3KYDB

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
545
structure length
477
Chain Sequence
SRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQDQQVLDVKSYARLFSKSIETLRVHLAEKDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords SUMO-activating enzyme subunit 1
total genus 120
structure length 477
sequence length 545
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
B PF14732 UAE_UbL Ubiquitin/SUMO-activating enzyme ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.520 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ubiquitin activating enzymes (Uba3). Chain: B, domain 2 3kydB02
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 3kydB03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kydB01
1F06A 1MB4A 5CDTA 3PXXA 1WMAA 5KWEA 1DRWA 1LBEA 5L4LA 5B4VA 4R3NA 4MVJI 1GTMA 3S2GA 5IFLA 1QP8A 4ID9A 4II2A 4OYRA 2W4QA 3NGXA 1DC6A 1I2CA 3OJLA 1HDYA 4D0SA 4RCVA 1BVUA 3CIFA 1YJ8A 2HDHA 1LDBA 2FR8A 4RO0A 4BNJA 1IZ0A 3UCFA 1GQ2A 2OHXA 4KQWA 1U8XX 4R1SA 2GF2A 5FI5A 1DAPA 3NKLA 2EWMA 2AEMA 4Y67A 3FNGA 2FP4A 4J1TA 5U9CA 1HF3A 3VDRA 3L77A 1M6WA 1EVJA 3E8XA 2WM3A 4ZQGA 4A26A 3C1AA 5IXSA 2CNBA 5L4NA 2OOSA 1ISJA 1TI7A 1U1IA 4MVJH 2GZ1A 3I23A 4BNYA 2VYVD 1Y8QB 4FJ1A 3IKTA 3IC5A 1GZ3A 2A92A 3DTTA 5BNTA 2EKQA 5DCUA 3D7LA 3PHLA 4PG7A 4YJGA 1ZK2A 1D7OA 1VL6A 1OAAA 4I1IA 1AE1A 4KUGA 4NJMA 3WR5A 4PN3A 5KJ6A 1I3KA 4J43A 1ZEJA 3FTNA 3K30A 1LLCA 1I10A 3E82A 3GVIA 3HZZA 2QRLA 4TKLA 3PZBA 3I6IA 2WYWA 5F1KA 3FWNA 1VSUA 1WPQA 2FOIA 2OUIA 3ZWBA 4DTIA 3W8EA 3Q11A 3MCVA 5ILOA 1LC3A 2VCYA 4AJJA 1Y8RB 3G3EA 4LVUA 2B4RO 4RF5A 2BKAA 3FSRA 4NK4A 5HTOA 3K5PA 5LCXA 1VC2A 5A9SB 5JS6A 1T24A 1CJCA 1WXDA 3GG2A 1I0ZA 3DFZA 2JHFA 4IQGA 4PLFA 5L3ZA 2CSUA 3ZCXA 1A4UA 5KVVA 3DMTA 4U6SA 4DRYA 4WEQA 2Z95A 1OMOA 1DHRA 2FSVA 1NAHA 2IZZA 4YVFA 2Q4BA 4BKRA 5JAIA 1C0KA 4ZJUA 1C0IA 3Q2IA 3TL2A 3AW9A 3ZWCA 3U4IA 4U7WA 5CEFA 1UAGA 3I5MA 1MG0A 3GG9A 5A9TA 4CR7A 4XR9A 4YJHB 3DOJA 4DBZA 4NFHA 4CQLB 3Q0EA 1V8BA 2Y0CA 1MFPA 1EK5A 4AJLA 4RF4A 3SC4A 2HUNA 2P4HX 4XB2A 3S8MA 5IAAA 1B8UA 3LT0A 4K1LA 3BA1A 5CP8A 3ZN2A 5GZ1A 3BIOA 3CMCO 1C1XA 3JQEA 4KOAA 4XQGA 3V1UA 1MXHA 1DDOA 1PJQA 3F6YA 1NBOA 3FPLA 3H9JA 4DQXA 4LRTB 1YO6A 4CV3A 3OF2A 1QSGA 2NACA 4DLBA 9LDBA 4WLOA 3RUDA 4IIVA 1PJ4A 2HCTA 2YJZA 1ISGA 3RI3A 4OKIA 3COSA 2ET6A 4CQMB 2R00A 5IDYA 4FB5A 1LRKA 1H6AA 3OA2A 3VVCA 4S3MA 3RCBA 3V8BA 5JY1A 1R0KA 4FFMA 1XLTA 4J90A 3NJ4A 4BO6A 1Z7BA 4AJHA 4UULA 3RFXA 4J9VA 4DMLA 4HX5A 2J3JA 4YCAA 1KERA 4I5DA 4GGPA 2IXAA 5JYDA 3E9QA 4F6CA 5JYEA 1HXHA 1YJQA 2UUOA 3NRCA 1YQGA 2Y05A 3LU1A 1FJHA 1QG6A 2VWPA 1LU9A 4CM7A 4M49A 2XAAA 1XCBA 4BO0A 4D3SA 3DZGA 2IRWA 1A5ZA 1SC6A 2O3JA 3JQGA 3S2FA 3ZU3A 1R4NB 4KDFA 4NU6A 1Q2XA 1U3TA 4YPOA 4FOOA 2DU8A 3GNSA 3VKVA 4NH4A 3ZHYA 2WYUA 1KVUA 4IPTA 3DZFA 2ZJ1A 3FR7A 3WTCA 3BXXA 1PWXA 4PLHA 1T1RA 3O4RA 1N1EA 3HB5X 3C7AA 5ER9A 1C0PA 2J3HA 3PYLA 3Q2KA 3DZKA 1YRLA 2YFHA 3LT1A 3ROQA 3TDKA 5B12A 3HUDA 3JD4A 1NFFA 2GERA 3A1NA 3DR3A 4HBGA 2E6UX 3CMMA 3QSGA 4YJGB 5JC1A 2CY0A 3C85A 3P7MA 4CMGA 5L95A 1TT7A 4N5MA 1EQ2A 4DPLA 4E30A 2X1HA 1C14A 2JCXA 4Z9XA 4NQZA 4FFPA 1DRVA 3ZHBA 3PWSA 2VNSA 3AY3A 3DOCA 1ZZEA 3RASA 3VPHA 2EHDA 3C24A 1PZEA 5EINA 4BUCA 1DO8A 1R16A 4F3YA 1UXJA 3L4BC 4CLEA 5KIAA 3LT2A 5ENVA 3FD8A 3P19A 3VAZA 3FBGA 3BHIA 3RFVA 2VHYA 4YT8A 4CM9D 4O5OA 4B4WA 3KB6A 1VL0A 1OOEA 2VOJA 4BMNA 3ZI0A 1K6XA 1DIHA 4OMUA 4BNIA 4AJPA 2JHGA 3CKYA 1F12A 5CHEA 4A27A 3M6IA 1NWCA 1O6ZA 4CUKA 3ZU5A 1O5IA 3K6JA 1P1RA 5THKA 4GLOA 2QRKA 1A27A 3SC6A 1BDMA 3E48A 4NU5A 3TZ6A 5ICMA 3VTFA 1GADO 5CAEA 1UAYA 1LLQA 4FFLA 2JL1A 4QTZA 4RVGA 3TZHA 4IQ8A 4DVJA 5AXAA 3AY6A 3NDJA 3MJSA 2JAHA 4D44A 1P0FA 1H9AA 2R6JA 3ZNNA 4DC1A 5A03A 1BXGA 1PU2A 3EVNA 1A71A 4XIJA 5GY7A 2Q50A 5A3JA 2CDCA 3WNVA 3I9MA 4GL4A 3CUKA 4B7XA 4XKJA 2P91A 4RZHA 3AUAA 1E3EA 1Q0QA 3GN1A 3K92A 7ADHA 3WFJA 2WD8A 4YBZA 5EPOA 1JKIA 1WVGA 5BSEA 3HFSA 3L0DA 1MXFA 3AWDA 5TJHA 4FJ0A 1VM6A 4NJOA 4WOKA 4I5GA 1XQ6A 3PHHA 2ZYDA 3DMYA 4XGNA 3GZ4A 1ULSA 4W82A 1E77A 1ZXBA 1K5HA 3OA0A 2GDZA 1TVEA 2UAGA 5HBRA 1E3LA 4ALIA 4XB1A 1M66A 5CPFA 1YS4A 1JAYA 2YQ4A 2GNAA 2G0TA 3H4VA 4R69A 4ONEA 1N92A 2VHZA 3R3SA 4HP8A 3UICA 4E21A 1EVIA 4WK6A 4MPDA 1YBVA 2FPPA 1LLDA 8LDHA 3WQRA 4J1SA 4BKPA 2HSDA 4YJHA 4H3VA 1QYWA 5F3RA 1VLLA 5JAZA 3JQGB 3O26A 3LC7O 3PYMA 4CMHA 3BMNA 3EGOA 4UUPA 4JP3A 3QP9A 3Q9NA 4TRJA 3JQ8A 3ZW9A 2H6EA 2DT5A 4CM8B 2X7HA 4BO4A 3GY0A 5JNLA 1IOLA 4Q3AA 5BSHA 2GN4A 3G17A 1U5CA 5U1PA 1K6JA 2DAPA 2NUAA 1IZ9A 1ZK3A 3OFSA 2B0JA 2AA3A 3ZV3A 3LC2O 3PPIA 4K28A 2WDZA 5IDXA 1P77A 2Y1EA 3BTOA 2AW5A 4IJUA 2VUTA 2ZCUA 3ETEA 3GOHA 1TLTA 1PJSA 1YQXA 3EZLA 1DFHA 4NBWA 4QFDA 2NVBA 2J5QA 2E4AA 5TSDA 2HLPA 2CF6A 4CQMA 1EEHA 4EW6A 3HHPA 2CVZA 2SCUA 4LGVA 4XA8A 3C1TA 3QQPA 2HK7A 4KTTE 4DL9A 1YH3A 1B15A 1PGOA 3F3SA 4IQ0A 3WGIA 1PJTA 4FN4A 5CG2A 5A02A 3RFTA 4HADA 3PFWO 4WCDA 3BTSA 1X15A 4PVDA 4QFCA 2NQTA 1U9JA 4XQCA 2EP5A 1ZJZA 4DGSA 3LLVA 3PTZA 1J6UA 4XGIA 2Z1NA 3QVTA 5L7WA 3PJFA 1GUZA 3AU9A 4GMFA 4INAA 5KJ1A 3EZYA 3DHYA 5CFZA 3O03A 4TROA 2D2IA 2P2SA 3QA9A 4M87A 3ZGYA 1YL7A 1JA9A 2JD1A 3CPSA 3GFBA 4CM8A 3DBLB 1KEVA 2DPGA 4ND1A 4D79A 3D3EA 4ZA2A 1KIFA 1HYEA 3QW2A 1M75A 1J0XO 2O7SA 1RM3A 3RUHA 4CL8A 4IMRA 4G2NA 1BW9A 4RF3A 2HO5A 2IE0A 1VSVA 4XJSA 3JQFC 4ZQEA 3JQFA 3GK3A 5EIOA 3GQVA 3WG9A 1LSJA 1Z73A 2PD6A 1H6BA 5JXWA 4M86A 3DFUA 1UXGA 1ARZA 1CYDA 1YDEA 1NQAO 5T5QA 2DFVA 1J4AA 1WDLA 1Y8RA 2RBEA 3DBRA 5C37A 3R0IA 1P45A 1ZMTA 2HU2A 2A35A 3FTPA 3M2PA 3F47A 4GKBA 1CEQA 2VZ8A 4PRKA 1X7HA 3FR8A 3H6KA 3I9LA 3NX4A 3O38A 3I3OA 1LDEA 2X86A 2NNLD 3BMOA 5G4LA 3UW3A 4IDAA 1C3VA 3PJGA 1HE3A 2A4KA 5L7YA 1R66A 4OXYA 5KJFA 1GV1A 4FC6A 3BMNB 3JCZA 1JQBA 2DPHA 4IJVA 3WGOA 4TZKA 3RU9A 5DBGA 3UFXA 1PL8A 4WASA 1XIVA 5BNFA 3GEDA 3GT0A 3EMKA 5I7SA 4O0LA 3H7AA 3L4BA 3GHHA 2XF8A 1QV7A 2V65A 1HDRA 4NBVA 4L4SA 2QW8A 4E32A 2BFMA 2DBRA 4PCVA 3ZV6A 5L9AA 1HETA 1DAOA 2D8AA 2GR9A 5HA5A 4BO3A 1QYDA 3T7EA 3WGTA 2X0IA 2V6FA 1U8FO 1C1DB 4ZU3A 3TFQA 4D43A 3DTYA 3H9GA 3TN7A 2EP7A 3TZCA 1N5DA 1XG5A 3WMXA 3R1IA 2I67A 4J16A 1NHGA 3RUIA 4YQZA 3C3XA 1GPJA 1A4IA 2HK8A 2IZ1A 3H65A 4J7CA 4JGBA 1SEVA 4PG6A 4L4XA 2C7GA 3OJ0A 3F5SA 3GMDA 4WECA 4WCFA 3K31A 3OH8A 4B4UA 4KQXA 1TEHA 1SO8A 1ZO8A 3JQAD 3BHJA 1ISFA 3OQ1A 2ZTLA 4O63O 2NTVA 1P1HA 1GYRA 5I7VA 3PDJA 2DM6A 3BMQA 3KZVA 4AJOA 3ZHXA 3BMCA 3OECA 4IBOA 4IJWA 1VJ1A 4CQMD 4IDBA 1NX6A 1L7DA 1OBFO 3H5RA 4XEHA 3UHAA 5COAA 1P3DA 4BO1A 3D64A 4JX8A 3CINA 4CPDA 1ZMOA 2P9CA 2VT2A 3JD1A 1VPDA 3K2EA 4PLWA 3I83A 4YAKA 4CMBA 4BNZA 3ORFA 1GQYA 1PS9A 1LA2A 3E9MA 4KZPA 1XHLA 2H1SA 4TRMA 1YL5A 2QRJA 2I76A 1UXKA 5B1YA 4NBRA 1DIGA 4A03A 3AFNA 4CMIA 3ANLA 4UVDA 4B4OA 3IS3A 3GUYA 1LSUA 4I5EA 2FRDA 4FGWA 4IDDA 2HJRA 2F1KA 3VKUA 4Q9NA 2EERA 2YW9A 3Q9UA 1R4MA 4R51A 4OQYA 4CV1A 1P1IA 2Y1FA 3GEGA 3DDNA 8ADHA 4BMSA 1O89A 3VH4A 3ANMA 3L07A 3VZQA 1E5QA 3LF2A 4KUEA 1BMDA 2GO1A 2D1YA 2Q99A 3WBFA 2HMSA 3RBZA 1LEHA 1E7MA 3NDIA 4BNWA 4OL9A 1L7EA 1F0YA 3LF1A 4RQUA 1JN0A 1HT0A 1DJQA 4TZTA 3PJDA 4R5HA 2BRUA 3WYEA 1FDSA 4GGOA 3UXYA 4NK5A 2X5KO 3OMLA 2CVQA 4CLOB 2YDXA 4B3HA 4XR4A 2JD0A 2HAEA 4UVGA 4L76A 3GZNA 3IL2A 1X14A 4QECA 1GQQA 5IXYA 2BFPA 5CEJA 2LDBA 4E12A 4RDIA 1YOVB 2GCGA 1RPNA 3JV7A 1A9ZA 1JW9B 1GU7A 1KC3A 2RCYA 2VRBA 4HFNA 5K0ZA 1FDVA 5JAMA 2OP1A 1NFRA 2GN8A 3UCXA 5IZ4A 5BSGA 1HE5A 1HYHA 3GPDG 3JQ7A 1XDWA 2FR0A 4YT5A 1U2GA 1Y8XB 3AFMA 5G0UA 1BHSA 3PQFA 3EK2A 1PSDA 4R9RA 2ZATA 4LMRA 3WGZA 3JQ7B 5A9RA 3ADOA 3V2HA 5U4QA 1DIAA 3WLEA 1T2FA 1QKIA 1MX3A 4IDGA 1H94A 2GN6A 1HRDA 1PGJA 3OSUA 3GVPA 1E6UA 3JYQA 4RJTA 4G65A 4DA9A 3ADPA 2OP0A 1HYGA 4FS3A 4AJEA 3WIDA 1XR3A 1NM5A 4PFJA 2HKIA 2OFPA 4R3WA 4CM5A 2X23A 1YB4A 1U5AA 1SNYA 1VI2A 2YQ5A 5IDQA 3BMQB 2YFQA 4FPXA 1BRMA 3TNLA 2AMFA 5L40A 3U9LA 2FSSA 1Q1NA 1I24A 1W4ZA 1HDCA 3BZUA 4BO8A 3WIEA 4HV4A 1N2SA 1YQDA 3W1VA 1X1TA 2B83A 4NI5A 2IEBA 5DCWA 5JO0A 1KEWA 2P5YA 5ADHA 2YZ7A 1CF2O 3OM9A 4MVJD 5G0VA 4WE3A 3PRJA 2LQ7A 4OKNA 4XRRA 3VH2A 1X0XA 3PIIA 2DQ4A 4CLRA 4GAEA 1LDYA 3DZBA 1JKJA 3U4CA 2BHLA 1WNTA 2NU7A 3GAFA 1T2EA 3TOZA 1TT5B 1PJLA 1HEUA 4J49A 5G2OA 2J5RA 3GH3A 3MZ0A 7MDHA 3H3FA 3KRTA 4GX1A 1E6WA 3OQBA 4N54A 4BKUA 3EYWA 5JLAA 5J23A 1JU9A 3DC2A 4TRRA 4AJ2A 2DLDA 1NQ5A 4FIZA 5ES3A 2VNAA 1DC3A 1TA4A 1HDZA 3C8MA 4OQZA 1ISMA 4QT0A 4KWHA 3JQ6A 3ZWVA 4JBIA 3ENNA 4NG5A 4MP8A 5ITVA 3A06A 2F00A 1IYZA 1MFZA 3GVCA 3QWIA 2PNFA 1UP6A 2VUSA 2P68A 3WBBA 3K9QO 2A94A 4J1NA 4CM4A 4PZEA 1KVRA 1PGNA 4R54A 1QYCA 1NR7A 4EYEA 1WLYA 5I9NA 4H15A 4PG8A 1J5PA 2D59A 4E31A 3RQSA 4EEZA 3QLJA 1H6DA 4RPGA 2A9FA 3NUGA 3GLQA 3PQDA 4Q3EA 1UZNA 4E3ZA 3LZ6A 1UDCA 3DZHA 3NTRA 4NZ9A 1KBZA 1QXSA 1PQWA 3CH6A 3QVXA 3AI1A 3KYCA 2AHRA 4PRLA 4QEDA 4WLEA 3ICCA 3HWRA 3CSDA 4ZRMA 1NASA 2C7VA 2X6TA 4RVFA 3AU8A 2RHRA 1GV0A 4XDZA 1EFKA 1GFSA 1NVTA 1YVEI 4EITA 2WE7A 2ZTMA 3IDSA 3JD2A 4YRAA 4AJ1A 1N9GA 4BQPA 2Q1UA 1E3JA 3HN7A 1AXGA 3PQEA 3PHIA 1ZNQO 1HL3A 4P22A 1ADBA 1T2AA 1N8KA 4RV9A 4AG3A 4GVXA 1LNQA 3ONDA 1KC1A 2J8ZA 2ZTUA 1ENPA 4IDCA 3JQAB 2H9IA 3WSVA 3EUWA 1B16A 3LQFA 4PVCA 2O23A 3QVWA 4NNJA 2ZK7A 4JBGA 5FF9A 1LQUA 3QE3A 1IULA 5B37A 4DIFA 3H9QA 5CDSA 5A4DA 2AQIA 2JCYA 4ZD6A 1PTJA 1MA0A 1YE3A 2DUWA 2C5EA 2PH3A 4CMEA 3OIFA 1ML3A 2CFCA 4E6PA 2Q1SA 3WGQA 3JQ9A 2NVUA 5FYDA 1C1XB 1NP3A 1NYTA 4FC7A 4CLDA 4EBFA 2O3QA 3B1FA 2VRCD 1IHXA 3L6EA 2WD7A 4GMGA 4ZQFA 5G0SA 3RC2A 2O4UX 3RU7A 3FN4A 4BNKA 2R00C 3KO8A 3HQ4O 1V35A 2W2LA 3NAQA 1P9LA 4CQLA 2VWHA 1FDTA 3B1KA 5EN4A 1R4NA 5F5LA 4ND2A 4MOWA 2O3UA 1YBAA 4GSLA 4ND3A 1O0SA 4BNXA 1ZEMA 3ZH2A 4CM1A 3A28A 1I01A 1N7HA 1UXIA 2BFAA 4XZ3A 1BXKA 2VN8A 2G1UA 4BS9A 4CLHA 3OJFA 3INGA 3ONGA 1NVGA 1IPFA 1K3TA 1I33A 2PK3A 4R1TA 2XOXA 1GR0A 3F4BA 4IGFA 2HMTA 5KJEA 3S2EA 4KWIA 3EW7A 4GKVA 2HMUA 4I08A 1R37A 3CEAA 2NTJA 5DP1A 1LJ8A 1I3NA 4JJFA 4WOJA 4U5QA 3LC1O 1XA0A 4YJFA 3T7CA 3VH1A 1D3AA 1NXQA 4IUYA 4UUNA 2GZ3A 3GEMA 2W90A 4BNMA 4UEJA 4RORA 1Z75A 4O6VA 3GHYA 3PP8A 5EL0A 1LRJA 4GWGA 4D41A 4HUJA 4YAIA 1UZMA 3GAZA 1LI4A 4W9NC 4L9RA 5JPIA 5KCZA 3HNPA 4Z9YA 2P5UA 1Y6JA 1Z7EA 3OBBA 4CODB 3I4FA 1ONNA 3VPGA 4IM7A 2BF7A 3I9KA 3PLRA 3SX2A 3QV1A 1OZAA 1TB4A 4K6FA 1GCOA 4LRSB 4C7JA 1Z45A 4XIYA 3IKVA 2XXBA 3B6ZA 2V6GA 1CIVA 4LCEA 3EHEA 3K2BA 3E1KA 4DQUA 4P4NA 2GGSA 2IZ0A 2PGLA 4R1UA 4UVIA 1U3WA 5CDYA 1J49A 4YT2A 3X2FA 1MC5A 5A3VA 1YKFA 1PZHA 2Q45A 3C1OA 1KY4A 2Y1GA 2QHXA 2TMGA 3QIVA 4PLYA 3HDQA 4YRBA 1YXMA 4C4OA 1T2CA 4Z0HO 4CUZA 3I6QA 1B7GO 1NNUA 4CR6A 4WCFC 4ESOA 2EGHA 1O8CA 5IZCA 2VTDA 5L4SA 1W8DA 1U2DA 1CQJA 3ITDA 5JW6A 3JYNA 4NPCA 3WXBA 3D4PA 1YWGO 4WLFA 5F1OA 2CF5A 1CERA 1WW8A 3LSYA 4G81A 4BOYA 3WB9A 4DPKA 9LDTA 3D5QA 3W8DA 3GPIA 4YJDA 3FPCA 2UUPA 4YDRA 4Q3CA 3WGGA 1ORRA 3HADA 1R12A 1RYDA 3BMCB 4PG5A 1FF9A 3P5SA 2EIHA 4RVHA 3KETA 1D8AA 4NHEA 1KYQA 3M1AA 1R0SA 1KY5A 2WE8A 3W6UA 1QRRA 1K2WA 2O3TA 3LVFO 3JYOA 3ZU2A 4RGBA 1PQPA 5JDIC 1JAXA 4J9UE 1IY8A 4EGFA 1X1EA 4FFOA 1ULUA 3MJ4A 5JAQA 3VPSA 4IS3A 4BNLA 4YACA 3PFFA 4J4HA 4DYDA 3PWKA 4WEOA 4GX5A 5C5IA 3ZWXA 5I7EA 1DXYA 5HWSA 4YAGA 2GRAA 4B3IA 1IE3A 1Y9EA 3DZIA 3N74A 1NPYA 3KEOA 3RKRA 4Y9DA 2AE2A 3F9IA 3VOSA 1MGOA 4J2OA 1R4MB 4BO5A 4JQCA 5JDCC 4ILKA 1SOVA 4JP2A 3DBRB 2PKRA 5KKAA 4WNIA 3GNTA 1EFLA 2OBNA 3WMWA 1LDNA 3NGLA 2NQ8A 1Y5RA 4HWKA 1KEUA 4CMEC 1WAMA 2DUUA 3GVXA 4HNHA 4Q39A 3EC7A 4RZIA 3PYXA 4DWVA 2EEZA 3KYCB 4XYLA 4NIMA 4GWKA 2VZ9A 4FFNA 5B4UA 2PGJA 1WWKA 2DVMA 2BD0A 1ZJYA 2EJWA 1XU7A 2VUUA 3IJRA 4RPHA 4Z0TA 3FNFA 3TSCA 1DRUA 2P9GA 4BO2A 5KVSA 1PGQA 4U0JA 5KTKA 1O95A 1Y8QA 4Y8VA 5GZ6A 4HFRA 5CDUA 4ZICA 3N58A 3PZRA 1PJ2A 4JCOA 4W4TA 1MUUA 3UUWA 3RJ5A 1ZFNA 2WSBA 3QHAA 1QYVA 4X54A 2O2SA 1GEGA 4B79A 3I52A 4B3JA 2O3SA 4DC0A 3RAJA 2JJYA 3FF4A 3GDFA 3JQBC 4R5MA 1P1FA 3OIGA 4E2WA 4E2ZA 3HSKA 4OH1A 3Q1LA 5EESA 3IP1A 2Z5LA 4MDHA 5L51A 3W6ZA 1P1JA 1MLDA 2X5JO 3GN2A 1DB3A 3OP4A 1BSVA 3NTOA 3U4HA 4EUFA 3INTA 3TJRA 1PL6A 3PVZA 5G0WA 2V6BA 3JQCA 1RM5A 1E7WA 1V3UA 4RF2A 5JE8A 3U09A 1I8TA 3FBTA 1T25A 3KYDB 1JKFA 1WZEA 1NTOA 3PHJA 4LW8A 4R1NA 4XJTA 4YAEA 1VJ0A 4BKQA 3GR6A 1X0VA 2C07A 1HLPA 5T57A 1HLDA 2IEDA 3JQBA 3QWFA 1JDJA 4PG4A 3TF5A 4ALMA 4Z6KA 1R6DA 2BELA 5G0TA 3JD3A 2YHIB 4TSKA 2HMVA 2DKNA 4CL3A 1DOHA 3ITKA 3BTVA 3DXFA 1MV8A 2R2GA 2D4AA 4GH5A 3CZRA 5C7IO 1PJCA 1E3IA 2E37A 3VC7A 3T4XA 2FY8A 1W73A 5JFOA 4XDYA 3SVTA 1T4BA 5DOVA 4XRGA 2HQ1A 1G0NA 3WQSB 2POQX 4UUMA 3L4SO 1EUDA 1ZK1A 4XGKA 4JIGA 1K6IA 2H5LA 4P8RA 4K26A 4WPGA 1T1SA 4GBJA 3JTMA 4IGEA 4PZDA 1XU9A 3NDRA 4OJNA 4FCCA 3GC6A 4L8VA 4MVJM 2X22A 4Q3BA 3KOUA 5JO9A 3FN1A 3KXDA 5AXCA 2O48X 4E5PA 1E7RA 1YDWA 2YY7A 2IODA 4FJ2A 3SEFA 3KV3O 5JY6A 1SOWA 3ZWMA 1ENZA 4J3FA 4FFRA 4BNFA 3HN2A 3H9UA 2TMDA 4RVUA 1EUZA 1EVZA 3GVHA 4N7RA 3OEYA 4BNVA 5H82A 2O50A 5TLSA 1EDOA 2OO5A 3ST7A 1G1AA 5KJCA 2NU6A 5L7TA 2IYPA 3VZPA 3RIHA 3NT2A 4J1QA 1QV6A 4RVSA 1BXGB 1AXEA 2ZTVA 3K73O 1O94A 4ALLA 4J91A 2OL4A 1HDXA 4K9DA 3FNHA 3HG7A 3W4IA 4M54A 4OXNA 3PGXA 2B37A 3ZNQA 2ILTA 2J6IA 4YR9A 2JCVA 1DSSG 3PEFA 4AL4A 4XQEA 3G49A 3D3WB 4CLRB 4UREA 4XX0A 3B20A 5COBA 2PLAA 1H0KA 1VJTA 5A05A 3KYDA 4EDFA 4PLPA 4U0KA 1XSEA 2AXQA 2RH8A 4DBVO 1BXZA 1FDWA 2ZIZA 1ZK0A 3A9WA 3RUCA 1I3LA 1ISHA 4YB8A 4BNNA 2I99A 4BMVA 4QX6A 2XXJA 2PR2A 4H16A 4EJMA 1VRWA 3UN1A 1HE2A 1RM4A 2PA3A 2NV6A 4B8ZA 2PY6A 3MOGA 2NVUB 4AICA 2AQKA 3R6DA 4TRNA 1LDMA 2NU8A 4GI2A 4D0RA 2GLXA 1QMGA 3AOEC 4Y98A 1O9BA 3UGKA 4CJXA 4F45A 1GAEO 1HZJA 4DUPA 5GZ3A 1RJWA 2VHWA 2ZYGA 3QRWA 4MINA 4CLXA 5AQ1A 3WFIA 4AJNA 2JFFA 3VVBA 4MVJP 1GCUA 4DQVA 2PH5A 3AUSA 3WICA 4BQRA 1Y5MA 4B8WA 4I5FA 1ISIA 1HKUA 1ZIDA 2W2KB 4XYEA 4J7UA 1LLUA 1NHWA 3TOXA 4ZGWA 1ADGA 2IXBA 5I7FA 2QIOA 5TC4A 4BNTA 3AOGA 3GNQA 1Q0HA 3E18A 2W2KA 5AVOA 3PHGA 1E1KA 2DTEA 5TJ9A 3HJAA 4YXFA 1A9YA 4E5YA 3NT5A 1AHIA 2ZB7A 2W98A 2DBZA 4NFYA 4LVCA 1QLJA 1EMDA 2VT3A 3QVSA 3KSUA 4L0QA 4LK3A 4HXYA 3IOYA 3MWDB 1SPXA 2Q46A 4FD3A 1Y81A 1EUCA 1U4OA 4FR5A 3ZWPA 2Q4EA 2GD1O 3GGGA 1V6AA 4U6QA 3NYWA 4BGEA 5DF1A 4BNHA 2C2XA 1E7YA 2G5CA 3CTMA 4CM9A 1P74A 1UXHA 2HMWA 3TL3A 4NJMB 2BMAA 5AYVA 3S55A 3FI9A 4DLLA 4GQAA 3KSDO 2X0RA 3RC9A 4B7UA 4D3FA 1NQTA 2AG8A 3KYBA 3JYLA 3U49A 3ZWNA 2YYYA 4I9HA 1W6UA 3WS7A 3K96A 2FHSA 4YRDA 1E6EA 4M1QA 1OC2A 1ONOA 3GZNB 1R0LA 3WNQA 2E49A 2YDYA 3I9JA 4GX0A 5ILGA 2AQ8A 1Z82A 3H2SA 5MGBA 1KVSA 1EK6A 5TRTA 2Y0DA 2BLLA 3EY4A 4KUHA 3RBVA 3BAZA 4ZHSA 1PJ3A 2P4QA 4URFA 1T26A 5ENDA 1HTBA 1U4SA 1WP4A 4IDFA 1WDMA 2Y68A 1UP7A 1T4DA 3TZKA 4OOFA 1GL3A 4WCFB 1R15A 1UZLA 1GUYA 4D7AA 2AE1A 5I8ZA 2JD2A 3BYZA 4J6FA 2VZ0A 2DBQA 3KTDA 2NWQA 1CWUA 4GVLA 1LX6A 4ZQHA 1PGPA 4MVJA 4UEOA 4EI2A 1SMKA 1GYQA 5F21A 5FQ2B 4IINA 5HS6A 1Y7TA 2PX9A 2EW2A 5JMWA 3H2ZA 4CMCA 4ZN6A 4PLTA 1E1MA 3DEYX 3H3JA 2X4GA 2NTNA 5IDWA 2NSDA 4NR0A 1DJNA 2PZLA 4E0BA 2C5AA 1ZCJA 3CZMA 1PR3A 2AEJA 2PD3A 2J5KA 4CLOA 1I36A 4BB6A 2ZCVA 2FPGA 4DPMA 1VKNA 1ZXLA 1DEHA 4ZRNA 3ABIA 5G4KB 5I9LA 4BIIA 1LSOA 4J2HA 3DZJA 1P44A 5GMOA 1NR1A 4DREA 1IB6A 2Q3EA 4XCVA 5BSFA 4FW8A 4MIYA 1PS8A 2D5CA 2CDBA 4AJ4A 5DNAA 5FWNA 1ID1A 2CDAA 3BMOB 3V1YA 3ZU4A 2PTGA 4YJFB 5EMHA 1K89A 3OEWA 3RC1A 1CQIA 3ZWWA 1SBYA 2I66A 2QZZA 1K0UA 3KVOA 5DCYA 1P1KA 3G79A 1NAIA 2I6TA 2Y0EA 1XWFA 2PGDA 5IG2A 3WLFA 4L73A 4PZCA 4UVHA 1M76A 3RVDA 3KEQA 4NBUA 4BL5A 4RPLA 3FCOA 3PIDA 1U3UA 3WYCA 5FEUA 1RYEA 4W99A 1S6YA 4MKZA 3ONHA 3STHA 4U8GA 4FOSA 2C0CA 2V6MA 1U3VA 5C3MA 5I8WA 3DMTC 3U0BA 1E5LA 2I65A 3AUUA 4BO7A 3HDYA 4RQTA 3QJ5A 1G0OA 1C1DA 3FHLA 4LN1A 3PJEA 1TXGA 4HY3A 3AM3A 3JQ9C 4MJLA 3CE6A 4DXHA 3ZWAA 4TVOA 2DC1A 2OORA 4RPKA 4NBTA 2Q1WA 4YTEA 1GY8A 1QYXA 1ZW1A 4IMPA 1I2ZA 3NTQA 4BVAA 1DFGA 6LDHA 2AG5A 3HB4X 1TT5A 3U62A 4BO9A 2HRBA 1SAYA 2FMUA 5COQA 2FR1A 2WEKA 2PKQO 2PV7A 1WMBA 3RJ9A 5KNLA 1OI7A 5THQA 2QYTA 2RH4A 3HDJA 1YONA 1ZH8A 1PEDA 2X5OA 3I9OA 4H7PA 4O1MA 4II3A 3ZHZA 4A2CA 3ASVA 4ND5A 4QO7A 4CMKA 2CMDA 3NT4A 4WGGA 2VWQA 3CXRA 4P38A 1I2BA 1F17A 3AI2A 4B7CA 4KTVE 3UAGA 2Q1TA 2YUTA 3U3XA 4D3DA 1PIWA 2ZYAA 3W8FA 2C82A 2PFGA 4D46A 4EZBA 1VKOA 3IUPA 2GSDA 3RUEA 3UH1A 4Q3DA 3IUSA 4XQ9A 1OC4A 1XYGA 4GX2A 2I5PO 1GPDG 4PLVA 3N7UA 3DBLA 3UKOA 1JTVA 4E5MA 4E2YA 4EEXA 3F46A 4RLSA 1DLJA 2CVOA 2H63A 3FRJA 1E7SA 4Q3NA 2ZKLA 4XD2A 1QORA 1BVRA 1N9GB 2E48A 4W5VB 2W2LD 4M55A 4N5LA 1NPDA 3EDMA 4C7KA 3KLPX 1EBFA 2FWMX 3V2UA 1V0JA 4M8SA 1FDUA 2VYND 1DBVO 3WWZA 2GZ2A 2FZEA 4W7HA 2I3AA 2QYSA 5G4KA 1E0DA 2HK9A 2YV2A 4IS2A 3SLGA 1LUAA 5T64A 2HJSA 3UVEA 2WWRA 4PIVA 2X58A 4MVJE 4PLCA 5A06A 3GFGA 3GGOA 4JN6B 4MVJF 1HDGO 3HE3A 1EQUA 4JJGA 3M2TA 4DMMA 2OZPA 2BGLA 1RM0A 3HFGA 5LDHA 2WMDA 1LXCA 3D5TA 3DHNA 4CUJA 4NFSA 2D3TA 2RIRA 4CV2A 5DZSA 5JMPA 3OETA 5CDGA 5FI3A 1S7CA 5AXDA 2X9GA 4UVEA 1ZSVA 3BHMA 2EJVA 1EE2A 3RUFA 5C7OO 2FN7A 4HFMA 4IDEA 2E82A 3UF0A 3WOHA 4IZHA 4ROSA 2WYVA 3JQAA 3MJTA 3DONA 3EVTA 4MIEA 4AJIA 3AUTA 2QZ9A 2CZCA 5HRUA 4A5OA 4J0EA 5T6BA 2EKPA 2O7QA 3ENKA 4WLUA 5CG1A 1QLHA 3GGPA 4OOEA 3TPCA 3KUXA 3KBOA 4JLWA 2QG4A 4FBGA 1FMCA 2NVWA 3VZSA 1U7HA 4L4RA 3DBVO 1E1NA 3LT4A 3RD5A 3B1JA 4OHUA 3ETDA 2GUGA 2J3IA 2CUKA 5JBIA 3GA0A 2G76A 1NVMB 4JJIA 2VQ3A 1CETA 3JD0A 2JFGA 1AUPA 5IN5A 3VTZA 3VDQA 3H8VA 1WDKA 1L1FA 1UDBA 1D1TA 1BG6A 1LTHR 1Q7BA 3O9ZA 4Y6PA 4R01A 5LC1A 4TQGA 5LDGA 4YA6A 3WDSA 3ZWOA 4UAGA 1EVYA 1M2WA 1LDGA 2Q2VA 1KETA 4DYVA 5JDCA 1VL8A 5ICSA 3NEPX 2OBYA 2X8LA 5FFFA 3S1LA 1RWBA 1T2DA 1B3BA 3DAFA 4ZQBA 1W0CA 1DIRA 2UV8A 3DO5A 3X2EA 4CMIB 5I9MA 4LCJA 2O4CA 2DTDA 4QUKA 4EUHA 2LDXA 4FGSA 4CM4B 1HSZA 2DFDA 4OIMA 1LQTA 3RROA 3VPXA 5JDIA 3MTGA 2RAFA 1EDZA 1AN9A 2Q2QA 4W7IA 1N7GA 5KVQA 3D3WA 4IJKA 3LLSA 2I9PA 1HWYA 2C2YA 4HNGA 2VWGA 5C7LO 3I9NA 4UUOA 5DT9A 1UP4A 4PGFA 4CR8A 3QWBA 1I32A 2Y93A 2D0IA 3FWZA 3R3JA 5DBIA 2FPIA 3BTUA 3G0OA 4L75A 4OM8A 4ALKA 2O2YA 1FK8A 2G82A 3D0OA 4A7PA 1V3TA 2EF1A 5L45A 3I4CA 1X7DA 1Q7GA 5EJ2A 3F1LA 5IZCC 2B5VA 1H6CA 4YYZA 1UR5A 2HRZA 1YBMA 3RKUA 3U5TA 1Z74A 3JYPA 4E5KA 4XYMA 1ONPA 3AI3A 4XYGA 3VH3A 3WWYA 1HSOA 3Q6IA 3ZV4A 3OJEA 3O8QB 3Q3CA 3ULKA 3VZRA 2QX7A 1IUKA 2BGMA 2PZMA 3MEQA 6ADHA 4D42A 1H2HA 3JQ8B 4LSMA 1BW9B 1JWAB 3E9NA 1B2LA 2X0NA 3E6AA 4IIUA 3WJ7A 5T67A 3MJEA 3AJRA 4GSKA 3G1UA 5KOIA 3L6OO 3AK4A 5AOVA 4E4YA 1BGVA 3ASUA 4OGWA 1I30A 4KP7A 4FDAA 3AOEA 4FSHA 4L74A 3GDOA 2YV3A 1BTOA 3RC7A 4EUEA 2ZB4A 4JXKA 4F6LA 4CV0A 4J7XA 5TT1A 3ROMA 3U4DA 1ZKMA 2QQ5A 2OGUA 1KVQA 2DTXA 2Y1CA 3K8ZA 2X9NA 1BDBA 3JQDA 3DWFA 2EKLA 2B35A 3MTJA 1ZSNA 3NV9A 1RKXA 2WD7B 3PLNA 1B26A 1GDHA 4R16A 4TMFA 1E1LA 2G17A 3D4OA 1V3VA 4KMSA 3TFOA 1MP0A 4Z3DA 2VYNA 2W8ZA 1M6HA 4GPD1 4I9UA 3D4NA 1PL7A 3MWEB 1BWSA 2EW8A 4OAQA 3SJ7A 1V9LA 4Y6RA 1ZUD1 4BV8A 2PWZA 1YGYA 2O3RA 4HFJA 1CDOA 2X9VA 1NWHA 3L9XA 4BGIA 2VHVA 3ONEA 4Z3KA 2Z1MA 4I9NA 1XKQA 3S2IA 3GRKA 3OIDA 2RHCA 2PKQP 3QVOA 4MP6A 1ADFA 1PQUA 3SBOA 4BNUA 5JCJD 4PLGA 2B36A 4IXTA 4GLLA 3ROPA 5KVCA 4WKGA 1E3WA 1Q0LA 3ZDFA 3DBHA 1GYPA 1PJBA 4A0SA 1DC4A 5F1PA 5JSFA 1E7QA 4NMHA 3HDHA 4WJZA 3ZW8A 5K6AA 3WGHA 3ETGA 5MDHA 4BV9A 3ZNOA 2V7PA 2PZJA 4DIOA 3NJ8A 1B8PA 2PD4A 1GEEA 2VHXA 1H5QA 1PX0A 1P33A 2B5WA 2IYOA 4UEKA 1A7KA 4BGVA 2PZKA 2BH9A 3ROKA 1GZ6A 4BGUA 2YV1A 4CM3A 5KKCA 4QSMA 1UUFA 1XELA 1NPTO 4MKXA 1D1SA 5B4TA 1ADCA 5JC8A 2NM0A 4Y6SA 3IIEA 1SCUA 1DPGA 1KS9A 3TZQA 3ZWYA 4MO2A 3IP3A 1ZK4A 2B4QA 3RBXA 4I8XA 3DAPA 4CM6A 1YB5A 1SB9A 4MIOA 3GF4A 1XQ1A 1B8VA 2AQHA 1NFQA 4Z0PA 2Y66A 2BGKA 1C0LA 3OICA 5DBFA 4WLVA 1P31A 2CD9A 1VE9A 1QR6A 5EERA 4O59O 1KOLA 2Y1DA 2B69A 5HM8A 3I1JA 4OXKA 3MJCA 1EBUA 1HDOA 1DC5A 3GRPA 3A4VA 1N1GA 3ZV5A 3FNEA 4BB5A 3SJUA 3DAGA 1IPEA 4TKMA 1LC0A 5A5EA 2VTEA 4IXWA 1ENYA 1I5RA 1X13A 3LYLA 4DIBA 3TRIA 4D45A 5T8KC 5TX7A 3T4EA 3QY9A 2P9EA 3E5RA 1YB1A 4YEDA 3ANNA 4WLNA 2BI8A 3IAHA 3DHEA 3DOOA 5IJZA 3E03A 2VYVA 4JNKA 4OSOA 2NLOA 1JLLA 1GD1O 1AGNA 1YOVA 3OQ6A 1H9BA 4E33A 2UDPA 3AY7A 1P0CA 3SLKA 3WX0A 4YQYA 3H5NA 3M1LA 3QWAA 2Q49A 2VRCA 2ZQYA 5L53A 4QO8A 4RVDA 4CMJA 4ITUA 1Q7CA 3A14A 1KEPA 3WJAA 1SEPA 3UOGA 3C7CB 3PI7A 5IN4A 1JVBA 1U28A 4B4VA 4P4GA 3RUAA 1B14A 3WSWA 1Y9AA 5A04A 1E3WB 1OFGA 2I3GA 4HKTA 1B0AA 4R4JA 4RPJA 2J3KA 4R68A 1X7GA 1DIBA 4RLHA 4F46A 1E92A 3DL2A 1GUFA 3P2OA 3L6DA 5IF3A 1PWZA 5T8KA 5CPBA 3RSHA 4DLAA 3H5AA 3EAGA 2OMEA 3V2GA 5DULA 4LSWA 1CRWG 2WTBA 4M89A 4OO3A 4N18A 4IZIA 2FZWA 1KVTA 5TNXA 5HS4A 3D1LA 1ZSYA 3LDHA 1PZGA 2Y1OA 3H9EO 4IY1A 1LRLA 3WYBA 2WJPA 1EZ4A 2BI7A 1AHHA 5TT0A 4AVYA 1PS0A 2YHUA 2D5AA 3IMFA 5DP2A 4MKRA 2UVDA 1JVSA 2EV9A 5F5NA 3E5MA 3AM4A 1FXSA 1IHYA 4MVJG 5K6AC 2IDZA 2ZJ0A 4W6ZA 1Y1PA 1MC4A 2EXXA 4J4BA 4XYBA 3SXPA 1PR9A 4ALJA 4A10A 4BKOA 3VPFA 2GASA 2BFOA 5DOZA 2NADA 5DDIP 2Y99A 3DBHB 4JK3A 3GDGA 4ALNA 4WNCA 3INRA 3QWHA 4RL6A 5H81A 3KLMX 1I3MA 4PLZA 5AXBA 2JAPA 3KM0A 4LISA 2B4TO 3DQPA 1DLIA 5EQFA 2GYYA 4ZVVA 1B3RA 4MP3A 5ER6A 4AFNA 1UDAA 3ONFA 1NQOA 4OSPA 4JROA 3ON5A 2C29D 4CMAA 1HE4A 5BR7A 1JWBB 4R9SA 4S1VA 3WTBA 1SB8A 4QXMA 3V5NA 1A72A 5TQVA 5DN9A 4E13A 2DBVO 5TS3A 3PDUA 4YAJA 4Z9FA 5H83A 5CEEA 2X0JA 5TGDA 2ZQZA 1YL6A 1LSSA 1H2BA 1F8GA 3KSZO 2EGGA 1G6KA 1SZJG 1F8FA 2C20A 2JKVA 3PK0A 5BQFA 3MJVA 3C7DB 3L9WA 4FQ8A 2UYYA 3DB2A 5EQDA 1WZIA 4E2XA 4E5NA 3P2YA 1PZFA 1XGKA 2VOEA 3O8QA 3OJOA 3LK7A 4N5NA 1A7AA 3F5QA 3W4JA 1Z6ZA 1D4FA 2GPTA 3V1TC 1DFIA 1ZVMA 3TWOA 4YT4A 2EG9A 3ICPA 1F14A 3B70A 1ENOA 3VHRA 5JCJA 5A9SA 4KDEA 1M67A 3RWBA 2XPCA 4P4LA 1DHTA 4YWJA 2GN9A 1XEAA 2Y67A 3F1KA 1U7TA 4TVBA 4A73A 5A1TA 3F4LA 3OHSX 4J0FA 4K6CA 1HZZA 3GMSA 4EJ6A 4ND4A 2OXIA 3PWZA 4XWYA 4NDNE 1GZ4A 1MG5A 2ZB8A 5K9ZA 1UH5A 2ZB3A 2AEFA 4RDHA 3ZNPA 1ZBQA 4W9NA 4AJKA 3WGYA 2NU9A 4TWRA 5BNIA 3IQDB 3MOIA 3W4KA 3ZZNA 5JCXA 4BNGA 4BHTA 4WUVA 2C59A 4EJ0A 2C54A 3AM5A 4G5HA 4LMPA 4R41A 5TIIA 5BT9A 3GUCA 1E3SA 1UJMA 3IJPA 3UCEA 1H93A 2Q2WA 3G1TA 4J4TA 4JBHA 4QQRA 3TQHA 3WQQA 5A5FA 1IL0A 1EE9A 3JSAA 3PGJA 2JFHA 2YHIA 5TF4A 5ITWA 3KHUA
chains in the Genus database with same CATH superfamily
3HU1A 4X7MA 1V11A 3OQJA 5FXMA 2D2WA 1B8IB 2HL6A 3GP3A 5EE5B 1RBQA 1IZ0A 3PNBA 1I13A 5CITA 4OINF 1QX4A 1N6RA 5D5WB 4L7VA 2OCCH 1HF3A 2E4VA 1V54H 3VDNB 5JXIA 4L5EA 1TF7A 3HRMA 1GG2A 1HFEL 1MN6A 1Z6TA 2WTNA 2PZBA 2QRLA 5E6UA 5EMMA 1NN3A 3GTKJ 2OUIA 2LOOA 4DTIA 1VRCA 3ECHA 2VCYA 4AJJA 4NMMA 3FSRA 1B8NA 1JKQC 5H80A 2K27A 5ALRA 2Q4BA 4ZJUA 3ANSA 3A9CA 1UAGA 1ZD1A 1X7WB 1EK5A 1S2OA 3SC4A 2QTZA 4MK4A 4L28A 4CKZA 1J2EA 2C0PA 1PJQA 2HC9A 3F6YA 5ICCA 3UG6A 1L4HA 1SCQA 3VR4A 4CV3A 2PYDA 4GLBA 2AOTA 1BMFD 9LDBA 1IFXA 4JUBA 1RXEA 1N0WA 5FPSA 1B8IA 5BMVB 1H6AA 3DE3X 2ZT5A 1DP7P 3PPWA 5K1ZA 2QSUA 3ZDDA 5K0SA 1ZESA 4YCAA 2DEUA 3OOWA 1N3LA 2PM8A 4Z4FA 2RMKA 5DGDA 2BUAA 3LU1A 3DVSX 5DEIA 4CM7A 4HN2A 2FMTA 3SBXA 1XN7A 5SY6A 1A1SA 2PSFA 2JA7J 1XTZA 4UJ3A 3ZHYA 1OIXA 3GJRA 4IPTA 2CFSA 1POXA 2X9LA 4CKEB 5C2JB 4UUQA 4OJKA 2UZAA 1Q19A 3LT1A 4YYEA 2A05A 2PX8A 3I58A 2BBSA 3Q7SA 1P2TA 4UXJA 2ZJFA 3A1NA 2AXLA 2CY0A 2QM3A 4TMZA 2CXQA 3CTAA 3KQSA 2JCXA 1TU3A 4Z9XA 3V3KA 2GZAA 3WU0A 4UZSA 4W9MC 5KUTA 3L4BC 1HLVA 4Q7LA 3Q3EA 2O0LA 2CV2A 1CF7A 2VOJA 4BMNA 1EFAA 1Q2UA 2E71A 2ZWVA 4EMBA 2XIQA 1Z18A 1O6ZA 1BH2A 1C50A 1V8DA 2FE4A 3S3TA 3BMXA 4JT2A 3KZ1E 2A6TA 4R0NA 2I34A 4ZZ3A 1G4AE 3ACBA 3MJSA 4XIJA 3O2JA 3OE7D 1OB2A 1Q0QA 3K92A 3DDZX 2WB1A 2HWXA 1S5LC 5K2OA 4WOKA 3DMYA 5AJVB 2RB5A 1FYMA 1TUGA 4EMTA 1PI3A 1E6CA 5EYRA 2DPMA 1FY7A 4MPDA 2CT8A 1FDOA 1P5JA 2G9QA 2XWSA 3LAJA 1VLLA 2DB3A 1U2PA 5T6MA 4TRJA 3GJQA 2I29A 3VSCA 1TYBE 3L4JA 4IRUB 4UHDA 4Y3UA 1A96A 3FCAA 2Q27A 1U2WA 1O08A 1BEEA 1V16A 4X95A 1WZNA 3F71A 5AW3A 2WM9B 4CQMA 2EZUA 5EP3A 1VP9A 4KTTE 2I4MA 4DYCA 4IQ0A 1R5NA 3FUTA 4N4AA 4G5GA 1RU3A 4WCDA 3H3UA 4IHJB 4PVDA 4CL0A 2NQTA 4XQCA 1JTFA 1J8FA 2GMWA 4XGIA 2FRDC 1C81A 3FB4A 2WAEA 2E7XA 4JLJA 2D2IA 2H7VA 3P0EA 5LLQA 2E3JA 4JLKA 4CM8A 5DSZA 1TTQB 3LBNA 2ID6A 121PA 3G8AA 2HO5A 1YI8A 3JQFC 5INTA 5E6RB 3KLNA 1Z73A 4M86A 4A3KJ 4R9VA 5KNBH 4C07A 5LU9A 3GV0A 4NB5A 4HF7A 2PVCA 2V7WA 1V9SA 5C8ZA 2NNLD 2Q62A 1C3VA 5JS1A 4OXYA 4R2KA 3T94A 3SQLA 1GV1A 4FC6A 3BMNB 5IH3A 4GWLA 2OENG 2LMDA 1GV2A 1TBXA 4BLUA 2Q3MA 4NBVA 4AF7A 1Y3HA 2BFMA 2G08A 2PT7A 4R05A 1M1EB 3WGTA 2X0IA 2F55A 3FLEA 1XAGA 3NYRA 2A2ZA 3CEMA 3RWMB 2ES4A 3AERA 3MGGA 2ZULA 5E2IA 4O4HF 1A3CA 1XYVA 3CNLA 2AF4C 1EA3A 1ECFA 1P3DA 4IIDA 4OFZA 1Q1EA 2PVSA 3AUXA 3K0LA 4X1IB 4JFAA 2GKSA 2B63J 1IRGA 2F2EA 2PUHA 3LYAA 4A03A 1FYXA 1P1BA 2FRDA 4PY2A 4C7VA 1BVYF 3QYEA 2F1KA 4A0FA 4F5WA 4PCQA 1MAAA 1R6XA 2G9WA 1O89A 3VH4A 4LAFA 2D1YA 1FVOA 1LK0A 4EOGA 2AUTA 2M0CA 3DE4X 1ECGA 5LA6B 3R3WA 4L5YA 5AOCA 5LZ2A 4D7NA 1A9ZA 2VRBA 3OT1B 3T0YA 1B8OA 4LF5B 4CT4B 5IPFA 1OWNA 4LDRA 1W30A 3BIJA 3Q7IA 1LD3A 3VFZA 1T95A 4UFOA 4JGGA 3DDHA 4RIFA 1HYGA 4FS3A 4AJEA 2Y75A 2H1HA 3P45A 2WUVA 5IDQA 2YQ5A 3PUZA 3STTA 4CCYA 1IXYA 2C94A 4B3MD 1H22A 3U9LA 2JN6A 3URMA 4X1EA 2ACWA 5K6TA 5K8JB 3IUMA 3KX2A 1QK4A 5LD2C 2IL1A 1RPTA 5DEOA 2NTEA 2JF0A 2PIDA 1KQPA 3PIIA 4D0PA 2P3QA 4ATNA 3U4CA 1W76A 3GAFA 1BNCA 1T2EA 1PJLA 2PMEA 5J43A 3KRTA 4N54A 1XVVA 4KRYA 1DC3A 3DKIA 1ULHA 1PZMA 2FW8A 4Q66C 1N2ZA 1JPVA 2P68A 4F4UA 2A94A 3DPIA 5J58A 1RKQA 1YE8A 1I39A 2LY2A 2FEMA 4A92A 4E31A 2PLWA 3LCUA 2RDPA 3TRJA 3IHKA 4E3ZA 2ETXA 2CH0A 4LB6B 3AI1A 2WHQA 3N2IA 2WSMA 3CSDA 2R7TA 2RHRA 4J03A 1SCIA 3A04A 1NVTA 3TEFA 1H4SA 2Z5UA 4ND6A 2KMLA 4TS1A 2O2IA 4UD6A 3GFPA 4LOIA 1LNQA 2LKXA 4OHVA 1SHZA 1C5KA 4XH9B 4XJXA 2A61A 2QB5A 3N39C 3FFXA 5FF9A 3V1NA 3GAAA 4M72A 5JNUA 4F3TA 4PE5B 3HYCA 1PV2A 5TQ0B 1YE3A 4CMEA 2RC4A 4KV7A 3FETA 2JIMA 2P75A 1WZ2A 3DKYA 2C3YA 1RR8C 4EBFA 4IXAA 1ZUNB 3ZBQA 4QGAA 4A82A 2RGAA 3BT7A 3CO7C 3SHWA 4EB8A 2W2LA 5F5LA 2VDWB 4C87A 1QIIA 2J5OA 1TMYA 2C9YA 3EIEA 3RTRA 2Z3YA 1I33A 2ORVA 3R7NA 1GLGA 3TS1A 1C29B 4X65B 4GNRA 2Z3ZA 4YJ3B 1TCCA 1ZA2A 2P2CA 4D41A 5HNKA 1UZMA 5JPIA 4N7MA 5AM0A 3RCOA 1A8QA 1I7SB 1Z4QA 1OF1A 4MR9A 3CJQA 4XWAA 3RT1A 1F38A 4LCEA 3B52X 3T4PA 4A69C 3DL7A 2Y48A 2RHOA 4X62D 3KQTA 2GK4A 2YS6A 1GPLA 2YRXA 1NDQA 2J7PA 4HUQA 4O4LB 4P0QB 4WLFA 3RK4A 4DPKA 4XQFA 1DX9A 7REQB 3UC9A 1Y6IA 2XUOA 1GKLA 1RYDA 3BMCB 4MB2A 1KYQA 1R0SA 4KQ6A 2FW0A 3W6UA 1I5ZA 2O3TA 2VJCA 4QODA 1OWPA 3VU1A 4J9UE 1IY8A 2QMEA 4GOXA 2FUG2 3QKWA 1S3FA 1T15A 2FSPA 1KU0A 5CM8B 3VHQA 4OU0A 4FT4A 3K6KA 2PKRA 3HFRA 1OWOA 2VP3A 3FUUA 3CT4A 3U7JA 5MHTA 3I8XA 3PSIA 4E70A 2JARA 3WP0A 1N32D 2YOHA 2AOXA 2F5DA 3CBQA 1FBTA 5AIQA 4OM7A 5G1PA 3OTIA 4DEVA 4MYUA 1T1JA 4ZICA 3I92A 3Q85A 3QHAA 3Q0WA 4QLBA 1QYVA 3QXXA 2O3SA 1IK6A 2JJYA 3JQBC 3VYVA 4HNAB 2QYHA 2A88A 3LOUA 1NLMA 2QRMA 4DLPA 2G63A 1RWQA 1BSVA 2M9HA 3D3NA 1EH7A 1ACLA 4L3OA 4UM8B 2VXBA 1I4EB 2XHKA 2A68F 4B3CA 1X0VA 3TF5A 5FPQA 1JEJA 2GAFA 3DPSA 4CL3A 3SR4A 1HNZD 1G3QA 1NBHA 1VGQA 4P33A 1NH3A 3GFMA 3W8NA 1JYEA 4IHQA 4RPIA 1Z4MA 2XCIA 3EXEB 4M21A 1PJCA 3IVXA 2HIGA 3KAJA 4D56A 3TEDA 2A5FA 3BQZA 4HDSA 4K26A 5J8CA 5JO9A 2WIKA 1FEXA 1UCFA 2OWDA 2XWQA 3AFOA 3AHEA 1ML4A 2IUTA 3KV3O 3DTNA 1R6RA 4HV5A 1U3EM 3HN2A 3H2GA 2WF8A 2DW4A 4MH0R 1GLNA 2AYZA 4R31A 4KIGA 1HA8A 4L22A 3N8GA 3KTFA 3F9KA 4K9DA 3J81K 4M54A 3EWNA 4OSEA 1AA6A 2IGOA 2VP0A 4KVZA 2RHHA 3T5PA 5J9FA 1IRZA 3K0KA 1OPXA 3ZPLA 5J5CA 2LNBA 2PL5A 4JP5A 2BMJA 2OCGA 3ABRB 2XRMA 4KL8S 3TO7A 2NVUB 3DTKA 4M9ZA 2X2EA 1ZAKA 2JB9A 3UGKA 5FA6A 2YY5A 3KR0A 5K7FA 1Y6ZA 4MEBA 3WFIA 2FB9A 3VNBA 1KK3A 4AX8A 1JH3A 3BXFA 2CJPA 2L01A 1FA9A 4DYRA 3CRZA 2E5ZA 2QIOA 4J75A 3AOGA 1Y80A 2D7JA 3UHFA 3HVJA 1HQYE 2D00A 3C6XA 4ZYDA 1GTL1 2W98A 1Q7RA 4RVOA 2IDKA 2CLDX 2O14A 4ZKDA 3C2GA 3EASA 5K0CA 4BNHA 2C2XA 3F0CA 1YRNA 4NOKA 4KE8A 4ESJA 1UXHA 4DV1D 3S2SA 2BMAA 1NZJA 3HBNA 2X0RA 1Q57A 4HPXB 1AZTA 2W2NA 4XRMA 2YDYA 5ILGA 3B3AA 5MGBA 1O6GA 1EK6A 2JLCA 4N3AA 2CXHA 5ILVA 3ZQQA 2W58A 1C80A 3HGGA 3AVPA 5B7QA 1UWLA 2DBQA 4GVLA 3KWFA 1NG7A 4RKRA 4M99A 4CMCA 1FMWA 3H2HA 2I8DA 2NU8B 3E05A 3PQ5A 4QLOA 3K6SA 1ZOSA 5JSZB 3L1PA 5JHUA 1ZVJA 3E61A 4ZRNA 4QIWN 2ONJA 4R8SA 3EPHA 5I9LA 4BIIA 4ZOLB 4DREA 4KXMA 3IVMA 1OLSB 4UOZA 2JIPA 2ZUFA 3OEWA 2I66A 3R09A 3G79A 4JR2A 1T5LA 5DK6A 4UVHA 1N2HA 1X7XA 2X0EA 3DXZA 3TGPA 2OGZA 2ARKA 3ELBA 4CZ2A 1YJWI 3D7KA 4MMXB 4BX0A 3UAXA 4G1UC 1E5LA 4MQ4A 1BC7C 1G0OA 2EV5A 5AKXA 2JKZA 2WG0A 3QP6A 3CE6A 3EC2A 4WX9A 4O2RA 5LN1A 1HDEA 3TOCA 5FL7A 2PI0A 3W2GA 3QPLA 2HBQA 1JHQA 1TCUA 1E6MA 5JRDS 4H7PA 3O2QB 4QO7A 1MGTA 3SOZA 5JBNA 3U3XA 4H7EA 3PC3A 4FHEA 1QQ7A 1DLJA 3SVLA 1E7SA 3MG9A 2FEOA 2ZDHA 3U7QB 5KC9A 4NAVA 3KLPX 3KIOA 2BKEA 1V0JA 2XWBF 2ESRA 3VSDA 1ZD5A 2WOJA 1G6NA 3ORRA 4ENJA 3TZBA 1WF3A 2IOFK 3KQUA 3AR9A 3GJ8A 4C3VA 3AVQA 2RCNA 1S7CA 1BKYA 4PC3A 1EE2A 2N1MA 3IHLA 5LGTA 2Z2SB 3UF0A 2ELJA 3X44A 4OB7A 3GLVA 5DM2A 2VZEA 5JG7A 4QICA 4TZ0A 3NQOA 5AMXA 3L7YA 1YQWA 3E4CA 2L7ZA 1UPTA 5JFTA 1FJGD 2H4XA 5JTUA 4Y1RA 4MWCA 2C7RA 5EFOA 5JBIA 1QKJA 2I6QA 2BY4A 4YJ2A 3GO4A 2WINI 3U1BA 3ZD7A 5DYTA 1WDKA 3HJNA 1MJGA 2ZWIA 1RRPA 1MQ9A 3FVWA 4MI9A 4FBLA 3DF8A 5CQEA 4ZAWA 3AP3A 1KHHA 4ZQBA 4ABZA 2O4CA 2FSWA 4YLGA 3U21A 3C87A 2QM0A 2GYWA 1H1DA 1DEOA 3RROA 3BIXA 3D8BA 1N7GA 3LUGA 3KQHA 3FJ1A 2IOQA 5C7LO 2FFJA 5AD1A 3H5OA 1Y5IA 4TSFA 5DBIA 4G0UA 4L75A 2PMUA 4I3FA 3IB3A 2P7IA 5DH9A 3F1LA 4Y2UA 4XYGA 2BFCA 5T7BA 2OHGA 4GP7A 1IY1A 1ST3A 1Z83A 3JQ8B 5FUVA 3UYLA 5EG0B 2CFRA 3AJRA 2AMJA 3BXPA 2MINA 4P1WA 3TMAA 5F5XA 3BP8A 5JD6A 5KYXB 2ZPAA 5B53A 4UVCA 2F2TA 1E3HA 1KVQA 2DTXA 5IBPA 4C76A 2VOPA 2FLKA 4R7ZA 4BH9A 1ODDA 2Z4SA 3L79A 2VVTA 4RE6A 1V7CA 1KDVA 4ETIA 3BXOA 3OIWA 4FILA 1M0SA 2B7BA 3GBSA 2QK4A 3QVOA 3D7MA 5LGUA 3ROPA 5FRMA 4Y2VA 5BVGA 4MITA 1EXVA 3OCZA 4URXR 3WGHA 4GKJD 3T3GA 3RSQA 3NJ8A 1PX0A 2B5WA 2IYOA 3LOPA 2Q21A 5F2KA 5BS6A 1TUBA 4XFDA 4DQ0A 1XVIA 3NHFA 2HFKA 2VP4A 4H59A 3ZHQA 3OKAA 3R9XA 2AQHA 2BE9A 5DBFA 4Q47A 3COAC 2GFIA 2X9QA 2DAOA 1EBUA 4RHUA 2A30A 2Y69H 1BX0A 3NWEA 2PX0A 3ORYA 3N6VA 2XKKA 2JUCA 5GP9A 4LX0A 4MQ6A 4QGGA 2BY2A 5AW0A 4RADA 1FU7A 5ALNA 4ZOAA 1IM2A 2GIVA 2CHFA 1AS0A 1PYDA 3LCJA 4YI5A 5L53A 5ABPA 5IN4A 5KWIA 4AG6A 1E3WB 2I3GA 4U2CA 2BV6A 5DYYA 4KVAA 3SR3A 3TEJA 2FCRA 2QRNA 2UV1A 2X6WA 3MT0A 2OF7A 1FFCA 2EBFX 1K7YA 3TD9A 1JLLB 2LZ0A 3IMFA 4B82A 2ODPA 4NS1A 2EV9A 4NXND 3LAPA 2FWAA 5K4AA 1PR9A 2NADA 2F17A 2XUZA 4HX9A 5FBKA 2FR8C 2Q0QA 3DXYA 2XWJI 5EKTA 3WK8A 4R9SA 5FTJA 1A98A 4X6UA 3E5XA 3PSFA 1GA6A 4JS0A 4UFPA 2C20A 2JKVA 3H87A 3V1TC 2YU3A 2HU9A 3DMNA 3NHMA 4E6KG 4M36A 3VU9A 5KWSA 3IEMA 4Y2QA 3GLGE 2JIZA 4DR2B 4YWJA 2FF5A 2Y67A 4M6VA 3FHCB 2Z3WA 4K6CA 4DSUA 3L8DA 1M8GA 1KONA 5FFMA 5K9ZA 5DE3A 1KJ8A 1CRPA 1G9XA 4PHGA 4PHHA 1X19A 2AJLI 1W5FA 3E9EA 2Q2WA 5A5FA 5ITWA 2QJOA 3JSAA 2RHWA 1Z77A 1CXZA 1HT2E 4LF5D 4XGQA 2F3RA 1US8B 5CX1A 1PNOA 4RFSB 1XVUA 4PCLA 4D0SA 5DSTA 2G40A 2NNYA 4RO0A 4KQWA 5K0LA 2XV1A 4Y67A 1P92A 1IBSA 2QMHA 3KDSE 4HNAA 2Z2JA 3WTYC 2C9ZA 3MGKA 1V7ZA 4JBLA 4LPKA 1VTKA 4PC6A 2XUFA 1F2DA 3AR8A 3IC5A 2EKQA 1PFGA 3LP8A 5DCUA 2NVXJ 1OAAA 2B2XA 4ZDWA 4J43A 5C32A 5FKLA 4TKLA 3PZBA 2B8EA 4D9HA 1C7FA 1F4VA 4RD6A 5LCXA 5EY5B 5JS6A 3L7IA 3DFZA 4IQGA 2W70A 2IJLA 3RJZA 2CSUA 5A4IS 2Z95A 4MW4A 1W35A 3FOCA 4IJMA 5EG5A 5EJIA 5A9TA 1QA6A 3SM9A 2WUGA 2ZJYA 4U2EA 4G1FA 4I76A 3AG5A 4RF4A 3LT0A 1G20E 1A1VA 1C1XA 5BNGA 4EHLA 3GQBA 3CCJI 2AFIE 2H3EA 3RUDA 2NO5A 1I7DA 5BYBA 1P81A 1ISGA 1PFUA 2A5LA 2IGBA 4S3MA 4K5QA 1QRUA 1K2VN 5BRNA 4Z3OA 2HSEA 5JTTA 4BO6A 5BQTA 3ESXA 2HF2A 2ZRHA 3DWIA 2HGZA 4QGHA 2UUOA 2GBIA 3GJTA 2Y05A 1LPAB 1LU9A 2VWPA 2SKEA 3DZGA 3QF4A 2IRWA 2BW3B 3U1VA 2FQ1A 3OX2A 3PFIA 3ZLTA 1IXZA 1G7SA 1MEEA 1PD0A 1NMEA 4Y4RA 3O3NB 5KDOA 3UAZA 1SBIA 1YRWA 3CM0A 3WTCA 3BXXA 2FJPA 2ZSDA 4PLHA 3B1WA 3IH2A 2QE7D 2PMBA 3KP3A 1Q22A 3ILVA 4AUNA 1GAXA 2W2TA 4BAUA 2GERA 4HLCA 2H4ZA 3CMMA 1NXPA 1EQ2A 4G07A 1YSCA 4K6OA 3DEJA 4BFLA 4ZAFA 1UKBA 2OCPA 2I2DA 2GJAA 1ZZEA 1N5JA 1YJAA 3SZPA 3P9KA 1FNNA 4RK6A 4KR6A 3FD8A 4C20A 4MV5A 3OE5A 1F9AA 3NI2A 3LKBA 4URHA 3QYBA 4XWGA 2X6RA 2JHGA 2YNMA 4RMIA 4LTDA 2LPMA 1WD5A 4GLOA 1XZ8A 1B1CA 3UKGA 4EKIA 4FFLA 4F85A 5BPIA 2NAFA 3NDJA 4F6RB 4M9RA 5ADVA 2CDCA 3EEFA 1CD5A 4X9XA 3GN1A 3L7CA 3MEXA 5HS9A 2M5WA 1YJXA 5AI6A 3PHHA 3O8LA 3O5AA 1MKYA 5HBRA 3OOUA 5F7OA 5GAGJ 4EWLA 3AT1A 4EM6A 5DXJA 4ARCA 3UZUA 4YRFA 2X7HA 3VZBA 2BP7A 2IBMA 4FMCF 5HILA 2B0JA 1ORDA 4LGTA 4QYIA 5FIUA 3PPIA 2WDZA 2MGQA 3JYHA 3ZI4A 1KE2A 2JS7A 2BEWA 1VYHA 4MYTA 4G6TB 4LGVA 2COBA 2JFBA 4NYMR 1WKBA 3GBPA 3D6NB 4HADA 1D2GA 4JHXA 1U9JA 2X8JA 5IVPA 3UY4A 1E69A 4INAA 1Y5LA 5GM1A 2XJ9A 4DW8A 3RTCA 2Q0XA 1O1YA 1XC7A 4ND1A 1P3JA 2OFFA 3Q6NA 2IYEA 1GRRA 5L3SB 4LRUA 3KJNA 1W36C 5EIOA 3DVAA 4ZGGA 1RAGA 2QMQA 1KMHA 4CHTA 1W5SA 2VZ8A 4YWHA 3P2MA 2FDRA 3HVRA 5JI3E 1K78A 1LPOA 1O3TA 2ZMEB 4OLBA 3BG9A 3LPAA 1USSA 2W7NA 5DNEA 4IPAA 1MBJA 4HWOA 2WZBA 3UFXA 3H16A 4YIIA 2WJ6A 3AB8A 3VJKA 3OY9A 4YREA 1JI3A 4YNBA 4L4ZA 2XF8A 2K4BA 1OLTA 3GUUA 5IARA 4NYIQ 1CRZA 4OHRA 3U1DA 1D6MA 2D62A 3ZU6A 2BFFB 4OI4A 4NCKA 5AK6A 1Z88A 1YVDA 3AAFA 1IU9A 1YDFA 1FWZA 2HK8A 4PG6A 2EFHB 1JLMA 4DUZD 3PTAA 2V7EA 2Z58A 2NU9B 2ZP1A 1NOJA 4CCYB 1T6YA 3FLMA 3ZHXA 3BMCA 2Y9ZA 3PPYA 4PAQA 2O8CB 2X9DA 2OCAA 3KL2A 2MHCA 3NWBA 5COAA 3C7JA 3PIPF 4M9XA 3IWZA 1FXUA 2H1VA 4E88A 2P9CA 3H19A 2I3ZA 1BR1A 3QYFA 4UXNA 4YK7A 5EYPB 1V26A 4DSAA 1RE1A 4V3CA 4Q1VA 1JR2A 3I4PA 1GNTA 2A8YA 2R6CA 1R9GA 4QU9A 3N0VA 4W5JA 5H20A 3WBFA 1NYQA 4PPFA 1JN0A 4DUYB 2IDMA 3KAKA 3KUDA 3ADDA 3UXYA 1G7CA 4UHBA 2R8XA 1ZKDA 4CIVA 3ANYB 3VSAA 5K0ZA 1T0BA 1CJMA 1U0JA 1GZ5A 1BHSA 4R9RA 4ZAXA 4G24A 2P69A 2AFHA 4CF3A 4TT8A 3BFPA 2R7KA 5H59A 3ZMZA 4MARA 2Q2NA 1XR3A 4LG3A 1JIKA 1PUEE 3OZRA 5EC8A 4J7AA 5AHKA 4M0FA 1R5ID 3OQIB 1I24A 4EG4A 3WIEA 2HZ7A 2CLLB 3ZQ4A 4ZVOA 4F4DA 2YZGA 1W5TA 2RG7A 3HBAA 4GDMA 2FZKA 1X0XA 4UHKA 3CYFA 2HRRA 4UDXX 5GP1A 1WCWA 3HTXA 5DLPA 3SJZA 2VK4A 4OQZA 1LWNA 2B1QA 4UHTA 3D2CA 1UP6A 2ZSIA 1HKHA 1NR7A 1CF9A 4DZJA 2YHBA 2D59A 2NZVG 3RR2A 3QLJA 2BY0A 1B6TA 3H5IA 3L1IA 3L2RA 3I0TA 4D98A 2EBIA 1A50B 4WNAA 2BHSA 2EA2A 4XOPA 1LV7A 4UTVA 1X1PA 4I4NA 1IDOA 1KI9A 2B0LA 1IAWA 3GCXA 5IT9K 2J8ZA 2ZTUA 2XJ4A 4M83A 4HQEA 1XN1A 3EUWA 2O23A 2NUTA 1RKBA 1WJGA 2IZ5A 5K5RA 5LOVF 2C03A 1QF6A 3EUAA 2X2PA 3EXG2 5DN6D 2ZBFA 1FJLA 3LBIA 5JOQA 3E4DA 2W4IA 4P83A 1QE5A 4F21A 5AW6A 1S2IA 2D06A 5B2ZA 1C7RA 1SFRA 2VWHA 3NALA 5E8RA 4MOWA 1A0OA 2F4MB 1YBAA 2PFSA 1ZJJA 3BOSA 4BYYA 1BXKA 3EVEA 2HHJA 3INGA 3MHTA 3EIFA 1NK2P 1D6JA 3GFSA 4B33A 1G42A 3S2EA 1KK2A 5DTJA 4FOTA 2LIPA 1YNSA 2HF7A 2G8NA 1MH3A 5KI6A 4BNMA 3N6XA 4YIHA 2G4CA 4X93A 5TISC 1ICIA 2ZIGA 4QNRA 3I4FA 2QLTA 1F1ZA 4FQ7A 3CVXA 5EIBD 5KSOA 4L95C 4O2AA 1TTPB 1JLHA 3MXOA 4HDMB 4I4LA 3ROUA 3RYTC 5L4SA 1U2DA 1X1CA 4RB0A 2BVMA 4NPCA 3VYUB 1YWGO 4LE1A 2R93J 2LSOA 2ADMA 5EWLA 1Z2NX 3MLEA 1UPUA 4ZALA 1XALA 2BN4A 2Q8QA 4C06A 3PWTA 3G89A 1SXHA 5JDIC 4N0DA 3EA4A 5DNVA 3VPSA 2VJPA 1R88A 2FPGB 1B6RA 2PKWA 3G68A 4MR7B 2C2MA 2CLSA 1AF7A 3Q8LA 1TNTA 1VMDA 2Q5LA 1WCXA 4G0ZA 1EFLA 4JJEA 2Z56A 3EOAI 4ZO7A 5B4UA 4Z0NA 5F33A 3REGA 1V11B 4BO2A 3F8SA 4OLJA 4MQUA 3BJRA 2WSBA 3O8GA 3DCIA 2ECCA 2QD5A 4Z6YA 3I6MA 3IP1A 5L51A 3NTOA 1UJ8A 2F4VB 5IKXA 1Z5ZA 5CFMA 5JE8A 1AOYA 1I8TA 1LEBA 1AUXA 5LNK6 1WP9A 1R6DA 1I7QB 3JD3A 2ZXJA 1MV8A 5B5EC 1ZU5A 2QPAA 5IRCD 2QQ0A 4EI9A 1JJVA 1E63A 2CL7X 3VC7A 4JYAD 5HFNA 4DY4A 1KU3A 3RHZA 3MWJA 4JENA 1IOVA 2TS1A 3HRIA 1Y1RA 1QE3A 2AC2A 3RVQA 4MVJM 4DLKA 1YKGA 1I3AA 4MLCA 1SHTX 1GAQA 3IEUA 1EBBA 1SOWA 4HNRA 2IEYA 6NULA 2NXWA 3CDIA 4JJ6A 2RONA 1OR7A 4BE2A 4MDEA 1QNLA 1VRVA 3PGXA 3AG2H 2B37A 5LLSA 1YC2A 4A93J 2DFHA 4Q3LA 2YS9A 4XX0A 1M33A 1R0YA 2YX7A 5BO5A 1BXZA 1KZ7B 1KYYA 2X2FA 1VLMA 2ZJAA 2DA4A 4WZ6A 3VPCA 1B6SA 1MSFC 2AX4A 2PA3A 1TNSA 3K2QA 1SH7A 4HQ0A 1RXIA 4TL9A 2Q7OE 5CH8A 2BFWA 3OEEA 1H8HA 2H4HA 5JS2A 2ZRDA 3LQKA 1BKDR 4FNAA 3LRPA 3FNBA 1FLIA 4XKWA 1L5SA 2G1KA 2XNDD 1EVKA 2DBZA 3JAME 3DAOA 3LMKA 4H27A 3AF6A 2V55B 1G5PA 5LRSA 1T6SA 4FR5A 3V4OA 3DMPA 4HZIA 1J5EB 4PBTA 5D87A 4V03A 1KA9H 2E35A 4GQAA 3KSDO 1X2MA 3STYA 3DDWA 1N7JA 4YCNA 5ALMA 1IZYA 5M5WJ 4I9HA 1W6UA 5GJCA 3GZNB 1R0LA 4WERA 4GX0A 2AOVA 3K53A 1A8UA 3EY4A 4UNIA 1CU1A 5ADWA 5LHGA 5IBQA 3VJRA 1WDMA 2B82A 3MW8A 2QI9F 1XXLA 3GB9A 3EUHA 2JD2A 3BYZA 3BTJA 4TLEA 3UATA 2VSQA 1W85B 4MV1A 1NBAA 4IINA 1Z2AA 1UBTS 1SBQA 4AMZA 2WFZA 4ZN6A 4PLTA 1WETA 3C3BA 2Q5IA 1TAQA 3OTQA 3T15A 5DYGA 3EXHC 3DZJA 4M46A 2QUAA 1IB6A 3SYKA 3IAUA 1GNLA 1RLMA 2VF8A 2WJ3A 2O1SA 4IUDS 1XMSA 4MGKR 2PTGA 1RWVA 3D59A 2LKDA 5FTNA 2JDID 2G70A 3QI2A 3H4MA 1W25A 2I6TA 3W34A 4Z53A 3GUDA 4L73A 2V03A 3IVGA 3KEQA 5A4JA 2FF7A 1G3YA 2XVYA 2OO5C 5C46F 5I8WA 1JMKC 3WTZA 2JT1A 1C1HA 4XGRA 2F8LA 3MGCA 3IULA 3OHMA 1H9CA 3GGCA 1F0KA 4CW7A 4ZV7A 1TXGA 1CEEA 5AKKA 1YAJA 2PL3A 2IHKA 4DFDA 4IMPA 2OQVA 4YG2F 1DTWB 1G21B 2PV7A 5BSRA 1ICEA 2YV4A 1FNSA 4EJ2A 1F17A 2ZBDA 1EV7A 4XD7A 1W88A 1PIWA 3N3AC 3W8FA 3RZOJ 1MDFA 2BGCA 4EHFA 4XQ9A 4LNUA 2INGX 2DHQA 4YQEA 3RYHB 1FDUA 1C4KA 2XLCA 2OMKA 3LV8A 1ZAYA 3GGOA 4UBMA 3FWKA 1HDGO 1YMUA 4CCSA 3J80K 3HFGA 4WXPA 3VKFA 1Z35A 1UBOS 2KTLA 4YIRX 1X38A 2D3TA 1JG4A 2YQZA 3VR4D 4MO9A 4G1EB 1LS1A 1XQWA 3LNTA 4LLLA 1CULC 1D03A 1BOBA 3AYXB 5A6VA 3ESAA 4AZ0A 1JAHA 3UMCA 3IBTA 3VO1A 2ATIA 2VR1A 1AS2A 5EUBA 3VRHA 2O7QA 4XL9A 3BK1A 2JCBA 3D6UA 1KZ6A 5IC6A 1N2XA 4P80A 5FPHA 2DWOA 5B1DA 3L7NA 2JRMA 1LDJA 3GA0A 2Q4DA 1JEYA 4BASA 4US0R 4QPOA 2HVSA 3H8VA 4X0EA 3HGQA 5AKLA 3CUVA 2FI1A 3VR2A 3ITEA 5HIMA 1KL7A 1VE5A 4Y1EA 4F1JA 2LDXA 4RD0A 4BXXJ 4DLUA 4BU2A 2OECA 4ARAA 2RAFA 4R9NA 3KR2A 1DCFA 4B1RA 1AQYA 2O0MA 2Z30A 1KTIA 3FWZA 1PLKA 4OM8A 4YRNA 1QVVA 4BY7J 3DCYA 4I1PA 1X7DA 3ZDBA 3M4OJ 1Z62A 2II6A 3HTUA 1PX2A 1G18A 1IUKA 2Y1KA 4NARA 4YAWA 4IRHA 4F71A 5FNVA 5HF6A 4XB6B 4B0PA 3KG2A 4ZCSA 3BR6A 3VOBA 5TT1A 3R3UA 4QM6A 1IUOA 3JQDA 4FCTA 2VNHA 3ZGZA 4QGSA 4UXIA 5AHXA 1ZIYA 4PAMA 1AKNA 3JWEA 4ZTFA 4Z3DA 2DA1A 4CBVA 4BV8A 3ZUGA 4Y2PA 4EY8A 2VHVA 1ONVA 4E4TA 5FORA 1NXVA 1GVHA 3DLLF 3ZHVA 3H75A 5KVCA 2NO1A 3T3NA 1CUXA 2BDUA 3WGVA 1OROA 4PPYA 1GTZA 4XE5A 4FCVA 4L4UA 2IVZA 2X6YA 2K9QA 3GEZA 4QSHA 4YP5A 4GGGA 4ZOQI 4FINA 1ZXXA 1FQKA 2NM0A 5IJAA 2NZ8A 4HVTA 3N6RA 2R7NA 4NBNA 3GZTB 2B8NA 2BGKA 3OICA 1VE9A 1K88A 5EERA 5LQUA 2ONCA 1E20A 4JI7D 1ILWA 1KZYC 4HTFB 5JCOA 4Y3OA 4GI1A 3LYLA 1XAIA 1BVHA 3PQ6A 1YLFA 4MV8A 3ABSB 4UE6A 2VPRA 1GD1O 3W9BA 1C8LA 4K8OA 1O4VA 3BWBA 4Q9KA 2Z6VA 1YASA 2VRCA 2Q1XA 2O5VA 4NCJA 2RGRA 2IVFA 3UOGA 1B93A 3TKYA 1OJ7A 1BH6A 1RR6A 1J0CA 4RLHA 3VR1A 3ZE7A 1YZFA 3GUVA 1NI5A 3B78A 2WTBA 4M89A 3ED5A 4IZIA 5TNXA 2BEUA 4X24A 2JBHA 4MS3A 1Q6ZA 2Y1OA 3OYFA 1LRLA 2WJPA 1UC9A 2D5AA 3FOAA 4FI3F 1FXSA 3HP1A 2OXFA 5K6AC 5LLTA 4B6SA 2EIKH 4TLBA 2ISTA 2DWCA 2GASA 3IBGA 5DOZA 3VHLB 5DI3B 2BSXA 2Y99A 1N6LA 1XDBA 4DLWA 4RL6A 5A5DA 2DMTA 1VHTA 2JTVA 4FE4A 2GYYA 5GIPE 3DE2X 4O2BF 4CMAA 3OOJA 2ZUVA 1OHHD 1S1CA 4E13A 2DBVO 1OXUA 4G4JA 5EJ8A 4LF8D 1Z6RA 4YS6A 1U7DA 1YS6A 5LZ5A 2WVAA 2XKPA 4D3XA 2QD3A 5IKPA 4NQWB 3W4JA 6Q21A 2EFWA 2GPTA 4YT4A 3S2WA 4Q4JB 2WF9A 3DLAA 1OISA 1M67A 3P2IA 1FSPA 4IKOA 1XEAA 5DM70 3GA7A 3PL8A 4G4GA 4F4HA 4MXDA 2WPDD 4J0FA 3MWKA 1ZISA 3KUCA 3S2YA 2XKBA 1IK4A 2IQ5A 4G0QA 5AFSA 2R79A 4Y17A 4RY2A 1P7VA 2NU9A 5IDVA 1MW7A 1C7QA 2WU8A 4C5BA 4BHTA 1T98A 2I8LA 2C54A 3NIGB 4BCDA 2O8CA 4J4TA 1EE9A 3RDPA 2NU7B 1H1LA 3TP3A 1F43A 3CRVA 3K3PA 2FBKA 3PQJA 2W4QA 4HDSB 1E64A 4RCVA 3RGWS 2W6QA 3UCFA 2O52A 5FI5A 2C3UA 4KX3A 2EWMA 1SZPA 1VE3A 3IP9A 3DE0X 4M60A 2CNBA 1K4SA 2HJ9A 4X97A 2P79A 4BNYA 3MXTA 3T5CA 5KSWB 4REOA 2DYSH 3LDFA 3AEKB 1E3TA 3A1DA 2P9ZA 1UPAA 3A37A 5LHIA 5KHLB 2J6CA 5KOJB 3B3GA 1MOZA 2AF3C 2ZOSA 2MLKA 3IAS6 1SBHA 2AH5A 3GG2A 1ZHHA 4PR0A 4EEKA 1YUNA 3MYRA 4UUTA 5A6SA 1IY2A 3E2PA 3OESA 4LYGA 1Z5NA 4MGHA 4BTVA 4WFKA 4OHBA 2W24A 3VYRB 2Y0CA 4V0ME 1S9DA 4XB2A 3S8MA 5HDGA 1B8UA 1T56A 4J01A 4DQXA 3LQ2A 3PX7A 1IVYA 1K4YA 1XEFA 2J0UB 2DA2A 3M6VA 3M8KA 2O2CA 2QAJA 3KCNA 4PBRA 4DMLA 5KQLA 1P9KA 1BHJA 1U98A 5CT6A 6GPBA 1QP0A 4GFDA 5IUJC 3E9QA 4B80A 4COOA 4ER0A 2WAQN 3EBLA 2OJED 1K86A 5KNCH 3B5IA 5B55A 4DDMA 1CHNA 5IYDJ 1NXSA 3S2FA 2FFBA 5E4JA 4RPCA 1U3TA 3D02A 3VKVA 1VQNI 2BKVA 4RFSA 4K6HA 5IYZB 4B5LA 2AWNA 4F3RA 1O6FA 3H2IA 3BD9A 4PW0A 3TLGA 4PNPA 2E6UX 4X20B 4CMGA 5ITZB 1XEWY 1R9TJ 4R8RA 3HK2A 4Q7MB 1G38A 5F77A 2W82A 4L9SA 4HHEA 2NT4A 5GV7A 1OFHA 1SM4A 2OQ2A 4D5EA 1TIKA 2WJHA 3CX7A 2GEJA 2UUAB 4BN4A 1NVAA 4CM9D 2Q8KA 5CFRA 4F12A 4R6XA 2FFQA 4G97A 1G8YA 4DV7D 2FRXA 3T1YD 1XRPA 1ZGBA 4S2EA 2H1RA 3E48A 4YMVA 5ICMA 1P6UA 1YTLA 1REQA 4YMHA 3AY6A 4JB2A 2R6JA 1Q3KA 2ZIFA 5D00A 4QYWA 3BJMA 1U9YA 1RI2A 3WNVA 2FDXA 3DUFA 4B7XA 3U4AA 1FLVA 3SDBA 4RZHA 2P91A 4LZJA 3W2TA 3WFJA 2WD8A 3OX4A 5LWHA 2AKAB 1V37A 4LQCA 2QMZA 1XNQB 2ZYDA 3RS8A 2DH6A 2O8XA 4FGJA 1E77A 1ZXBA 4OYLA 3THXA 2M34A 3RANA 3UICA 2FWRA 3HA2A 3LUJA 3INYA 4O4HB 4PXSA 3GTGJ 4IZ6A 2BL4A 2IHZA 3MVPA 4RJJA 1UFKA 3UJ8A 4CA0A 3ZMTA 1P60A 5U1PA 2G9VA 3IOEA 3OYCA 4LK2A 3ZQ6A 2G3YA 1P77A 2C98A 4B73A 3TIFA 1T36B 3KLBA 5IVHA 3A4NA 5C31A 2J5QA 3OE1A 4UNQA 1EEHA 1PFQA 2VNKA 1NQWA 4DC9A 3RYCB 5KMGA 4X20A 5A02A 1IY0A 3G1OA 4KGXA 5E3HA 3FKJA 4FETA 2PQMA 4BE9A 3CNEA 3DBLB 2DPGA 2RB4A 1KIFA 1HYEA 2A9PA 3UG7A 1M75A 3RKWA 2O7SA 4HWPA 2JA5J 2PUEA 2H17A 2DT7B 3G4SI 3O7MA 3BERA 2OCXA 4OCZA 2P65A 2GKOA 1QC5B 5A3SA 4OUDA 1P2BA 3PJGA 5HKKA 4NE9A 5ALEA 4IHJF 3RU9A 5ANRB 4G1VA 1JT2A 1XKTA 2MH2A 1GDTA 4YIKA 3U4MA 2Q41A 2BFDA 2GXBA 2W2QA 2YNMD 4YP6A 2O7RA 4I8DA 5HE8A 3TFQA 4ZKEA 4J16A