3KYDB

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
545
structure length
477
Chain Sequence
SRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQDQQVLDVKSYARLFSKSIETLRVHLAEKDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-activating enzyme subunit 1
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 120
structure length 477
sequence length 545
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
B PF14732 UAE_UbL Ubiquitin/SUMO-activating enzyme ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.520 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ubiquitin activating enzymes (Uba3). Chain: B, domain 2 3kydB02
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 3kydB03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kydB01
2QQ5A 3M6IA 4NPCA 1XIVA 3PLRA 4B3JA 1A4UA 2X86A 5IDWA 1BSVA 1ISFA 2WD7A 4GPD1 1U4SA 2CDCA 3BA1A 1J5PA 1R12A 4IXTA 4GGPA 3VDQA 3ZNNA 1NVMB 3INRA 3DHNA 1TT5B 3PHGA 4IZHA 1IYZA 4OKIA 5FFFA 1NQ5A 3TWOA 1UP6A 1VKNA 4YT4A 4CMGA 2Z5LA 3MOIA 4RVDA 2WYUA 3TDKA 1ZCJA 4ID9A 3C85A 1AE1A 4FGWA 4PRLA 2I5PO 2PZMA 4ZQFA 2I66A 1LU9A 2JD0A 4WLFA 3RD5A 5GZ3A 2ZCVA 1B2LA 3B1JA 3WTBA 4LRTB 1T1RA 4IY1A 4EDFA 1GPDG 3GRPA 1PZFA 3VAZA 3WMWA 1E0DA 5EQFA 4U0KA 4RVSA 1XU7A 4DLAA 2BRUA 5JY1A 1KYQA 4N5NA 1M6WA 4W99A 1NP3A 1ZZEA 3TZHA 1R4MA 2EW8A 4L4RA 4E4YA 3EZYA 1P0CA 1K3TA 1ZMOA 1YOVA 3RC1A 1HRDA 1YWGO 2EG9A 4W6ZA 4NBUA 2HAEA 1NASA 2DBRA 3HZZA 4BNNA 1KVUA 1YBAA 2GSDA 1M67A 4IS3A 4E2XA 1PJ2A 4A2CA 1DIRA 2OMEA 1ID1A 3TZ6A 2VQ3A 1GV1A 2Q1TA 4CLOA 3GN2A 4RCVA 1IUKA 2NQTA 3A4VA 4BB6A 2Q46A 3FF4A 2DC1A 2DQ4A 2Y1DA 3LF2A 2GCGA 3HG7A 1R16A 4ZD6A 2VCYA 4ZQEA 2FPIA 1JKIA 2WEKA 3CEAA 1YJ8A 4WLOA 5HS4A 3GEGA 1YL7A 3P5SA 1ZSYA 3PEFA 4R69A 3JYOA 3KYCA 4J43A 1CQIA 2Y1OA 4NK4A 4GAEA 4Z9YA 4D45A 1AHIA 1I3MA 3PYMA 5C7LO 2DTXA 3I6IA 1O8CA 3SJUA 1T25A 2B5WA 5JO9A 4YT8A 1ULUA 3JQAB 1ZMTA 4PVDA 1MXHA 5DBGA 3LLSA 1N7HA 4CQLB 3GVXA 1HE4A 2JAPA 3GHYA 4B7CA 2PR2A 2O3QA 3GZNA 4AJLA 2X6TA 3RUHA 1PS0A 4E13A 2D0IA 4RPLA 3VH4A 4JXKA 4FDAA 2WYWA 4BL5A 1BHSA 2D8AA 2YHUA 4CM8A 4CM3A 3DOOA 4IUYA 3AY3A 2VWPA 1UP4A 4XRGA 5DCUA 5I9NA 3OIFA 3WG9A 4PG5A 4GQAA 2PNFA 3DBHA 3W8FA 2X8LA 1QMGA 1PIWA 2PX9A 8LDHA 3Q11A 3T4EA 4QFDA 2J3HA 4NBRA 3ADOA 1LTHR 2Y67A 5MGBA 2OFPA 3P19A 3I9MA 1E7RA 3OEWA 1GEEA 4TMFA 1NPYA 4CQMA 5BNFA 3DBRB 4RF5A 2HK8A 3CSDA 4RORA 1SNYA 3U0BA 4AJNA 4CM7A 1BGVA 4J9VA 4J0EA 5TJHA 4CV2A 1KBZA 4JBHA 4CJXA 4Z0HO 4YQYA 1MGOA 3I9JA 3E82A 4WLEA 3OETA 1U3WA 1B3BA 3CUKA 4RQUA 5GY7A 3UH1A 4CR8A 3SXPA 4CUKA 1E6WA 4AJIA 1EE2A 3KVOA 5IN5A 5T57A 3AU8A 4U5QA 1MXFA 2ZTMA 3RUEA 2NTJA 3D4OA 1Y9AA 2G0TA 2H63A 2O2SA 3WX0A 4OHUA 3TF5A 2CZCA 2PGJA 2HJSA 2E82A 4TVBA 2Y68A 3OICA 4CQMD 1ISHA 2FWMX 2NVBA 2G76A 1YDWA 4BO5A 1DO8A 3ZWXA 4BVAA 2B35A 3E9NA 1GAEO 3WBFA 4P8RA 1RM0A 2Q45A 4C4OA 5CDGA 1HTBA 2HMSA 4J1TA 3ZHZA 1ZIDA 2R00C 1OBFO 4MPDA 4R5MA 2ZIZA 1GD1O 3U4CA 3TOZA 5JDCA 4JIGA 2WD7B 1NQAO 4RO0A 1NVTA 3DTTA 1P74A 3IJPA 3UCFA 1GL3A 4A27A 4E12A 3F1KA 3KTDA 4YCAA 4P38A 4MINA 3D7LA 3EGOA 4HKTA 3WSVA 5ES3A 4J91A 3DMTA 3F5SA 1E7WA 1M2WA 3QP9A 5F21A 2PD3A 1VKOA 3PWSA 3M2PA 1WXDA 3QWHA 3TNLA 2EKQA 3KO8A 4O63O 2RHCA 1RJWA 5JCJA 1LSUA 1X7GA 5IFLA 2Q4BA 3WBBA 4DBVO 4R3WA 3U09A 4XDYA 2CDAA 4L9RA 5A4DA 4K6CA 5A9TA 2C0CA 4PLZA 1NFFA 2BELA 2X22A 2EHDA 4N18A 1M6HA 2GASA 4YT5A 2B69A 1YQXA 4JQCA 3V5NA 3HJAA 1UXJA 4CMIA 4DPLA 1Q1NA 4YPOA 1KVSA 1GQYA 3JQ9C 3Q1LA 5F3RA 3D3WB 4IMRA 2ZTVA 5EIOA 1I8TA 1R4MB 1LDGA 1XWFA 5A9SA 5HS6A 1DAPA 1YOVB 1TI7A 3C1AA 3PDUA 2P91A 4HV4A 1IY8A 4AJHA 1HDGO 1E77A 4TZTA 3RBZA 3MJSA 2PZKA 3AOEA 4ESOA 2HMVA 3KRTA 4NBTA 5JCJD 2O3TA 3K73O 4FB5A 4FIZA 3GRKA 5TF4A 4F6LA 4AJPA 4R4JA 3PJFA 1RM5A 4CLOB 3L4SO 4CMCA 2QRKA 4BNZA 2X1HA 2CMDA 3IC5A 4UEOA 1XQ1A 1PJTA 3N7UA 3JQBA 1Y81A 4FFRA 5FQ2B 4GGOA 2PA3A 3TZQA 1OZAA 1G0NA 2PH5A 2DT5A 3JYNA 3KYCB 1HDOA 3BMQA 1WMBA 4PFJA 1NVGA 2NADA 4W82A 3I23A 4L75A 5G4KA 2CD9A 3WSWA 5DBFA 3QWBA 4PLYA 3GGGA 1J0XO 2NTVA 4MKXA 3VH1A 4W5VB 3FD8A 4IJWA 1HLDA 3O38A 3JD0A 5G0UA 1ULSA 4O6VA 8ADHA 3ZHXA 1U8FO 3GZNB 2GRAA 1MG5A 1NNUA 2C7VA 3AOGA 1P45A 3IP3A 2FZWA 1I0ZA 3WICA 2IEBA 1PJLA 2FMUA 2VZ8A 3K2EA 4CM8B 1H6AA 2P5UA 4BOYA 2VZ0A 3T7CA 1PQWA 2J5RA 4EI2A 1ENZA 1V3VA 5IF3A 4BGEA 3OJLA 1UZLA 4J49A 1X0VA 5KWEA 4GX2A 2PKQP 3DBHB 4P4GA 5A1TA 1R0LA 4MO2A 4JX8A 3FPLA 1NPDA 2OP1A 3H7AA 2JD1A 4CPDA 2FR1A 1ADCA 5A02A 1LLQA 4IQGA 5EJ2A 2HSDA 3HDYA 2BF7A 3DEYX 3ONGA 4R1NA 3TL3A 3NT2A 1OC2A 2GERA 1CEQA 5BQFA 3GF4A 3ON5A 3VVCA 3PDJA 3LT4A 4Q3BA 5AXDA 1EUDA 2EP5A 1MV8A 3FBTA 2YFHA 5JSFA 5JDCC 2E4AA 2B4TO 4IZIA 1GZ6A 3KLPX 3S1LA 2PTGA 3HFGA 3JQDA 1HETA 4JJIA 5JPIA 5JC1A 1A9ZA 3ZWCA 4A10A 4GMFA 4CM6A 2NNLD 1NTOA 3AW9A 1BDBA 3RJ9A 4DVJA 3FNHA 4FR5A 3WGQA 2J6IA 2JFGA 4D43A 1T2EA 2W2KA 3B70A 3UW3A 1B3RA 1MLDA 4D41A 2BFMA 3I1JA 3K30A 3NTRA 3OJ0A 1HF3A 4ZN6A 1K0UA 1KEPA 5JAIA 5KVCA 1C14A 4WEQA 3H2SA 2J3KA 3WWYA 1A5ZA 3DAFA 3GQVA 4RF2A 1GQ2A 1RWBA 1PWXA 1BXGA 2IXAA 3OMLA 5BSFA 3FN1A 4ONEA 3OIDA 3EHEA 2Q50A 4YDRA 3WYBA 1X7HA 4GX5A 3ZWYA 3GG2A 5TNXA 1VI2A 5KIAA 4HBGA 4ROSA 1QYDA 3OJFA 1E3SA 1KEVA 3FNGA 4J4TA 1Q0HA 1XSEA 4IIUA 4R68A 4QSMA 2AW5A 4B7XA 1I3KA 1LJ8A 1RM4A 1YO6A 4MJLA 3K92A 2AHRA 4LVUA 4RPGA 1ZW1A 3H9QA 4ZQHA 5K0ZA 4AJJA 1QSGA 2WM3A 3AOEC 3HDQA 2VYVA 5BSEA 4CL8A 2VUUA 3L4BC 3ONEA 1XEAA 4DQXA 4OKNA 5A04A 4HNGA 3O8QA 4NBVA 1K6JA 3H9UA 1X14A 1LC3A 4PLGA 1SO8A 2ZK7A 3DR3A 3OJEA 4KOAA 3EW7A 4QFCA 4YR9A 5AOVA 1BW9B 2J5KA 4CLDA 1IZ0A 5JNLA 4EUFA 3ROQA 5KKAA 4BQRA 1DEHA 1PX0A 1P77A 3L0DA 2D59A 5G0VA 3ZV4A 1QYCA 4CMIB 3QHAA 4IGFA 4U0JA 4MP3A 3PZRA 2YHIA 1HT0A 1WNTA 1P1RA 3ORFA 5TQVA 5AXBA 4CM9A 3JQFC 5IDXA 3D4NA 3ZWBA 5A9SB 1A7KA 3PK0A 1CIVA 3U4IA 2PY6A 2VYVD 3PLNA 4LK3A 4R1TA 4GX0A 4CM1A 3RIHA 1T2CA 4ALKA 3L77A 1KVTA 4FFMA 4IGEA 2P2SA 4OXYA 2Q1WA 4DBZA 5I8WA 1KY5A 1EUZA 4Y98A 4NZ9A 4CV1A 3GOHA 1AXGA 1PJQA 4WLNA 3VH3A 2DPGA 1ZEMA 4PVCA 1OFGA 2CVQA 2HRBA 1UH5A 3LC2O 4KZPA 1Y8RB 1Y8QB 3C1OA 4MVJI 4BNWA 4CM9D 2Y05A 4I5EA 4BNMA 3PFFA 2HK9A 2EKLA 1HSZA 1VC2A 3NDJA 4BNTA 3UAGA 2I3GA 1Z6ZA 2YZ7A 3BMQB 3RU7A 3ULKA 4RPJA 5G4KB 1HE5A 3M1AA 2QYSA 3ZU5A 5BSHA 1R4NA 1PQUA 1ZXLA 4XYMA 4HNHA 4WECA 3CINA 3LLVA 2QX7A 4WOKA 1LQTA 4BNVA 4IQ8A 4XQEA 3U3XA 4OQYA 2O4UX 3ZU4A 3NKLA 1ZK0A 2W98A 3LDHA 3NJ8A 2PGDA 1A7AA 2JKVA 2EW2A 3AM3A 1PGJA 2GYYA 3VOSA 4LISA 4Q3CA 4HY3A 2JHGA 3D0OA 2Q2VA 5ITWA 1DFHA 5L3ZA 1PSDA 3DWFA 3AUUA 4A73A 3Q2KA 4ZVVA 3S8MA 3BHMA 4AJOA 1M76A 3MZ0A 4HXYA 3DXFA 4HUJA 3RC9A 4GLOA 3AUTA 3VKUA 5G0TA 4M1QA 4YRAA 1V35A 4E31A 1LC0A 3O4RA 4CLXA 1QYWA 3GN1A 5ILGA 5IN4A 2B4RO 2VT3A 4P4LA 5KJCA 1OAAA 1HDXA 1XCBA 3IUSA 5KKCA 5IZCA 3JTMA 1P1HA 4NH4A 2GZ1A 2W8ZA 3BMOB 3WGHA 4BNJA 5B12A 4NQZA 3WMXA 1SEVA 1SMKA 4PLHA 4DC0A 3PQFA 4OM8A 2TMGA 5COAA 1V6AA 5KNLA 1DIAA 1MFZA 4ND4A 5DULA 4LW8A 1L7EA 1YJQA 1HE3A 1ZJZA 2RH8A 4KTTE 2D2IA 2DFVA 4IDCA 3WS7A 2R6JA 3BZUA 4EJ6A 5CHEA 1GV0A 3TN7A 4J3FA 2W2KB 3PFWO 3RFVA 1TA4A 3H3JA 3HQ4O 3L6EA 3HB4X 4DGSA 1YE3A 4N5LA 1NAIA 2VRCD 4BNIA 3E8XA 1I3NA 1SB8A 1J6UA 1BXGB 1VJ1A 4OH1A 5DN9A 1EZ4A 4JP2A 3GPDG 2EERA 4PG6A 5T67A 4E5NA 5KCZA 2VUTA 4GWKA 4ALJA 4Y8VA 1FDWA 4BO4A 3MJTA 5C7IO 4B4VA 5ER6A 1ZKMA 1HXHA 3GR6A 4PGFA 4HFNA 2QW8A 1HWYA 3PP8A 4BNGA 2Y0CA 4Y6SA 3UN1A 4NFYA 1FDUA 3F46A 2B0JA 1HDRA 3OBBA 3GUYA 2VNAA 4B3IA 2DAPA 2QHXA 3LZ6A 4II3A 2HCTA 2LDBA 1PGPA 4JROA 4JJGA 4RDHA 4D79A 2GO1A 3SVTA 5IXYA 2PK3A 3PYXA 4L73A 1R15A 2BI7A 2IODA 4NJMA 3ZW9A 4RL6A 3F4BA 1OI7A 5KJEA 5DNAA 5JCXA 2GGSA 3DZKA 3RKUA 4B4WA 1E1LA 3IIEA 3FHLA 2A92A 1WW8A 3FRJA 4AFNA 1YH3A 1B26A 3VPSA 5ENVA 3OP4A 1JDJA 4H15A 2AG8A 5K9ZA 3GK3A 3NT4A 1XU9A 5JAQA 4RVGA 3SEFA 4E5YA 4MIYA 3CXRA 3VPFA 1NBOA 1DC3A 1P1KA 3BMNA 5F5LA 2O7SA 1F8GA 1PZEA 4XGKA 3QRWA 1RYDA 4AICA 1AUPA 2RHRA 3A9WA 4S3MA 5JS6A 2V7PA 3ZWPA 3AUAA 2Q1UA 2EEZA 1VL0A 4L0QA 4NFHA 5B1YA 1KVRA 1A72A 2YV1A 2HMUA 4YAJA 2QIOA 4ZRMA 2ILTA 3W8EA 4QXMA 2C54A 2NU7A 4BGIA 5IXSA 3DBLA 3FTNA 2Y99A 3D4PA 4BNXA 4CMBA 1Z75A 3OA0A 2GN8A 1V9LA 4QX6A 3W4IA 2UUOA 2O3JA 4H3VA 4ILKA 3BAZA 1CYDA 5ICSA 4PRKA 1ZUD1 3PVZA 4WCFB 1B7GO 5DT9A 1KC3A 3WIDA 3TOXA 5JFOA 4RLSA 4CMHA 3IOYA 4MVJP 5I7FA 1UXGA 1V0JA 5GZ6A 3Q6IA 1HZJA 4ZA2A 5CFZA 2X23A 1PR3A 3HWRA 4YAIA 2R00A 4OJNA 4B8WA 1DIGA 1YBVA 1HDYA 4QT0A 2E6UX 4DIBA 4GI2A 4TKMA 3QVWA 4BO7A 3E18A 5HTOA 1QP8A 2OP0A 3DC2A 5IZCC 1FMCA 3RBXA 1KETA 3CZMA 4RGBA 1VJ0A 1X1EA 1F8FA 5CDSA 3QVOA 4XB2A 4UUMA 2QRLA 3DZBA 4K6FA 5I7SA 3LF1A 1WP4A 4BV9A 2I99A 5HM8A 1F06A 1EEHA 2H1SA 3WQQA 1TEHA 3ZWOA 3FBGA 4XJSA 1EBUA 1LDNA 3ETEA 1CJCA 2DUWA 3MCVA 4JNKA 4E21A 5C37A 4TRMA 2WE7A 5A5EA 3ITDA 1I01A 4YAEA 4BIIA 2VYNA 4C7JA 4YBZA 3HDHA 2FHSA 2IE0A 1DIBA 1DJNA 3KHUA 4IJKA 1E7YA 5DF1A 4J7XA 4JP3A 3FWNA 5DOZA 1ENPA 3VPXA 1LEHA 3EMKA 4BNHA 2X0JA 3JQ9A 1ONPA 3O9ZA 2EKPA 3TQHA 4GMGA 5IDYA 3H3FA 3WDSA 4BMVA 4DMMA 1ZSNA 4Q3AA 3NTOA 5CDYA 4IDAA 2A4KA 2BFAA 1VPDA 3QWIA 1ZSVA 2PWZA 3VTFA 5DOVA 4TWRA 2VYND 1NQOA 1NWHA 1O95A 3GEDA 1ZBQA 4R1SA 4UUOA 3I6QA 3UFXA 1U1IA 1P1JA 3W1VA 1NAHA 3F1LA 4XQ9A 4I5GA 2OBYA 3I52A 1UDCA 4D0RA 4KWIA 4XGNA 2XPCA 4RF4A 4Z9FA 5JDIC 3EZLA 1DC6A 1RM3A 4WEOA 2BKAA 3IUPA 1DHRA 1FDTA 1U2DA 4ALNA 4EUHA 2ET6A 3EK2A 2OBNA 1F12A 1ZK3A 3KM0A 1LLDA 3C24A 4CODB 4PZDA 3WNVA 1M75A 4CUZA 4U8GA 4WGGA 4CL3A 3OA2A 1H2HA 4R51A 5AXCA 3S2EA 4DIFA 4DLLA 5H83A 4F6CA 2PZLA 2GN4A 4I5FA 1G1AA 5JY6A 3FNEA 4Z3KA 4G5HA 4M89A 1MX3A 3RBVA 2BFOA 2Q99A 1XYGA 2F1KA 2NTNA 3B1FA 2XXBA 2X9VA 3I9LA 4YYZA 4BKQA 5TSDA 5IAAA 4OQZA 1VM6A 1RPNA 5ITVA 3Q0EA 1K6IA 3AK4A 4QO8A 1YL6A 3KV3O 4FFPA 4BB5A 3KYBA 3ONDA 4K28A 2P68A 3D3EA 1PJ4A 4X54A 5KVQA 4KUHA 4QO7A 2J3JA 4K1LA 3GPIA 1O89A 2AQHA 2QYTA 5U9CA 3DFUA 4OL9A 3ZNPA 4HFMA 4JLWA 4YJFA 5H81A 3LK7A 4TSKA 1P31A 4Y67A 3BMNB 3G1TA 4O5OA 5KVSA 5L7TA 4EEXA 1E3WB 2NACA 1DDOA 2Q3EA 4XIYA 4PLFA 3ZV3A 5K6AC 3RUAA 1NHGA 3E1KA 3W8DA 1NXQA 4XEHA 3CMCO 3GVCA 1A4IA 1VL6A 2PH3A 4HX5A 1KC1A 3ASVA 3F5QA 4G65A 1YKFA 4XCVA 3FI9A 4IDGA 5I8ZA 1I36A 1DIHA 4NI5A 4A0SA 4ZRNA 1T26A 3FCOA 3ZWWA 4W4TA 1BDMA 2P9GA 1U8XX 4OOEA 3S2GA 1AXEA 3WJ7A 3ZNOA 3ETDA 4H7PA 1NM5A 4CMEA 5TGDA 3V1TC 2ZJ0A 3HE3A 4JGBA 4E5MA 3H9JA 3UCXA 3WQSB 4XR9A 2ZTLA 5JMPA 1D7OA 2A9FA 4KTVE 1VSUA 3LVFO 1E92A 1AHHA 3CTMA 4YB8A 3VKVA 3JQGA 3QE3A 4MP8A 1U9JA 3N58A 5KJ1A 1VL8A 4UUNA 4BGUA 1GUZA 4YTEA 3W4KA 4OYRA 1CETA 4XYGA 1Z74A 4QUKA 3E5RA 2HU2A 2YFQA 4FS3A 1CRWG 3IL2A 1LNQA 4O59O 1LDBA 5A3VA 3KB6A 1FF9A 3UGKA 2EXXA 1D1SA 1KERA 1C1DA 3EC7A 1I33A 4NMHA 4U6SA 3WGGA 3PZBA 2FZEA 5C5IA 2XF8A 3PHLA 2W90A 1NPTO 3L4BA 4NU6A 4KQWA 4BKOA 5TIIA 4CMKA 1H6BA 4Y6PA 4QEDA 1SBYA 2CDBA 2CF5A 5JAMA 4WNIA 2FRDA 1H6CA 1P33A 2FSVA 1SOWA 4DWVA 1LQUA 2BHLA 2Q4EA 5B37A 3L9WA 4KP7A 3SBOA 4IMPA 3TRIA 1W73A 4A03A 2CFCA 4CMAA 4FCCA 5ER9A 4MVJA 1D8AA 2ZYAA 2G82A 2UVDA 3GVIA 3OEYA 3JQFA 3PHHA 1CDOA 3JQ6A 2E48A 4KUEA 4OSOA 3EYWA 3VC7A 2A94A 2EIHA 1E7SA 1F0YA 2WYVA 3T7EA 3JD2A 4EBFA 4O1MA 1QRRA 1QG6A 3HSKA 1WZIA 1XG5A 4I9NA 2DBZA 5CEJA 1HLPA 2TMDA 1YB1A 3DOJA 3DZJA 1B14A 3JQEA 5KJ6A 4TRRA 1PU2A 3H9GA 1Z7BA 5A3JA 4CLRA 5L51A 2IXBA 1PS9A 3INTA 2X4GA 4MVJD 4RDIA 1YB5A 3E9QA 4L74A 4MVJM 4AJ2A 1YGYA 2I3AA 3TL2A 4E33A 1DFGA 3JYQA 1KEUA 1PR9A 3GAFA 4ND1A 2GUGA 1NHWA 1DHTA 2CUKA 2XXJA 5LC1A 3WFJA 5MDHA 2C29D 3GGPA 1Q2XA 3KSDO 2UYYA 4M86A 1P44A 1VJTA 4R3NA 5I9MA 1LX6A 1BXKA 1KY4A 4E6PA 4J7CA 4KDEA 4D46A 3PPIA 1TXGA 1QXSA 4EGFA 2VTDA 4P4NA 4Y9DA 1Y5RA 4CQMB 1F17A 3ZWAA 4IM7A 4Z0TA 4XR4A 3D1LA 4LSMA 2IRWA 3S55A 3NGLA 4GSLA 4IJUA 3DBVO 1DBVO 1B15A 2DM6A 1SOVA 3HN2A 2Q2WA 2VZ9A 1UP7A 4BNUA 4D3DA 4DL9A 3NDIA 3LC1O 3WYCA 5TT1A 1T24A 1AGNA 2ZYDA 4BMSA 2WTBA 1T2DA 2D3TA 4LVCA 3B6ZA 5JLAA 5I7VA 1WWKA 1C1XA 5FYDA 2YDXA 4CMEC 1WPQA 5ADHA 2DTEA 1X7DA 4KUGA 1UZNA 3F3SA 1Y6JA 4IS2A 1MC4A 1JTVA 4CMJA 4W9NC 4Y6RA 1JLLA 1Z7EA 4YJFB 1LDYA 1ZO8A 5KJFA 4ZHSA 1B8PA 3DZIA 3EVTA 4XDZA 2GNAA 4R41A 2CVOA 1E3LA 3H9EO 4P22A 4RQTA 1GTMA 3WYEA 1CF2O 3UUWA 3SC4A 1MUUA 3FPCA 3ZWMA 1ZFNA 1QKIA 3OSUA 1ISJA 5BNIA 3NX4A 4CR7A 3OJOA 1LA2A 1ONOA 1J49A 3ZZNA 2JD2A 2OXIA 3O26A 7MDHA 4ALMA 4H16A 1JKFA 1N92A 4R9SA 3GEMA 4PZCA 4BNKA 3EUWA 5U1PA 3I5MA 2ZYGA 5GZ1A 5JMWA 1UR5A 4J0FA 1XQ6A 2CVZA 2VWGA 1LSOA 1PTJA 1I10A 5JYDA 1CWUA 1I5RA 4UVEA 1WDLA 4NFSA 3HB5X 4ND5A 2JAHA 3JD3A 4G81A 4J9UE 2CY0A 1ADFA 2C59A 4FC6A 3UXYA 3DB2A 2DVMA 2EJVA 3GVHA 3QSGA 2OGUA 2EV9A 3G0OA 3JQGB 3VPHA 4BO8A 1ZJYA 2I9PA 3JQ7A 4IDFA 4Q39A 3ICCA 2Q1SA 3PGJA 2FPPA 2VUSA 3MEQA 5G0SA 3OQ6A 1ZH8A 2VNSA 4OXNA 4LN1A 4AVYA 1NR7A 1LLUA 1ZK2A 3U4HA 4E2WA 1EFLA 4PN3A 3ZI0A 4LGVA 4DTIA 3K5PA 4FOSA 2JCYA 3AY7A 5EQDA 3PWZA 1C1DB 3ZW8A 1OMOA 3HN7A 3F9IA 3PJDA 3PGXA 4BO9A 2NVWA 2WDZA 4PG8A 3BYZA 2Z1MA 4LMRA 3UICA 3INGA 3BTSA 2ZB4A 2Y0DA 4RPHA 3AJRA 5DDIP 4MVJG 4BHTA 4XZ3A 3ZCXA 2O3UA 3RWBA 4RF3A 4RVUA 1YVEI 2EGHA 1UJMA 4UULA 1I24A 4FN4A 1UAYA 1HEUA 1WDMA 3OQBA 1LXCA 5F1KA 4R1UA 1MFPA 3KLMX 1EQUA 2EP7A 3ZNQA 4TKLA 2X7HA 4KQXA 3ZGYA 3ZWNA 2P9EA 3DDNA 2G1UA 3KXDA 3KYDA 3LT0A 4XWYA 4ALLA 2NLOA 4OIMA 2VHWA 3V2HA 4AG3A 1JAYA 3AUSA 1U28A 2AA3A 4BV8A 3HHPA 1OC4A 3E5MA 2C07A 2C20A 2FSSA 3JD1A 3PXXA 2O3SA 4IPTA 1WMAA 2VT2A 2VTEA 3JSAA 1VRWA 2X5JO 1EVZA 4Z0PA 1WDKA 2NU8A 1E3IA 5TT0A 4B7UA 4RLHA 5FI3A 4MKRA 2H9IA 5F1OA 4AJ1A 1ZVMA 1O6ZA 3I9OA 3VZPA 3G49A 1NYTA 2Q49A 3OIGA 5L4NA 2GD1O 1T2FA 3QJ5A 1PGNA 2Y0EA 4FC7A 4L8VA 4RVHA 1C0IA 2C2XA 2ZKLA 4WLVA 3STHA 1C0KA 1MA0A 3KSUA 5L7YA 1IHYA 1ZNQO 3QQPA 4R9RA 2O3RA 4ZU3A 3F6YA 4MP6A 3PQDA 2X5OA 2ZJ1A 3WNQA 2AXQA 3P2OA 5BNTA 4IDEA 5EPOA 2X9GA 4Q3DA 3ROKA 2CSUA 3WFIA 2VRCA 3QWFA 5L4SA 4YEDA 4DRYA 2IYOA 5DP2A 1SCUA 4TQGA 5CPBA 3WQRA 5KVVA 2EGGA 2X0RA 1GUYA 3CH6A 3S2IA 2I65A 1GPJA 2IZ0A 1B16A 1U7TA 3SX2A 3ZV6A 2PV7A 3C8MA 1D4FA 5AQ1A 1EVJA 1PZGA 4EJMA 2VHVA 3SJ7A 1EK5A 4DQVA 5B4VA 3A28A 3BXXA 3ZU3A 4BO1A 1H0KA 5C7OO 3RQSA 5TX7A 1GCOA 1C1XB 1WAMA 4IXWA 5COQA 4UEKA 5TJ9A 2AQ8A 1NFRA 2BGMA 2OO5A 4XGIA 1YQGA 1Y7TA 1YBMA 2F00A 1LLCA 4LCJA 3ZV5A 1PL8A 1M66A 4INAA 3DZFA 3QVXA 3RSHA 3HADA 3RUFA 4HFRA 1R66A 5AXAA 3L9XA 5U4QA 4HFJA 2OHXA 1WVGA 4M87A 3DAGA 4CQLA 3GFBA 4K9DA 3ICPA 1E5LA 3ENKA 5I9LA 2H5LA 4UVHA 2JCVA 1FXSA 4L4SA 4UUPA 1X13A 3FN4A 4BUCA 5JBIA 3TFOA 1X1TA 3FWZA 1ONNA 2CF6A 3TFQA 2VHZA 1NWCA 3PHIA 4WKGA 3I4FA 3BHJA 4AJ4A 4HADA 1O9BA 2PD4A 1DJQA 1EDOA 3BTUA 4CLHA 2V6GA 2X0NA 5LDHA 5EMHA 5G2OA 1QORA 2QG4A 3G3EA 3GT0A 3JQAD 4FFLA 4JBGA 3ETGA 2RIRA 4I8XA 2HUNA 3O8QB 4IDDA 5JDIA 1JWAB 4W7IA 4CV0A 4DREA 4I5DA 1E3JA 4C7KA 3EY4A 3MJCA 5B4UA 4MKZA 2WMDA 4AJKA 1Z82A 3F47A 2JFHA 3JQ7B 5FWNA 3C7CB 5L40A 1SEPA 1EBFA 1EFKA 1QV6A 1UXHA 1LRJA 3P7MA 1VSVA 2I76A 4BKUA 3WB9A 2DBQA 2YHIB 3Q2IA 2NWQA 3E6AA 5A5FA 1R0SA 3ST7A 2VHXA 5EESA 2XAAA 6LDHA 3JYPA 4UVDA 1GADO 3D5QA 2LDXA 1MC5A 2V6MA 1IHXA 2QZ9A 4GX1A 5LCXA 3F4LA 3GHHA 1ENYA 1GCUA 3FSRA 3V2UA 1CQJA 1GUFA 4YJGA 4YA6A 1QLHA 4R5HA 3VVBA 2NM0A 3K6JA 3UKOA 1LSSA 4XIJA 3D64A 1JA9A 4NG5A 2C82A 4YT2A 1S7CA 2Y1CA 4MIEA 3U49A 1SZJG 2AMFA 3L6DA 2BI8A 5IDQA 3DOCA 2H6EA 4MVJH 3JQ8A 4XJTA 3R1IA 2BLLA 1HSOA 2DUUA 1PJSA 2PD6A 5I7EA 2HRZA 2GF2A 2OOSA 2RCYA 1KIFA 2WE8A 3HNPA 4J4HA 1GEGA 1P1IA 4J2HA 5F1PA 5A9RA 4NR0A 2YV2A 3R3JA 5DCYA 1R4NB 1GU7A 1ADBA 1KS9A 3OM9A 1DLIA 4EITA 5K6AA 3KOUA 3C3XA 2BH9A 3ANLA 4WASA 3L6OO 2ZB8A 2V65A 3KYDB 3RI3A 3ASUA 1BRMA 3EAGA 3UOGA 3GG9A 4BKRA 4B3HA 1LDMA 3K8ZA 1C0LA 4GBJA 1KOLA 1S6YA 1YXMA 3NV9A 5EERA 3BIOA 1ISIA 2FOIA 1PL7A 4XX0A 3RUDA 4IJVA 3PTZA 3KEQA 4DXHA 1E5QA 3LSYA 3H6KA 1IZ9A 4JJFA 1SAYA 5BSGA 2X0IA 4ZQGA 3ZH2A 1YQDA 1GR0A 2YV3A 1XLTA 1A71A 4DYVA 1PQPA 4MVJE 1JKJA 2HKIA 5BT9A 4A7PA 3RC2A 2PZJA 4BS9A 2R2GA 1Z45A 1PGQA 2BFPA 4IBOA 2YYYA 4M54A 1H5QA 3S2FA 4DIOA 5JE8A 1L1FA 4JK3A 3D3WA 2G5CA 1IPEA 2EWMA 3DZHA 3FR7A 5CEFA 5L45A 4NU5A 3NDRA 2D1YA 3IAHA 3I9NA 4FD3A 4Q3EA 2YUTA 4L4XA 1G0OA 1GYRA 2P4HX 4XD2A 2NSDA 3KETA 4FFNA 3IJRA 1VLLA 4R01A 1D3AA 2PKRA 3RC7A 1B8VA 1B0AA 3NTQA 2IYPA 4N7RA 4EYEA 5HA5A 4E5KA 1PL6A 2AEJA 2WJPA 1Q0QA 5F5NA 4YAKA 4E2YA 3CZRA 3WGZA 1HYGA 3QLJA 1ARZA 3SC6A 4D3SA 4YRDA 4MOWA 1N5DA 1YB4A 1Q7BA 3NT5A 4E0BA 1R6DA 5HRUA 1QYVA 3PJEA 1J4AA 4UVIA 3PIIA 3LT1A 2IZZA 3NYWA 4XYEA 2UUPA 1U3TA 5TLSA 4MIOA 1H6DA 4EZBA 3DTYA 1G6KA 4ND3A 2X9NA 2JHFA 4W7HA 4EUEA 4J4BA 2J3IA 3RJ5A 2C5EA 4B79A 3E48A 1GYPA 4E3ZA 1DB3A 2AEFA 4IDBA 3MWEB 5J23A 1UZMA 2BD0A 5ENDA 9LDBA 3LYLA 1U3VA 3OF2A 2HLPA 3ANNA 3PWKA 1ORRA 3GGOA 2B36A 1H93A 3PI7A 3Q9NA 3H65A 4NJMB 3EVNA 3MJ4A 2ZQYA 1PWZA 2IZ1A 6ADHA 4PLTA 2SCUA 1RKXA 2BGLA 2YQ5A 4GKVA 4YQZA 3K31A 1D1TA 4YJDA 1XGKA 2ZTUA 5G0WA 3K9QO 1K6XA 2GN9A 2HJRA 2JL1A 3OECA 1CERA 3PYLA 4BO0A 2RAFA 2WSBA 4FBGA 3MJEA 1DFIA 4TROA 3IQDB 4CM4A 3GZ4A 5CG1A 3CMMA 3H8VA 5T6BA 3IDSA 4XYLA 5EL0A 4E32A 2JJYA 3K2BA 4R16A 1JVSA 2X5KO 4RVFA 3BTVA 1N9GA 1MP0A 2JCXA 2P9CA 2YW9A 3I9KA 3CE6A 4GSKA 4RZIA 4WUVA 5COBA 4CLEA 4XQGA 1I3LA 1C0PA 2VWQA 4KMSA 2Y1FA 5CPFA 4YJGB 3WGTA 4F46A 3VZQA 3WGYA 5L7WA 1LUAA 3RKRA 3TPCA 4F3YA 3T4XA 4DQUA 3MOGA 3JQCA 1DAOA 3DBLB 1UDAA 4FGSA 3WOHA 1NQTA 1ISMA 4J7UA 3VTZA 4HWKA 2A35A 3C7DB 4NJOA 4J2OA 3Q9UA 1UDBA 1BVUA 3RCBA 2P4QA 3JQ8B 4FJ0A 2QZZA 1MB4A 3AFNA 3H5NA 4W9NA 3TZKA 4EJ0A 1P9LA 1ENOA 1U2GA 1Z73A 1NR1A 3E9MA 3GNTA 3K96A 2NVUA 2Z95A 1O5IA 1E1NA 2QRJA 1XA0A 4PLPA 2GN6A 2WD8A 4M49A 1IL0A 3RAJA 1JAXA 5TC4A 3LQFA 2ZCUA 4G2NA 4WLUA 4D42A 1EE9A 1EK6A 4AL4A 4J1SA 4URFA 1JW9B 4TRJA 5G4LA 1GZ3A 4B4UA 4M55A 1TT7A 3LU1A 2ZB3A 4WNCA 1W6UA 3U5TA 3PRJA 3AU9A 1BTOA 1EVYA 1E6UA 3RUCA 2D5AA 3U4DA 1Q0LA 1H9BA 3R0IA 1E6EA 1R37A 5DBIA 3GY0A 1YDEA 1DRUA 4LRSB 1BW9A 3UVEA 3GLQA 3RFXA 4R54A 5IJZA 4QQRA 3GFGA 5C3MA 4YXFA 2RBEA 2FR8A 1E1KA 3IMFA 2NU6A 3AFMA 4KDFA 3DAPA 5ICMA 3RFTA 5CAEA 1JQBA 2VHYA 3X2FA 1T4BA 2O23A 2G17A 1BXZA 4UREA 1I2ZA 4BQPA 4Q9NA 1TVEA 3A06A 2VOJA 2D4AA 3IP1A 1MG0A 5FF9A 4EW6A 1AN9A 1I2BA 2FPGA 3ENNA 5L53A 5LDGA 5L95A 3JYLA 2UDPA 3AWDA 4YWJA 4UVGA 3AY6A 2Y1GA 3ADPA 3O03A 4CV3A 1DSSG 4DA9A 5HWSA 5H82A 3WGOA 4FOOA 4QTZA 4GKBA 4MVJF 3JV7A 2UV8A 4FFOA 3NUGA 4WPGA 4E30A 1KEWA 3NAQA 3GMDA 1PS8A 1X15A 1Y8QA 1Y8RA 2EJWA 3AI1A 3LT2A 3WLFA 4DMLA 1GY8A 1PEDA 1XELA 4YJHA 2J8ZA 3RU9A 3GNSA 4DPKA 4JN6B 4RZHA 4BGVA 2O7QA 2AQKA 1Y1PA 4OAQA 5AYVA 3VZRA 4RJTA 2Y1EA 1XHLA 4NHEA 5T8KA 3LC7O 3NEPX 1V8BA 1GZ4A 1N8KA 1EDZA 1ZEJA 1FK8A 2DPHA 3M1LA 4PIVA 4UEJA 3DMYA 4GL4A 3U9LA 5JAZA 4NNJA 3QVTA 3H4VA 1R0KA 1O94A 4XKJA 3DFZA 4CUJA 1IE3A 4DUPA 1HL3A 1N7GA 5A03A 4BKPA 3VZSA 4BNFA 4YAGA 1LRLA 2DLDA 3ZHBA 2I67A 5IZ4A 1ML3A 1E7MA 1BVRA 3DQPA 1DC4A 1DRWA 5HBRA 5EN4A 1E7QA 5JXWA 4LSWA 3AM4A 4LCEA 4UAGA 3HUDA 2I6TA 2DFDA 4IQ0A 1SC6A 3U62A 3GDGA 4ALIA 4XB1A 1UAGA 1YRLA 4PLCA 5TRTA 3BMCA 1XR3A 2OUIA 3E03A 1EUCA 5T5QA 2GR9A 2NU9A 5FEUA 3MTGA 2V6BA 1VE9A 1V3TA 4II2A 1ZXBA 4ND2A 1I32A 2CNBA 4OOFA 4BMNA 4FJ2A 4IINA 2WWRA 3WIEA 2AEMA 1LDEA 2B37A 4PG4A 5A05A 3I4CA 2FP4A 4CM4B 4NBWA 4JBIA 3BMOA 3D5TA 3GUCA 2B83A 3HFSA 4OSPA 4M8SA 5BR7A 4D3FA 4B4OA 1T4DA 4ZQBA 1JU9A 1HZZA 3RUIA 1N9GB 3GDOA 3PIDA 4AJEA 1IULA 1BWSA 1Q7CA 3P2YA 3AI3A 2HMTA 2PFGA 4PLWA 4QECA 2AE1A 3TJRA 3WR5A 4OMUA 3DMTC 1E1MA 2PKQO 3GA0A 1UXKA 4GH5A 4KWHA 3GDFA 2W2LA 3PHJA 4PCVA 4I9UA 3I3OA 4BO3A 1RYEA 3KSZO 1GDHA 1IB6A 2DBVO 4JCOA 3MTJA 4DLBA 1I30A 2C2YA 1A9YA 3DZGA 3CKYA 3OH8A 3DL2A 3ABIA 3UF0A 4F45A 2NVUB 2DTDA 3BHIA 1WLYA 1DOHA 1W0CA 1Y5MA 5JO0A 4J1NA 1E3EA 3QIVA 3VH2A 3I83A 4U6QA 1PGOA 4I08A 3ROMA 3IKTA 4BO6A 1HDCA 4Q3NA 5L9AA 4Z3DA 2O2YA 1DLJA 3EDMA 5KOIA 3ONFA 1H2BA 1I2CA 2P5YA 2W2LD 3GC6A 3QY9A 1QYXA 2FN7A 3TZCA 1H94A 2ZQZA 3G79A 5DCWA 5T64A 4OO3A 3VDRA 1O0SA 4FW8A 3QA9A 3DHYA 2VWHA 3H5RA 3WWZA 4NDNE 4FJ1A 1SPXA 4PG7A 1Y8XB 4TZKA 5CP8A 4B8ZA 1HYHA 2C5AA 3UCEA 3H2ZA 4FSHA 2OORA 7ADHA 3ROPA 4Z9XA 1U3UA 2JFFA 3JQBC 5CG2A 2B5VA 2B4QA 3MJVA 1N1EA 3BTOA 1PJCA 2YJZA 3QVSA 3ANMA 3OHSX 1C3VA 4HP8A 2DU8A 3PJGA 3V8BA 1UUFA 3UHAA 1GFSA 1DRVA 3ONHA 5EINA 1LRKA 1H9AA 1P0FA 3ITKA 4BNYA 1V3UA 3IS3A 1ZK4A 1JN0A 5T8KC 5JYEA 2LQ7A 2HO5A 4E5PA 1HDZA 2DKNA 2VN8A 5DP1A 3IKVA 3W4JA 3DONA 2YQ4A 3ZDFA 4XRRA 1L7DA 3HDJA 4TVOA 1U4OA 5FI5A 2NQ8A 1TT5A 1EVIA 2BGKA 4A5OA 1TB4A 3A1NA 1NX6A 1TLTA 4Z6KA 1QR6A 3B20A 2X58A 4I9HA 4WCFA 4I1IA 2W4QA 1U5AA 1P1FA 2YY7A 3WJAA 4YJHB 4CLRB 3R6DA 4L76A 1Q7GA 3JCZA 3VPGA 4GVXA 1HYEA 2GPTA 5KTKA 1QV7A 3RASA 3ZU2A 2PGLA 5JC8A 4A26A 4CM5A 4TRNA 2VRBA 1LSJA 5ILOA 1IOLA 2AQIA 1LBEA 4NIMA 4PLVA 3GAZA 4K26A 2OZPA 3GNQA 1P3DA 3A14A 1PJ3A 3X2EA 3V1UA 3OFSA 4OGWA 1Y9EA 1SB9A 1UXIA 1DC5A 3SLKA 5L4LA 3GH3A 3R3SA 3NJ4A 3NRCA 4YACA 2GZ2A 3PQEA 1A27A 4FPXA 3WTCA 4D7AA 5B4TA 2HQ1A 3FNFA 2HDHA 2O50A 4GVLA 4J6FA 1WZEA 1JVBA 5THKA 4S1VA 5THQA 4ZICA 4WE3A 2FR0A 3AM5A 1BMDA 2J5QA 3WLEA 3B1KA 1DPGA 3GVPA 3COSA 3KEOA 3G17A 3QW2A 2GLXA 1EQ2A 2O48X 5AVOA 3H5AA 3WGIA 1DXYA 3BMCB 2UAGA 1K2WA 1B8UA 2ZATA 4YRBA 4CR6A 4RPKA 5DZSA 3M2TA 2V6FA 4WOJA 5CDUA 3MWDB 4GLLA 2Y93A 1W4ZA 1HKUA 2D5CA 4RV9A 4MDHA 1JWBB 2O4CA 3JQAA 3RROA 3QWAA 1T1SA 1PJBA 2HK7A 3AI2A 5GMOA 1QLJA 4D44A 2HMWA 4WK6A 1LI4A 5CDTA 4PZEA 5A06A 2GDZA 4N54A 1HE2A 2GZ3A 3W6UA 2IEDA 4D0SA 1K5HA 3KBOA 3G1UA 3KUXA 1NFQA 2EF1A 5JW6A 2ZB7A 4U7WA 3Q3CA 3ZHYA 2IDZA 2VOEA 1GYQA 1YL5A 4XA8A 4ITUA 3ZWVA 2AG5A 2NV6A 2YDYA 3N74A 4DPMA 1U7HA 3GMSA 1XDWA 4O0LA 2Y66A 3DHEA 3DO5A 3V2GA 2OL4A 2FY8A 4XQCA 1FDVA 4LMPA 1PZHA 3DBRA 1F14A 3W6ZA 3L07A 1YONA 2E37A 4N5MA 3CIFA 1W8DA 4YVFA 1FJHA 3C1TA 1T2AA 1XKQA 4FQ8A 1K89A 1ZK1A 2AE2A 4BO2A 3VHRA 4NK5A 2Z1NA 4J16A 3SLGA 3V1YA 2BMAA 2RH4A 3NGXA 4J1QA 1IPFA 1YS4A 1N2SA 4OXKA 5IG2A 1OOEA 3QV1A 3KZVA 3JD4A 9LDTA 2POQX 4IIVA 4ZGWA 1KVQA 1BG6A 4DYDA 3WXBA 3ZN2A 1ISGA 4WJZA 5CEEA 4WCFC 4DC1A 4ZJUA 1X0XA 4E2ZA 3TSCA 2C7GA 4BNLA 2NUAA 1U5CA 3OQ1A 4EEZA 1ADGA 1GQQA 5TS3A 2Q2QA 1E3WA 3C7AA 3FR8A 1N1GA 2XOXA 1EMDA 2E49A 4J90A 4WCDA 1FDSA 3CPSA 3FTPA 4GWGA 4XYBA 3RVDA 2PLAA
chains in the Genus database with same CATH superfamily
4LF8B 2HSZA 1OI3A 4GPD1 4C4ZA 3U16A 2FXIA 4RA6B 1ZESA 3BXZA 3C3MA 3CS3A 3DL4A 4CNQA 2AC4A 3GMIA 1TT5B 4TS1A 2M2EA 1EA3A 5KHAA 2AOVA 3SICE 3MOIA 2WHEA 3E27A 4TM8A 4UE2A 3ZY3A 4K2EA 3KU1A 4KGDA 2JJ2D 1YTUA 3ZZMA 2JG3A 3V7CA 3VX4A 3UKDA 1XU7A 2IBSA 3IDAA 4PU0A 4K9RA 1SPBS 2GZAA 4BJ5C 3QI2A 4IX7A 2PN6A 1Z8HA 3C3WA 2ECPA 5TXGA 1MBEA 2UXDB 1I2MA 4HAZA 1A82A 4PGAA 2PRZA 2EVWX 2BFFA 3U44B 1DXQA 3B1VA 4G6QA 1YVRA 4QU0A 1LVAA 5ALOA 3JQAB 1G66A 4PVDA 4P2GA 1A2KC 5KC8A 2WYWA 1BHSA 1FYXA 1NOIA 4UCFA 4DHEA 2FZ4A 4XRGA 3U7FB 3PR2B 3TLMA 1VQKI 1A6QA 2OA4A 1WIWA 3SR4A 1CUBA 2JEZA 1E9EA 1C4WA 4LGMA 3O90A 5EC8A 3SKVA 1EJ6A 3I9JA 1M0TA 4RSGA 1JLRA 3UH1A 2ZUWA 4AJIA 5C5DA 4B3XA 2E2JJ 5AI6A 3AKCA 3VFDA 3RUEA 4N3GA 2NN3C 1J5EB 2R7UA 4TVKA 4ZCLA 2HFHA 4OQEA 2E82A 1IAQA 4IKEA 4R05A 3VGPA 4PCLA 4ZCRA 4TTAA 3PFKA 1RKUA 3VHQA 1Q0SA 5EQTA 1NQAO 1NBIA 2A6TA 1SEUA 3IURA 3R24A 3FYDA 3IJPA 4MULA 3SE7A 4DZZA 1E1DA 2OYSA 1UELB 4FOPA 2LOOA 4HKTA 2B2CA 2EKZA 3C48A 2LCFA 2M4GA 3U7QA 2I22A 2RHCA 3L43A 3F78A 5JJKA 3PUYA 2COMA 3U09A 2I54A 1CEXA 3HJAA 4F3KA 4YPOA 3DL0A 4O5AA 3X1KA 3UAXA 2PJPA 5JI2E 1W96A 1JNYA 2OFWA 1OWMA 4AC0A 1F8YA 2O2EA 4LC1A 4AURA 3Q8LA 1OT5A 4F6LA 2WPDD 1ZNXA 4R4JA 4DIKA 3EPJA 3EGDA 5LP6C 3IC5A 1QZ3A 4NDLA 3E7LA 1PJTA 3N3AC 4ENVA 2ZUUA 2BFFB 1NVGA 4RC9A 3CJNA 3M9AA 3CCQI 3UWKA 5TS2A 1IBSA 2J9XB 1MIHA 2XT9A 4MW6A 4NBQA 3C7TA 1J9GA 3WWEA 3V8LA 1KNQA 1A1SA 1M34E 2GRAA 1E2HA 3DZCA 3FOEC 1ZD3A 4A5NA 4ZEVA 4EI2A 2WSSA 5BW5A 2MH9A 1ENZA 1PUJA 4YG2F 2FR1A 3KZKA 3NI2A 4UMDA 1OI2A 5GP9A 2WJIA 4ZT4A 4CKYA 1T9DA 1R9NA 4QDKA 4D56A 2VQED 2WIFA 1SCNE 1QF9A 4D41A 5LA6A 2Z98A 1QQAA 1YFKA 5BWNA 5C1DA 2GTPA 1PD1A 4AO6A 2JUGA 5BSVA 2STWA 2HZDA 3OJFA 3TLKA 2IYNA 1FMJA 3AOEC 1J23A 2H29A 4D9IA 3U7QB 1ICEA 1X14A 1FXWA 1SO8A 2ZK7A 4C5BA 1RZUA 2BEKA 3I04M 4CLDA 4JI5D 4NE9A 3L0DA 4HH1A 2PZGA 4U0JA 1WNTA 5CAEB 2VBIA 3ZQKA 4CM1A 2BZGA 4EABA 1QZXA 5IMBA 2OO7A 2D0OB 1GUAA 3EGDB 4TMWA 4PC7A 1DGRM 4MVJI 3I56I 4H0NA 4CKBA 4JU9A 3PC3A 1MMAA 4FU0A 1OX4B 1PQUA 1EAYA 3CINA 3NTLA 3LLVA 3QK7A 2QTAA 1CYEA 2FWIA 4LDQA 3V8MA 2A9QA 4BECA 5B3KA 1JG6A 5JZBA 4CCNA 3CP2A 1J8DA 2E5NA 4DA7A 1EFAA 3MF4A 4OP3A 3OYIA 4JYPA 3KPVA 5JNSA 1A98A 1TE2A 3AUTA 3IUJA 5CYVA 4A3EJ 3QG5A 3JCUC 3MC1A 1NP6A 5KKCA 2WHXA 1A31A 2OUMA 1F2UA 3JZAA 3WMXA 2F5FA 5BYJA 3A4TA 5KNLA 1PCXA 4L4YA 3WRXA 2V6JA 2CLSA 2GOXB 1JIUA 3F72A 3TN7A 3WSTA 1I3OA 3JVDA 4N3AA 1U9YA 4IRXA 4WINA 4G8JA 4MV0A 4QOGA 1SB8A 1WPXA 2C4HA 1P2DA 4NABA 4GWKA 3FVQA 4OA8A 3K1AA 1X80B 3L7YA 2H8GA 4CEIA 1XTKA 1COWA 2OAGA 5JSKA 3LZ6A 2AWOA 3MMYB 4OK6A 3ZW9A 3BR0A 2V4ZA 2ZM6D 2AI2A 1U6KA 5JCXA 2GGSA 2PMZN 4UE3S 3WXMA 5AW6A 1B26A 3ZK8A 5K9ZA 3L40A 3VPFA 2DY0A 3HBMA 5KWJA 1I13A 3H11A 2JFWA 3PKZA 5JS6A 1R6UA 8MHTA 1GFWA 1N78A 4YAJA 1L5OA 1Q83A 3K10A 3K5WA 2NUPA 1N33D 3NONA 1ORHA 4WDRA 2GN8A 4HWGA 3LPLA 1ILEA 2ZI7A 2EZIA 4CMHA 2F4MB 1R8YA 1YK1A 1Z0ZA 2WDPA 1WUJS 3OZGA 1FCJA 1DIGA 1LFDB 4ZMSA 4QNNA 2K2WA 3QVOA 1FTSA 3RVMA 3FBGA 5JROA 3VNUA 4MKGA 1IN4A 3H2IA 1APLC 3HBNA 2VQSA 3OYAA 1IXRC 4D1QA 2IGNA 1QG0A 2DCEA 1R4ZA 4J0KA 1F2UB 2QTCA 3GWGA 1A4RA 3MHTA 3EDYA 4LV8B 3TEMA 3VTFA 4RJIA 4A8JA 4YUXA 2VYND 2WJAA 4POOA 4JEIA 3ZBQA 3A0HC 4V0LA 1N5OX 1HTWA 1DAMA 2N9UA 3CV3A 1QTQA 4H0CA 3VB2A 4XGNA 2QJOA 1RM3A 2C92A 1RYHA 1C9YA 1P0PA 4PZDA 3NATA 3QE9Y 4KFSA 5CFRA 4F6CA 1Z6QA 2F5VA 4CEIB 4EOGA 4AMVA 4XCQA 2KLHA 3LFHA 5KINB 5CJ9A 3I64A 3N70A 5IAAA 5ADWA 3SDSA 1NXWA 5FL7A 3G1OA 5JFRA 1Z36A 3GFVA 1L4HA 1IDN1 3OE7D 1UZAA 5HF6A 5KVQA 5DM4A 2VPRA 3T54A 3ZYZA 3ZNPA 4O5OA 4EEXA 2CQ7A 2ZJOA 3PENA 1X9IA 3H11B 2G63A 3OYFA 4I1YA 4YP7A 1YIJI 4XCVA 1XMJA 4MYTA 1JIQA 2MYNA 4AVPA 1BDMA 4DCJA 2WHPB 2MIIA 4ZCMA 4JJ7A 3CZPA 4B76A 1GG5A 2ZJ0A 1XLTC 1G5HA 3LX8A 1FT9A 3WQBA 3DJFA 1E92A 3H3ZA 3ISJA 4FMPA 3DLCA 2XUJA 2ELKA 2QXYA 3N58A 4NMMA 4FZ5A 4NAUA 2IYFA 1XRPA 4NOJA 4B0PA 2EXXA 3A4CA 5FAKA 2XF8A 2BL4A 3M82A 2UWMA 1H6BA 5F27A 2JLAA 2JGJA 2C3MA 3AMVA 5CFQA 1Z2NX 3KOWA 1TNDA 3JQ6A 1UHWA 4HG2A 4EBFA 4V0OA 2HT6A 1QG6A 3HSKA 1BXRA 1XG5A 4N41A 3K6GA 2I4NA 4NATA 3QPBA 1PR1A 4AO7A 2AG0A 1M2GA 1KSFX 3BQYA 4N5DA 2UZ3A 4AJ2A 1YGYA 3QY0A 3KKZA 1O0CA 3GAFA 4ND1A 3OTHA 3AL2A 3I0MA 1P6XA 4MYDA 1ZVVA 3ZVNA 1QXSA 3CDHA 2WF9A 1OFTA 1ZUWA 2KJBA 5BUZA 2IZ5A 2CHQA 2QD4A 1BI0A 3GJ8A 3KV1A 1C7QA 4BBSJ 4XONA 1VRVA 2P7IA 1UP7A 1TW2A 1RKQA 2NOJB 1Y4AE 1NSFA 1ST3A 2FEWB 1Z4OA 2EWVA 4G2TA 3FUUA 4YY3D 1B8PA 3FPFA 3T9DA 1LFUP 1ZHOA 1D5CA 3FPCA 1EGMB 3MGAA 3SSMA 5BNIA 5DVZA 5AVTA 3ZZNA 2FPOA 2ZWAA 3MHPA 4V03A 2JA2A 3EXG1 4TYQA 2VWGA 3KVVA 1CWUA 4OH7A 4E88A 4QOEA 1YF3A 1YJCA 4HZFA 4BO8A 3BJOA 3L09A 4HQFA 2NAPA 3MWJA 4KHPB 2XBMA 2UYGA 3CEMA 2D1FA 3B53X 2AFHE 1ZQ1A 1KO1A 4G36A 4EG4A 3K4CA 4YMGA 4IOKA 3BTSA 4KU4A 1M0WA 1N6HA 1YE5A 4BBRJ 4TV8A 3ZIAA 2XF7A 3EDPA 3KP4A 2D1HA 1V5FA 3ZGYA 1EX7A 1DVRA 1BXRB 2XBUA 1QM5A 1VZ3A 3RO7A 1G8AA 2Q9UA 2FSSA 2G06A 3NGMA 5G41A 2O3SA 3M07A 1U1GA 1JBQA 1V4VA 1ZLYA 4Z0PA 4AYBN 4FDMA 5FI3A 4D5CA 3VR5D 5UKDA 4XDGA 5EXXA 5B7PA 4CE6A 5BN4B 1HZZC 4LOJA 1F7VA 1P4HA 3PVSA 5BT8A 1PDVA 3FUWA 1D4FA 2QTHA 1B43A 4R1QA 4UNSA 4BO1A 5TQJA 5DKFA 3RQSA 4IIEA 1FQJA 1U2QA 1I94B 2XCQA 3KQKA 1PL8A 1G3QA 3UB2A 2FX0A 1C7ZA 3KXPA 1KI2A 1L5WA 3D3KA 3DF8A 3W5HA 2A6PA 4GDFA 2V45A 4OSEA 3AB3A 4N01A 5L3QA 1R0YA 2BZTA 4XN3A 4NYJQ 2CYAA 1E3JA 4X92A 3AF4A 3S1QJ 4MCIA 5FWNA 4BFLA 1QV6A 1LRJA 4HMQA 3JRBA 4PCQA 5C4IA 1VCHA 2YHIB 3E6AA 3KJFA 2QZ9A 1VQPI 1ZM3A 4P7FA 1RTKA 4YA6A 1KOGA 3DUWA 3M6WA 3JRDA 4XIJA 2DFTA 1TTQB 5BQPA 2RHMA 4YT2A 2OLKA 3BMXA 1Q1QA 1NJ6A 4TV8B 1YQWA 4RSHA 1PP8F 4Z4FA 1G20E 4L72A 1GU7A 1U7UA 3GLHA 1WLSA 2G8NA 3BH0A 4GECA 3TB6A 2H2FA 2FOIA 4H6VA 4FDTA 4LG0A 3PTZA 3L8YA 3G89A 2FBKA 1SAYA 2AB0A 1GR0A 5B3LA 4LRWA 4JKIA 4A7PA 2PZJA 2ZYVX 5CT8A 2JGIA 1PGQA 1DKMA 2FSPA 3O8GA 1XC7A 4JHXA 1LW7A 1JEDA 3A1WA 5CEFA 1FXUA 2P62A 2L2QA 3WE3A 1ZLXA 1KGSA 4E7KA 4KX5A 1FP7A 1WD5A 1WHTB 2F2EA 1Q0QA 4DKXA 2F1JA 3QEKA 3HG9A 3LZDA 3NT5A 4Z5XA 5J4VA 3PJEA 3B6EA 4INPA 3FPGA 2C5EA 9ATCA 2VJ4A 1T9HA 4X61A 4F0JA 5IT9A 5ENDA 5L3QB 1YR1A 1J5XA 1WVMA 2QL9A 1UDWA 1U0FA 2DUMA 4X1OA 3H65A 1Q19A 2ZQYA 3PUZA 3EETA 2GBGA 4WT7A 3F6VA 4UVCA 1XXLA 1K6XA 1G63A 1OLXA 2WSBA 1FTWA 4PSAA 1I6MA 4KYTA 4FLFA 4L8LA 4N9HA 1CC1S 5DGIA 3ZU6A 3KL4A 4GPIB 4DA4A 2JIBA 4KMSA 2AFRA 4L9AA 3PTAA 3I0TA 1QFXA 1LK0A 3GV0A 1SQFA 1E0AA 3NWPA 4QT4A 3WOHA 5JZMA 1KI4A 1VBKA 5SZJA 4L5EA 5FV7A 2XDAA 2ZO4A 1YNSA 1RAAA 2HS5A 3RAJA 1XNGA 2PSJA 3GLHB 1N7IA 5BWLA 3D6TB 1XTZA 2IIQA 2JA5J 2X2EA 4LG0B 4DNXA 2JLXA 3VDMA 2V97A 1L7MA 5K5OA 3QRFF 4RWEA 3GFQA 1ADJA 3WL7A 1XTIA 1I0LA 3SP1A 3B85A 1Z7LA 3K4NA 4PTYA 3NKVA 5AKHA 2QM3A 3L3BA 1OJLA 2FPGA 2A0WA 3EG9B 3LSGA 2R8YA 1AKNA 1NF3A 1T4CA 4JI2B 3STXA 4E30A 5A5VA 3FM5A 3DP9A 4KDCA 2W2TA 3OZWA 1I7QB 1P2GA 3GEBA 3KSBC 1YT5A 4I8DA 4WKNA 1JQKA 1Q1EA 1WU8A 4F4IA 1L7XA 4LVNA 5JAZA 3G8DA 2FWJA 4AD9A 2ZTHA 1N75A 2EFJA 1R0RE 5JV5A 3H92A 4BKPA 4Q24A 3ZHBA 2KX7A 5BV1A 1QRSA 2IHTA 3L4EA 2DFDA 4HNQA 3Q0WA 1UPUA 2ZEJA 1V3TA 4ND2A 1ZXBA 4PR0A 2CNBA 4BMNA 3OZCA 2C0QA 4OP2A 2BOLA 2LH9A 4UAVA 4BV3A 4JBIA 3QQAA 4LJAA 3EF0A 3E9EA 4B4OA 1JU9A 3PXGA 3V8KA 3RZOJ 5IHPA 1E1MA 2FLWA 1OTYA 3GA0A 1UXKA 3KWLA 4KWCA 2J09A 2D2FA 4C7XA 1K86A 2D5BA 3AUFA 4HV6A 1XMQD 4FETA 1Q3TA 5LWHA 1NVVQ 4ZYAA 2P27A 5D87A 4EGYA 4DLZA 1KQPA 1Y5MA 3R74A 5B3JC 5JO0A 4DW8A 3BQNB 4B3SB 1UT8A 3O9VA 5LLQA 1MNMC 5DASA 5C31A 2GTHA 1H2BA 1D0ZA 5B6IA 2G6BA 4K0RA 2AS0A 4GZLA 3AL0C 4WBSA 2QU8A 1FJGD 2WD9A 1KQ9A 2CW0F 4PG7A 5J1YA 1V43A 4I55A 1N32B 4V2GA 4DV1B 4FCWA 1SHJA 1KR2A 2H6BA 1K78A 3IS3A 2EG5A 2FPGB 5T8KC 4OINF 2K87A 5DP1A 4ZP1A 4AB1A 2XCLA 1T4CB 2NQ8A 2QU7A 5KNDD 4BY1J 1TUGA 4REMA 2VXBA 4KQKA 3RRBA 5IM5A 5LZ8A 2QP9X 3GI1A 4B44A 4E7SA 4DSNA 1LBEA 4R1HA 2VE9A 1H4QA 4PZZA 2G0AA 5FFZA 4MLOA 3HCNA 3O5AA 2YC2C 1GGMA 4FPXA 3E8MA 3LSKA 5C8VA 3RVSA 2FLKA 2FR0A 3WLEA 2IF0A 4A2PA 2X6YA 3S6JA 3OESA 2F9MA 3IBSA 2Z6QA 1TCBA 1NC1A 4ADSG 3EZ2A 4WBNB 1SHTX 3I42A 1G8KA 3M8FA 1G8SA 1YR8A 5DXAA 2ODNA 1X92A 1ONBA 1XN1A 1GFIA 4N54A 4NMXB 4ZAZA 2W00A 1B74A 2GZ3A 5AQEA 1DWUA 1FRVA 3KBOA 3KKLA 3KUXA 3VZDA 2ZB7A 3CDLA 1KFKB 4W1PA 4ZT5A 3LO8A 4CTOA 1TWHJ 1OCPA 4MAAA 3A01B 4CDNA 3ZWVA 1S7EA 4DLKA 2FDCA 1ZG3A 2OORC 3AR3A 1M2JA 1I1HA 5IHXA 3JS5A 5CITA 2RJ3A 2X6QA 3DFMA 2JH9A 4U0VA 1XFAA 1D2MA 2BFNA 5EP3A 3KDPA 3GJ3A 2JK3A 1HA3A 1SXIA 4EJVA 1NW4A 3TUJC 4BO2A 3NH9A 1HF0A 4J16A 2AXPA 4BLWA 1H2YA 3LDAA 2PX0A 1N2SA 4DB4A 3FOWA 2WIKA 3UWMA 2ME0A 1G6NA 2GDJA 3DT9A 4HN4B 1E3TA 2ZRCA 4BVGA 1K5GA 3QV2A 3L79A 1K78B 4EZIA 1JDVA 1YZNA 3ADKA 5M3FJ 3DBIA 3PLRA 4B3JA 2X86A 4YO7A 2KISA 5D85A 4NICA 3CCSI 4KO1S 2RAVA 1MCZA 4ZOCA 5CLLA 3P52A 2FWPA 5LRSA 2HSWA 2C5BA 1PDWA 5GONF 5FUMA 3BERA 4ENKA 2MW8A 4EDFA 2VSYA 3USES 5D7BA 3MB8A 2BRUA 3IUMA 2EK5A 3OVMA 2NZWA 2XPVA 1ECLA 3EOBI 5KNCD 2GPAA 4A2CA 2Q1TA 5AVQA 2QKLB 4C76A 4RS8A 2Y1DA 2NPIA 3CZ4A 3KELA 1XAIA 3UOWA 2OG2A 1G9XA 3E15A 1JPNA 4FMBB 5B2ZA 2C9OA 4FW9A 1FVFA 4MGKR 1BQ4A 1ZH6A 2OOKA 4KDPA 2BY2A 5LB2A 2I8DA 1IATA 4OJKA 2C2WA 1Z4PX 3GVXA 1NOKA 3GHYA 1T0FC 4AJLA 5EIBD 3I4PA 5JSQA 5MN4A 1DNPA 5HLGA 4YLEA 1F5NA 2KJQA 4NF2A 4LQDA 3SJBA 4TV9F 3HL0A 4Y2PA 1BOBA 2W22A 5REQA 4K9NA 4EKGA 4PS0A 2F7SA 4OAOA 4L16A 2CWWA 5TJHA 3DMFA 4A12A 3IP4B 1GXSA 3UA3A 1W5CC 2OBBA 3IH3A 1UC4B 1DO2A 2JHAA 3CUKA 4HLQB 4CUKA 4LYFA 3QFHA 3TPZA 3GTPJ 2VNKA 2RONA 2PGJA 4CQMD 2C03A 3EJWA 1E62A 3ER6A 2CK3A 5CB4A 2HJHA 1RM0A 4BUPA 2DOEA 3VYWA 4F9EA 1SVUA 5BUCA 2H7CA 1R10A 2GBCA 3UCFA 4G1VA 1ZQ9A 2Y9PB 3LFTA 2FG7C 3BBLA 3BM5A 2Y69H 3IELA 1LZKA 1J9IA 3U3KA 1NXXA 3WBBA 4U0YA 4U9IS 3WAKA 4UXHA 2RQPA 3HY4A 2RH9B 5FLEX 5DM60 4QQNA 3MB5A 1JHDA 1TI7A 3QYAA 4JU8A 2RC4A 1IY8A 4ICIA 1EKEA 3MJSA 3KRTA 3CU5A 3K73O 3NIGB 1NW3A 4LA4A 3TI9A 4ENRA 1QF6A 1AQ6A 2CXQA 3OQMA 1S2IA 1FMFA 1Y81A 1PK8A 3P32A 5CXSA 1S7GA 3WGMA 1RYFA 2O14A 3BWXA 2GJ8A 2D54A 1DUVG 5LYJA 3NEUA 5SY6A 3IAUA 2PM8A 1TVMA 3X1XA 5FROA 3ZX4A 4X3CA 1MG5A 1L7RA 3R7NA 5FRDA 1UK7A 1V3VA 2L02A 1XU4A 1BIBA 2EFOA 1W9HA 1S8NA 4F72A 3OUTA 5REQB 3T61A 4XQFA 3VVCA 3C6YA 2AZDA 1GXSB 2EP8A 1EINA 1CUIA 1TC3C 2NNLD 3VYTB 3E23A 1CZKA 1S8AA 3K30A 5KVCA 3H2SA 2J3KA 3DMPA 4G4IA 2IXAA 3CB2A 3T5GA 1QPZA 3I62A 2IHZA 5TNXA 1XP8A 1PL0A 3QUBA 3ZX5A 4AJ9A 1BX0A 2ZVQX 4B7XA 3AP1A 2IE8A 4AIRA 2WM3A 5BSEA 4OMCA 5SYMA 4QU9A 3C0KA 3CTAA 2BLNA 1TPZA 2AXEA 1CJTC 2XI4A 1V1MA 3ORFA 1DL5A 2VSFA 1H23A 3B82A 5AXBA 4KHZA 2X0LA 3I9V2 4B73A 2J3EA 2ZVPX 2VVTA 1X9HA 3AR9A 4ALKA 5FQOA 3FNIA 2BCEA 1Y1RA 5FJJA 3GLIE 4DB2A 2DPGA 1XO1A 2CVQA 3SC2A 3YASA 5JH7A 4DQDA 3PFFA 2RAEA 3CCYA 3CX7A 3UJNA 2YTZA 4URZR 2L2OA 3ULKA 4H4DA 3CGGA 1P9KA 2HMYB 3GL9A 1SFKA 4IQ8A 1A97A 1NXSA 1HA8A 1HW2A 1PR5A 3OE5A 1T6XA 4L0CA 1A7AA 2K85A 4LISA 2IYXA 4Q3CA 3UATA 2FTKE 3DMRA 1CK4A 4RJJA 4TYPA 4A0ZA 4ZMBA 4GLOA 2HRRA 1QHFA 2P9FA 4CLXA 1GKKA 3GN1A 3BC8A 1FBTA 4P4LA 4YI5A 4LDRA 2HOSA 2Z9DA 3K4PA 5IZCA 4FYMA 4ZVSA 1SC3A 3ZPLA 2VIXA 4IVRA 1T8IA 4IG9A 5JS8A 1V6AA 3N7AA 1MFZA 2KW5A 1F51E 1A7JA 5HPYB 1HE3A 3ZE8A 4IX9A 4WZZA 3SQNA 4F93B 3PFWO 2QYHA 3G9TA 3LIIA 1MENA 3I0NA 1DBWA 2HPVA 1KA8A 3OKCA 1EZ4A 3O1JC 1FFSA 1NRXA 5AK4A 4YR7A 2OXRA 3VOEA 2JPDA 4WSOA 3K6SA 3GR6A 2RI6A 4QUBA 3DSRA 5FA5A 4B3MB 2P6UA 2G9ZA 2X19A 5M5BA 3G6KA 2LDBA 1PGPA 2PSDA 1QO9A 4LGTA 4MUHA 3WHBA 1OI7A 3OJXA 1CIPA 3IOBA 3RKUA 4B4WA 4QTRA 1E1LA 4B74A 3B1ZA 4IIBA 1E2XA 1GARA 3VR3A 5KCMA 3O3NB 2HGZA 3NT4A 4F92B 3LUDA 1MC8A 4WOCA 1NQUA 3E9YA 2C58A 3QBVA 5IDVA 3KQLA 4KXLA 4L0QA 5B1YA 3JVEA 4MW2A 2GZMA 2J48A 1TVCA 3E9RA 4IUBS 3TRKA 3SC2B 3DKRA 1OLUA 5JH7B 1BBYA 2VBXA 1NW5A 2BM0A 5HDQA 4JJAA 4O8ZA 2R00A 4P1ZA 2V74B 4DIBA 3FZQA 4DRXA 5GV7A 5K09A 4FDUA 3GTOJ 5FV4A 2ZJ3A 4RGBA 4KR0A 1WP4A 5HM8A 3HVJA 3MTQA 4JNKA 2WE7A 1USUA 3ITDA 3RF6A 3IPAA 5CNJA 1U8ZA 4IVPA 3EWIA 4IQ4A 2NYAA 4PYIA 1Y1KE 2KIMA 2B4KA 1ISPA 3M6FA 4CZCA 5FFMA 1QVVA 1T9GS 1C30A 4Z99A 2J3DA 1VMDA 3ZQ6A 1EA5A 2QM0A 4AMBA 1OYYA 4V1CB 4L3OA 1Q22A 4NC9A 2HOEA 3SCZA 3IO3A 5CYOA 2FXAA 1DEXA 1G5PA 1EI9A 3PX2A 3KT6A 3IALA 3V7FA 2QKMB 1KHTA 3LYUA 4BASA 2DA7A 1M74A 4EPXA 5C8XA 3T1VA 3WNVA 1KO8A 2I78A 3K6SB 2HBQA 4OL0A 5BPIA 5EEHA 4X64D 4M72A 3F6BX 1M5RA 1Z28A 4IJ5A 2XF2A 4S24A 2PO5A 2X9VA 2ILVA 4QOFA 4OQZA 2W6JA 1RHJA 3IPYA 5T7BA 2R44A 4KUHA 4OHOA 4UTNA 4V38A 4OL9A 4UTOA 5JR3A 3ZHCA 4J0GA 4DR7D 3IBCA 4HX5A 4W5QA 3M83A 3V4ZA 4EI9A 3OQNA 4B3AA 3UMFA 4LVOA 4LJ8A 4C30A 1QOZA 3G8CA 1Z83A 1NM5A 4FQGA 3KR2A 3LA8A 1OLUB 1GNPA 3HZJA 2HOAA 1B9NA 1L7AA 3D6UA 3LVFO 3E7PA 2ST1A 3CTMA 4PN7A 2IVFA 2YL2A 2EWNA 1NXTA 4JP5A 1CY2A 1KFBB 3L9FA 2P9HA 3PL8A 1A5TA 2K4JA 4DRXB 5GJBA 1IUNA 2Z58A 1ZP6A 2ZRDA 4OTZA 3C6MA 1LPNA 3IEXA 1XMOD 1FRFS 1Z7UA 4H1TA 3EIHA 4GPEA 4URUR 4Y6PA 2IXDA 4QEDA 2CF5A 1Y1TA 3EVBA 4M4SA 3CCMI 3L9WA 2ESHA 3HSSA 4MVJA 2Q4OA 2ZU0C 1NK3P 1KKLA 1C30B 1I4DD 4Q01A 1OXVA 4YASA 3VAAA 1VQ1A 2YVAA 4M98A 2E0IA 4F85A 4EY8A 1ZVQA 2ZAMA 2BZSA 3BG7A 3PFNA 3W3AA 5HCNA 3HUUA 2IXBA 1I5OA 4MDYA 5E4JA 5LQDA 2XPWA 4DUYB 1ID8A 1PR9A 3PU6A 2C29D 4CCMA 4HRVA 4I81A 1NHAA 4XLNF 4P4NA 4O2BB 4HVTA 4ZOBA 3D1LA 2FUNB 2VZ9A 1T3GA 3EAQA 2IELA 3M1EA 3E61A 2PUBA 1UFVA 2WV7A 5DB4A 1D6MA 2RSLA 3LXXA 3H9EO 1GTMA 4RACA 3SC4A 3SZ3A 2MCFA 4EO9A 4UZEA 4BE7B 4HSGA 5LA6F 3AHDA 3O8OA 2IPOA 4R9SA 4K81B 4PZCA 4JT2A 3EUWA 3F6PA 4FP9A 3HY3A 4EKNB 3K9FC 2UUCB 1PTJA 4F97A 2LF8A 1QVAA 1T8RA 2CY0A 2R5YA 3DB2A 3QLUA 1KY2A 1W46A 3QSGA 3VPHA 2DYSH 2X41A 3INNA 4H4KC 2FPPA 1I39A 1FXWF 2I2DA 3BIJA 3ETJA 2ZXJA 4NP6A 4AN4A 5AW7A 4LF6B 4NCAA 3GJYA 4DTIA 3K5PA 1KF0A 1OMOA 3X0DA 2O1EA 3N5KA 3KALA 1IC8A 3BYZA 1EFTA 1XCVA 4PDKA 4D9BA 4BHTA 4XZ3A 3ZCXA 4BQSA 3F8FA 3OV8A 5BOXA 2GJAA 2CL5A 4JSRA 4ZC3A 3OQBA 4GXRA 2W6CX 5F1KA 3I4MJ 4RA6A 4MZXA 1O58A 4F9TA 3C39A 4WK4B 1HE1C 1TAUA 5D6EA 1QDUA 1HKTA 1OGIA 3IUEA 5EI5A 4EY4A 1L5LA 1QRYA 5BV7A 1AC5A 3FCXA 1RLIA 4PAOA 3ADBA 1ZVMA 3I9OA 4BHCA 1WZUA 3P5JA 3QJ5A 2VBWA 1SZPA 1UBGA 4EGJA 2Y0EA 3K7EA 4IYJA 1MO2A 3CUSA 5JZ9A 2L19A 1RZ4A 2ZT7A 2B20A 4YFXF 3FOAA 4ZREA 1M8GA 4RS3A 4TQGA 2NNYA 4GPAA 1EVJA 5LU9A 4JV5B 1WU7A 3CJQA 4TLCA 4GKKB 1CUWA 1H0KA 4G6TB 5C7OO 3AHHA 1AB5A 3MUEA 4JL5A 5E17F 3ZD6A 3U44A 1M66A 3LCCA 3RUFA 3RSHA 3LLMA 1MAUA 5EKTA 1PG0A 1OHHD 5HOOA 4PPNA 2C1ZA 1E5LA 4IO9F 4UVHA 4E7JA 2ZI6A 3O8OB 4L4SA 2P9BA 3FNBA 1IG3A 3HTXA 3OZXA 1ZIPA 3VU8A 3TMYA 4MQUA 1VP9A 4N7JA 4FYIA 2LY1A 5AI9A 2WAAA 3EYAA 1ZKGA 2X0NA 5LDHA 3D54D 3GT0A 2R5YB 5KKNB 4CV0A 4LHWA 2XE8A 3EY4A 2FX2A 2WMDA 4JI4B 1H9TA 1JP7A 4UNOA 2ZBVA 2FPPB 4DS3A 2BSQA 4MHTA 4G7HF 1E69A 3PNMA 3CEPB 4H7KA 1D0XA 2VHXA 4LJSA 4I09A 1NG6A 1BR4A 3IT1A 1TQIA 1WVIA 1QIMA 4HV5A 3GTLJ 1VZ0A 4NG5A 1X7YA 4BLRA 2ONZA 4YRMA 1SBNE 4G67A 4E94A 1GEGA 1P1IA 5F1PA 3OM9A 4JB0A 2OMKA 4WASA 1ABFA 3RI3A 4OHRA 1HOXA 2XA2A 4ZT7A 2HWUA 1AUOA 4B3HA 1LDMA 1C0LA 2PXHA 3R8CA 1YXMA 3EOAI 2QVZX 4N49A 4XX0A 4JX5A 3S17J 1JIVA 1LQ2A 2DMRA 1M8JA 2X0IA 3PSFA 4JX4A 3UWDA 4B35A 1E3DA 4P33A 4FGZA 3S2FA 5E4FA 5FWAA 1RCFA 2GHRA 2V55B 3CBQA 5DLQC 3QTTA 3QFTA 2IW1A 1IRFA 3DE2X 4X6YA 4RDCA 3RHFA 1E66A 3CJQB 3VR0A 2RC5A 1Q0PA 1RPZA 3Q5FA 4YAKA 2WU4A 1ZGCA 1RFLA 3DT8A 4MOWA 4FNGA 4C05A 4FKBA 1DJPA 4GE0A 3FE2A 4AULA 1PDNC 1GNSA 4V1CI 1U3TA 1H6DA 3TLYA 3ERCA 3ODGA 1NG1A 4TPKA 4HYTA 4B79A 2C7RA 3K2ZA 4BEWA 4DJDC 3DU6A 3AVVA 1UZMA 5DISB 9LDBA 1Z18A 5AI4A 3GGOA 2COBA 3NASA 4RHFA 4XRSA 4AY6A 2YFKA 2BGLA 3WI7A 3N8HA 2W25A 4EG3A 2OO3A 1D1TA 2XV1A 2XKKA 3EVCA 4ZTFA 2HJRA 5EGSA 1RKVA 3K35A 1PW7A 2R3SA 4TROA 2QMQA 1OWLA 2CKDA 4MIMA 5SZKB 2IYVA 1RAIA 4G94A 3ZYCA 4LXUA 5BRNA 4TM7A 3BTVA 3HEAA 3OJWA 3VOBA 1MF7A 4B45A 2XZOA 1TYCA 3RKRA 3DMHA 4DV7D 3DD1A 1X7YB 2B63J 1ODKA 2WF7A 4DCTA 3VTZA 5BNWA 3IPCA 1TYBE 3I2YX 1IOVA 4DV5B 2ORED 3H5NA 3BE8A 3IGFA 3AZQA 1NR1A 4OAYA 3MD9A 1W30A 3TW8B 2CSOA 2IYSA 1NDUA 4C7BA 3ZE2B 4C2AA 4XX0B 3RRFA 3GMEA 3GY0A 3H36A 1EK1A 3V8QA 1Z8NA 4EPTA 5E2IA 4ZCIA 5EIBC 1GL7A 4YGXB 2FW0A 1N5LA 3D3NA 2FR8A 3AFMA 2H11A 3NUQA 4XLPF 4PBRA 5ICMA 4LY9A 4IHVA 5CAEA 2I4TA 2O7OA 4GC5A 3JPWA 4GQBA 4M1ZA 1MG0A 4JB8A 1PG5A 3ENNA 1TZBA 2FN8A 1JXOA 3JYLA 3RFFA 3AWDA 2WUVA 2Y1GA 5DHPA 1DSSG 3RVNA 5HRCA 4DLYA 2WHQA 4K1XA 1X15A 1TRKA 1PEDA 1NRWA 4UHTA 4YQFA 1S7AA 1OX4A 3T0IA 3O95A 1FK8A 2VDLB 3QVTA 2JJ1D 3DC7A 1XA3A 2VKQA 1HL3A 3QKSB 5DX8A 1A8PA 4YAGA 1P9RA 2XT0A 1E94E 1BVRA 4DIDA 1XGMA 1N1DA 3CZ5A 1E5DA 2P5SA 2NZVG 4H17A 4MPRA 3MLAA 5FOWA 5PGMA 3O3CA 2QOEA 2O5EA 3FXUA 3V4LA 2OV8A 4JENA 4D3FA 3ESRA 3OLQA 3GDOA 1QHHD 2VYCA 2ZAOA 1ND6A 2BGWA 5CW2A 4AQDA 3HJHA 3T0FA 3IA2A 3P9RA 5BN5A 5C2JB 5CCEA 3WMRA 1F4PA 4IZZA 1IB6A 1RRCA 3MWFA 2V98A 2X42A 5M7EA 1X80A 3BHIA 2BEVA 1E3EA 1FYLA 1A77A 1S7OA 1PGOA 3ROMA 4UZSA 4QWMA 2CL6X 1DLJA 5FORA 3ELUA 5KOIA 3ONFA 4XKWA 5EIWA 4I0WB 4UTVA 4XI9A 2N46A 1I7SB 4TZKA 3P0FA 3MT0A 2QF7A 3IJ5A 4G5GA 5ULLA 3N86A 4QTTB 1OV6A 3NHRA 3MJVA 1SXPA 1PK7A 4JX9A 2PKWA 3UHAA 1BYIA 2YRFA 4GF5A 1J2EA 4E5PA 2YZ2A 3IKVA 2C98A 1WPGA 4CF5A 4NCHA 3RYPA 4W5RA 4EFKA 3SQMA 2O2HA 2XUGA 4R31A 4LWPA 1DXOA 3L0ZA 2YZNA 2A9JA 4X65D 2GLUA 2B1JA 4QDUA 1LSJA 1OXUA 2AQIA 3C3DA 1EXWA 1F60A 3A14A 1SB9A 1DC5A 4BEHB 4LGYA 3P2EA 2PCLA 3R3SA 4Q1CA 2H8KA 4G24A 5B4TA 4D7AA 4M6XA 1AB6A 3TOAA 3HU3A 3UJ3X 2ZMEA 5JLXA 3GVPA 4HLUA 1GQRA 2GLXA 1NUSA 2HMAA 1ZN8A 1LK5A 4AF8A 1DXYA 4I1SA 3EPZA 1GGHA 2H3HA 2VBFA 4U2FA 5J2TB 1YMVA 1J0CA 3PQJA 2O9JA 3C6KA 3DWIA 1U1CA 4KN7X 5FL3A 4L0ZB 3TXYA 1X19A 4N0PA 5CA1A 5BN5B 2YW2A 2VP5A 4XKBA 1XEWX 3Q3CA 4P7KA 4N7MA 4D3ZA 2BEVB 3PS9A 2FY8A 2E37A 2R1UA 3L6CA 3P97A 2QCOA 4WERA 1XKQA 4FQ8A 4B40A 3FKIJ 2HTFA 3VZCA 3NGXA 4C0QC 1VKJA 4W5HA 2YZMA 2DHDA 3KZVA 1H22A 1SHZA 5JEDA 3P4YA 2DP4E 4XGQA 1ISGA 2OQ2A 2QPAA 3OQ1A 4EEZA 2IX3A 2EC5A 3FR8A 1GT0C 5EJ9A 2PEXA 2R25B 1XIVA 5IDWA 4F4JA 3OE1A 3M8JA 1IYZA 1WKBA 2QRZA 2WHPA 5CB0A 2QN7A 1B6SA 4NY1A 1ZCJA 4H60A 4EB8A 4PSUA 3OZIA 2I7XA 2P9TA 2JA7J 2PZMA 1JU4A 3QOXA 2ZCVA 3DTIA 4P4UA 2YR0A 2Q3CA 3OZFA 5TEVA 1FFHA 1T10A 1T1EA 4M9QA 1B93A 2G9WA 4FT2A 1ZICA 3VJRA 1KQGA 3H13A 3NBAA 3BY6A 4E22A 3VA7A 2DBRA 4IRIA 1FY2A 1E2JA 3L92A 2ZMEB 2ISCA 3OYLA 3GN2A 3P9YA 4RCVA 3SS9X 4KQFA 2Q46A 3HKCA 4ZQEA 2R6DA 1RCUA 5HS4A 3M5CA 3LKBA 1G9TA 2ZE8A 4PZYA 1EFHA 5LFAA 3QOFA 5CA1B 3HLYA 2GD2A 1NXOA 3PHBE 1UB9A 1OROA 2ZR0A 3FOFC 5E20A 4QREA 3T4EA 1LVKA 5FWYA 1SCKA 4EBBA 3NWEA 2HQNA 2ZE7A 3SHVA 3TW7A 2ZZNA 3MW8A 1SNYA 3OWOA 4J0EA 4CJXA 2CKMA 4C3HJ 5K6TA 3UK6A 3STTA 5IN5A 1MXFA 2H92A 3PC4A 3KLOA 5A3QA 2HJSA 5ALTA 4HT3B 1ISHA 2H48A 2YVLA 1MGTA 1DO8A 2ZFWA 4JOMA 3FX3A 3ENZA 2VC0A 1XEXB 5JRZA 1N2EA 4IEEA 2FDRA 3ZUPA 5CT6A 2OHJA 1PFWA 4NX2A 4CCAA 3CLKA 2JASA 4P38A 1R9JA 3DMTA 1M2WA 5G3ZA 1WHSA 5L3GA 3SIWA 3O4HA 5H9VA 1PVEA 4W1SA 1TM4E 2C8KA 1GQYA 3JQ9C 3CA8A 3P9QA 4A82A 5FFXA 3LKVA 3A04A 4LMBA 1LDGA 1R5OA 2P91A 4DMHA 1E77A 4QGBA 5K3OA 1MZBA 3CX8A 3BWGA 2FG6C 4QQ8A 3ROEA 2G7ZA 1JHYA 1H3NA 5TF4A 4LITA 1B0UA 1CD5A 2HRCA 4B3RB 3HKCB 1QTRA 4Q6BA 1N2XA 4QELA 2WP8J 4ZRDA 2EH3A 2WLTA 3HYIA 2DT6A 2OHHA 3QBJA 1JG3A 1J0XO 2YIDA 4UCWA 2GVNA 4UBIA 1C9NA 4X66B 1EH7A 3OZAA 2VZ8A 2AXNA 1I7NA 2GN0A 2IUYA 4BGEA 2V03A 1IN5A 4MO2A 3TNFA 1M33A 5FWYB 1SKQA 2AN1A 1R0XA 5BN4A 2NZ8A 1OC2A 1SKBA 4OGGA 2O61A 5F33A 1L9KA 4GI1A 4IHTA 4UQLA 1A9ZA 4I3HA 5EHGA 4KQJA 3AW9A 4UOEA 3WYAA 1T2NA 4DVJA 3FNHA 2ZS8A 3QPUA 1UJBA 1DCMA 3HB1A 3OMYA 3H0DA