JRJA 4UULA 3ESQA 4OIFA 2IZ6A 3BMXA 3F8WA 4BNIA 4R2HA 2VHUA 3G17A 3CNEA 1RJGA 4M0PA 1XBTA 4Y6RA 4MHTA 2Y75A 1KYVA 1HYGA 1D0YA 1MD9A 3X44A 4D9GA 5TF0A 3U2RA 3L2OB 3KR2A 4MQ9F 3H6KA 1P7ZA 1GRQA 2KJQA 3L8ZA 5BV7A 4HH1A 4GOMD 2HSGA 2PMEA 1OWOA 4KQ9A 3R6LA 2LLKA 4TS4A 2QZ8A 1ONNA 2Z56A 1OHHA 2Q3BA 4UJ5A 3I23A 3U9LA 3L5KA 3MD0A 1V8PA 3RH0A 3S2ZA 1N0HA 4JI1B 3PC8A 3G7UA 4OSPA 3RSNA 1PVVA 3PXXA 1REQA 4ZAFA 4C7MA 5F7XA 1PT6A 2C9DA 1AOYA 4L0QA 5F2EA 4KIFA 3AY0A 4RANA 4NU5A 1GGVA 1UZAA 2JAXA 3ICWA 1QYDA 2X85A 1W4BA 4KQ2A 4X3PA 5JH7B 1X58A 3VR5H 3ZY5A 3DYBA 3SXPA 5D5XB 2AOUA 3H36A 1RR6A 1AUOA 4C5AA 4QRDA 2PUBA 2IYFA 2ZVQX 1KE2A 4S1WA 4B4WA 2O48X 5FBKA 1B0ZA 2LPMA 3KXIA 5JPCA 1HPLA 3I2YX 1R7JA 2L01A 5IEJA 3M4XA 3ANTA 4CKBB 4NBWA 3WMGA 1XNJA 1KAQA 3SG0A 1RU3A 3O1HB 2QF7A 3O31A 4RF2A 3NATA 4YALA 2XDWA 1R0RE 1N2CE 3W5BA 1IN1A 4IZOA 4PEVA 1XPRA 1Q91A 3DXYA 2QI9C 3IYLW 1Z7GA 3UT5A 4A03A 2LF7A 2A33A 1LBHA 4PSVA 3ERMA 4EVRA 1YK0A 2J0EA 4OO3A 5JYEA 2D06A 1MABB 4BOYA 1DCKA 2Q3DA 3C24A 4YCBA 2F8SA 3BE8A 3M0EA 4N40A 4OHXA 2B3DA 1J8DA 2ZXFA 2CNOA 4ZTZB 4HI0E 5LA6A 3CNOA 4PRKA 3U1BA 3RVRA 3B6CA 2PAAA 5CFZA 1P0CA 2IPAB 1RKVA 1XMPA 3A7EA 2P2LA 3CLRD 5BORA 1T1GA 3ZGKA 2HK9A 1P29A 1A5TA 4J43A 1ZKDA 2EBHX 4Y1EA 3TMOA 3CC7I 5FTNA 1C7RA 1LB1B 3HZOA 2P2GA 4EGSA 2Y2UA 3F4KA 3EAGA 3M9XA 4JVLA 2PYIA 3LK7A 3LSYA 5CLFA 2BCEA 1SELA 1M2WA 2W4MA 3E9RA 5BPFA 1B72A 2H85A 1AQIA 3B6ZA 4HB0A 2DMNA 1B2RA 3A1WA 1FNSA 5BSVA 1YZTA 9LDTA 4FEEA 4RHYA 2RHGB 4CL3A 4D8TA 2ISQA 3BZBA 3B3FA 1TECE 3OCUA 3GTGJ 2C8KA 3GRCA 1KMHA 2A59A 4ND8A 4M1QA 1MABA 2ZUWA 4NIMA 5B3JC 3L79A 4E7LA 2C2YA 4PYRA 2R97A 2IYQA 5GONB 1VKJA 5EHXA 3GUHA 4OOIA 1PSZA 4KGZA 2P7VB 4HAZA 4EB0A 3IBCA 1JAXA 3DDUA 1R71A 3MVPA 5FEUA 2XOKD 1SG6A 2WAOA 1H4QA 1QFYA 1J39A 2H7CA 4RK0A 1YC5A 1M34E 2DA3A 3KXLA 2HDHA 1UFQA 1P77A 4KN8A 4HDMA 4JB8A 4JQCA 4BV3A 4DB2A 2NYRA 5HOEA 4XONA 2ZU6A 2W2PA 5ALWA 4LF6B 3LLSA 2GCNA 1T25A 4LISA 4H0EA 4IRXA 4RA6B 3FOZA 2Z9DA 3A9RA 5CG1A 4PIVA 5H2FC 1ZOSA 2OHHA 2LBFA 1CUVA 4ZT5A 1OTXA 3R7AA 2PXCA 4R8HA 3HPHA 1OZ0A 3R5TA 2ZMEC 5KSOA 2OHFA 2ZTHA 4BL5A 2W5UA 3MRTA 5CH5A 5JXJA 1UC8A 3B5EA 3F78A 3OU6A 4KRXA 3RZDJ 1XS9A 3QVOA 2GKSA 4BB0A 4HJRA 1AZSC 2VJKA 2UUAB 4G5GA 2OKCA 2W0MA 4BEVA 3AEXA 1TGYA 2W2TA 4QC2A 2OTCA 3I59B 5EKDA 4WLEA 2Y1OA 1ABFA 4QQFA 1Q0LA 1GVNB 2G9QA 2HOSA 2DO7A 3UAWA 2UVPA 1P9OA 1CZNA 3ONVA 2QQ5A 5LLQA 3TH5A 4JH0A 5C8YA 4MWDA 2P6PA 4DV7B 1S8OA 4BRZA 3DVAB 1EJ9A 1EF4A 1IHDA 4FKMA 4CQJA 3H2HA 1LF5A 3OO0A 1QSGA 3GOQA 3H8JA 4BHTA 1EFAA 1U31A 4B6EA 1GTSA 2WAAA 4EW6A 2JIBA 2VXBA 3TEJA 3ZXXA 3S8EA 4JKOA 4FFNA 2VH1A 5FBQB 2CGPA 2ZYGA 4BLSA 2B7EA 4MVXA 4NP6A 1FY2A 3RU3A 3FFWA 2CFOA 2E85A 3T9EA 5AWFC 1HL3A 1LDNA 4GBJA 3V8VA 2ZI4A 3UTDA 1MZBA 2VQSA 4D4KA 3HH8A 1RYBA 3OYBA 3FWYA 3UR3C 3PQDA 4WJLA 2X6WA 3HKDA 4UMEA 3ANLA 3NVDA 1TOAA 3F90A 4JQOA 3KL4A 3E9NA 1P4JA 4B2LA 1ZN2A 1EFRD 1DQYA 2DBRA 3F47A 4P7BA 2R8RA 2D2IA 2QG9A 1QONA 1FZPB 3U44A 2VBIA 3GFOA 4I4NA 1ON2A 4QG3A 1A1VA 1Z4IA 3OTGA 2PH5A 2XHEA 4RKQA 3BREA 3FMGA 3HQ4O 3WGGA 3GUVA 1TYCA 4CM1A 3T7CA 1L3BA 5AW0A 3E9QA 4F4FA 2EGGA 5A4JA 1RIFA 1ZK3A 1YI2I 3ABOB 4FHEA 5HNFA 4HMOA 1X1DA 5FNVB 3ANMA 2QD5A 5C53B 3KT0A 2C00A 2Y27A 4XD7A 4BNLA 3IH2A 4Z9AA 1JIXA 1MP0A 1YS4A 4D82A 4TV9B 3CURA 1NLZA 5HQ3B 1ZOIA 3P9NA 1OB2A 3HO1A 5A6VA 2W43A 2WUGA 4ZVMA 3HKCA 3OOPA 3H0GJ 2EIJH 3H9EO 2B1QA 5HS4A 3HTXA 3QOPA 1XA0A 5LP1A 2GN2A 1L5LA 1YQTA 2EERA 5HVNA 4HQ0A 3DT6A 1MOSA 1SVMA 1I7DA 1UQRA 2CXNA 3BCRA 1GPUA 1VCHA 3MQFA 5JUWA 3WHCA 1JA9A 1WHSA 4Z7OB 4O4JB 2X4IA 3OJFA 1UH5A 4IYJA 4G0MA 2OQIA 3ZQIA 1QHFA 3H0EA 3TR6A 1ULUA 2CV2A 2R96A 1AKUA 2RK6A 3V55A 1E4VA 3M6FA 1JIJA 2EIHA 3NIDB 2FEAA 3VA7A 2PCLA 2CUEA 2ODNA 1PJRA 1IQPA 1IG7A 5JAOA